Supplementary Information

Size: px
Start display at page:

Download "Supplementary Information"

Transcription

1 Supplementary Information The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis Marta C. Marques a, Cristina Tapia b, Oscar Gutiérrez-Sanz b, Ana Raquel Ramos a, Kimberly L. Keller cǂ, Judy D. Wall c, Antonio L. De Lacey b, Pedro M. Matias a,d*, Inês A. C. Pereira a * Authors Affiliations a Instituto de Tecnologia Química e Biológica António Xavier, Universidade Nova de Lisboa, Av. da República, Oeiras, Portugal b Instituto de Catálisis y Petroleoquímica, CSIC. c/ Marie Curie 2, Madrid, Spain c Biochemistry Department, University of Missouri, Columbia, MO, USA and ENIGMA (Ecosystems and Networks Integrated with Genes and Molecular Assemblies), Berkeley, CA, USA d ibet, Instituto de Biologia Experimental e Tecnológica, Apartado 12, Oeiras, Portugal ǂ Current address: Biology Department, William Woods University, Fulton, MO, USA *corresponding authors: ipereira@itqb.unl.pt, matias@itqb.unl.pt

2 Supplementary Results Supplementary Table 1 Molar concentrations of iron (Fe) and nickel (Ni) determined by ICP-AES. Protein Fe content (M) Nickel content (M) Ratio (Fe:Ni) [NiFeSe] m hydrogenase 1.50 x x r[nifese] hydrogenase 2.61 x x Ni-Sec489Cys hydrogenase 3.94 x x

3 Supplementary Table 2 Data collection and processing statistics. rnifese-ox rnifese Sec489Cys-Ox Ni-Sec489Cys Ni-Sec489Cys-Ox Data collection Space group C2 C2 C2 C2 C2 Cell dimensions a, b, c (Å) , 63.46, , 62.77, , 62.66, , 62.86, , 63.18, ( ) 90, , 90 90, , 90 90, , 90 90, , 90 90, , 90 Resolution (Å)* ( ) ( ) ( ) ( ) ( ) R merge (0.315) (1.430) (0.723) (0.622) (1.177) I / I 13.7 (2.2) 22.3 (1.6) 11.6 (2.0) 16.1 (1.6) 10.0 (1.3) Completeness (%) 96.9 (70.8) (99.9) 99.4 (88.4) 96.9 (87.9) 97.7 (95.9) Redundancy 3.7 (2.0) 13.0 (11.5) 4.0 (3.9) 2.9 (2.5) 4.5 (4.2) Refinement Resolution (Å) ( ) ( ) ( ) ( ) ( ) No. reflections (5860) ** (27207) ** (3673) (9003) (4686) R work (0.228) (0.260) (0.215) (0.250) (0.232) R free (0.242) (0.274) (0.260) (0.273) (0.260) No. atoms Protein Ligand/ion Water *** B-factors Protein Ligand/ion Water *** R.m.s. deviations Bond lengths (Å) Bond angles ( ) * Values in parentheses are for highest-resolution shell; ** Friedel mates were treated as independent reflections; ***includes atoms from glycerol molecules

4 Supplementary Fig. 1. (a) Activity-stained native PAGE of crude extracts (50 μg): 1. D. vulgaris cells carrying membrane ([NiFeSe] m ) and soluble ([NiFeSe] s ) forms of the [NiFeSe] hydrogenase; 2. IPMM01 cells expressing the r[nifese] hydrogenase; (b) Western blot of cell crude extracts (10 g of total protein) using antiserum raised against the native [NiFeSe] hydrogenase 29 : 3. IPMM01; 4. IPMM02; (c)12.5% SDS-Page stained with Coomassie blue: 5. LMW Marker; 6. r[nifese] hydrogenase; 7. Sec489Cys hydrogenase.

5 Supplementary Figure 2 I The NiFeSe active site and its surroundings in the crystal structure of the anaerobically purified and crystallized r[nifese] hydrogenase. (a) View of the partially refined structure with its corresponding 2 F o F c and F o - F c maps, showing evidence of one additional Ni site and two additional Sec positions. The 2 F o F c map (gray mesh) is drawn at the 1.5 map r.m.s. level and the F o F c map is represented at the 3.5 (green mesh) and -3.5 (red mesh) map r.m.s. levels. (b) View of the final refined structure superimposed with the anomalous Fourier map (orange mesh) drawn at the 4.5 map r.m.s. level and calculated with phases from the partially refined structure represented in (a). The [NiFe] binuclear center and the side-chains of its coordinating protein ligands are represented in ball-and-stick and the HysA protein chain is represented as a semitransparent cartoon. Atom colors are brown for iron, green for nickel, gold for sulphur, red for oxygen, light gray for carbon, blue for nitrogen and orange for selenium. Hydrogen atoms are omitted for clarity.

6 Supplementary Fig. 3. The active site and the proximal [4Fe-4S] cluster in the crystal structure of the aerobically purified and crystallized r[nifese] Hydrogenase (r[nifese]-ox). The [NiFe] binuclear center, the proximal [4Fe-4S] cluster and their coordinating ligands are represented in ball-and-stick. Atom colors are brown for iron, green for nickel, gold for sulfur, red for oxygen, light gray for carbon, blue for nitrogen and orange for selenium. The HysA and HysB protein chains are represented as semitransparent cartoons. The 2 F o F c maps are drawn (gray mesh) at the 1.5 map r.m.s. level, the F o F c maps are represented at the

7 3.5 (green mesh) and -3.5 (red mesh) map r.m.s. levels and the anomalous Fourier maps are represented at the 4.5 (orange mesh) map r.m.s. level. (a) View of the final refined structure for the active site with three different side chain conformations for Sec489 and its corresponding 2 F o F c and F o F c maps. (b) View of the final refined structure for the active site with three different side chain conformations for Sec489 superimposed with its corresponding anomalous Fourier map. (c-e) Separate views of the three different side chain conformations for Sec489. (f) View of the final refined structure for the proximal [4Fe-4S] cluster and its corresponding 2 F o F c and F o F c maps. The [4Fe-4S-2O] oxygen-damaged form of the cluster is drawn with thinner sticks and smaller spheres. (g) View of the final refined structure for the canonical cubane form of the proximal [4Fe-4S] cluster and its corresponding anomalous Fourier map. (h) View of the final refined structure for the [4Fe-4S-2O] oxygen-damaged form of the proximal [4Fe-4S] cluster and its corresponding anomalous Fourier map. The yellow dashed line highlights the coordination of one of the Fe atoms by Glu77. In (f-h) the red spheres denote conserved water molecules in the crystal structures of [NiFe{Se}] hydrogenases located near the proximal [4Fe-4S] cluster.

8 Supplementary Fig. 4 Circular dichroism spectra of oxidized r[nifese] and Sec489Cys hydrogenases (0.1 μm in 20 mm Tris-HCl ph 7.6). Data are the average of five runs and are represented as black (r[nifese]) and salmon (Sec489Cys) curves after smoothing.

9 Supplementary Figure 5: H 2 production activities (μmol of H 2 per mg of Sec489Cys Hydrogenase) after treatment of Ni-depleted Sec489Cys hydrogenase with NiCl 2 in 20 mm Tris-HCl buffer, during cell disruption and/or incorporation. Molar ratios relative to the hydrogenase are indicated on the x axis. The values are mean values ± s.d. from two independent experiments.

10 Supplementary Figure 6 I ph dependence of enzymatic activities for the Ni-Sec489Cys variant versus the r[nifese] hydrogenase. (a) Dependence of the D 2 /H + isotope exchange activity (% maximal activity) of r[nifese] and Ni-Sec489Cys hydrogenases, and comparison of the rate double exchange production (H 2 ) with the single exchange production (HD). (b) ph dependence of the H 2 uptake activity (% maximal activity) of r[nifese] and Ni-Sec489Cys hydrogenases, at 37 C. The maximal enzyme activity for each hydrogenase is expressed as a percentage of the highest activity. Values represent mean values of at least three independent experiments ± s.d.

11 Supplementary Figure 7 I The active site and its surroundings in the crystal structure of the anaerobically purified and crystallized Ni-Sec489Cys hydrogenase. View of the final refined structure superimposed with corresponding anomalous Fourier map. Red dashed lines represent presumed chemical bonds, not fully drawn for clarity. The [NiFe] binuclear center and its coordinating ligands are represented in ball-and-stick. Atom colors as in Figure 1. Hydrogen atoms were omitted for clarity. The HysA protein chain is represented as a semitransparent cartoon. The anomalous Fourier map is colored and contoured as in Figure 2.

12 Supplementary Fig. 8. The active site and the proximal [4Fe-4S] cluster in the crystal structure of the aerobically purified and crystallized Ni-reconstituted Sec489Cys hydrogenase (Ni-Sec489Cys-Ox). The [NiFe] binuclear center, the proximal [4Fe-4S] cluster and their coordinating ligands are represented in ball-and-stick. Atom colors are brown for iron, green for nickel, gold for sulfur, red for oxygen, light gray for carbon, blue for nitrogen and orange for selenium. The HysA and HysB protein chains are represented as semitransparent cartoons. The 2 F o - F c maps are drawn (gray mesh) at the 1.5 map r.m.s. level, the F o - F c maps are

13 represented at the 3.5 (green mesh) and -3.5 (red mesh) map r.m.s. levels and the anomalous Fourier maps are represented at the 4.0 (orange mesh) map r.m.s. level. (a) View of the final refined structure for the active site and its corresponding 2 F o - F c and F o - F c maps. (b) View of the final refined structure for the active site superimposed with its corresponding F o - F c and anomalous Fourier maps. The "x" marks the probable position of a second Ni site, less than 1 Å distant from Ni-1 and not included in the refinement. (c-e) The probable predominant structural forms of the active site, as interpreted from the final refined structure: (c) The Ni-1-containing component, with the Ni-1 site bound to Cys489 in its sulfinate form, Cys75 in one of its sulfenate forms and a bridging oxy ligand. (d) The Ni-2-containing component, with the Ni-2 site (represented by Ni-1) bound to Cys489, Cys75 in the other sulfenate form and a bridging oxy ligand. (e) The Ni-depleted major component, with Cys489 in its sulfinate form and two conformations of Cys75 forming a disulphide bond with Cys78. (f) View of the final refined structure for the proximal [4Fe-4S] cluster and its corresponding 2 F o - F c and F o - F c maps. The [4Fe-4S-2O] oxygen-damaged form of the cluster is drawn with thinner sticks and smaller spheres. (g) View of the final refined structure for the canonical cubane form of the proximal [4Fe-4S] cluster and its corresponding anomalous Fourier map. (h) View of the final refined structure for the [4Fe-4S- 2O] oxygen-damaged form of the proximal [4Fe-4S] cluster and its corresponding anomalous Fourier map. The yellow dashed line highlights the coordination of one of the Fe atoms by Glu77. In (f-h) the red spheres denote conserved water molecules in the crystal structures of [NiFe{Se}] hydrogenases located near the proximal [4Fe-4S] cluster.

14 Supplementary Fig. 9. The active site in the Sec489Cys variants of the D. vulgaris Hildenborough [NiFeSe] hydrogenase and standard [NiFe] hydrogenases. Stereoviews showing a superposition between the Ni- Sec489Cys crystal structure and the crystal structures of the standard [NiFe] hydrogenases from D. vulgaris Myiazaki F (PDB 1wuh), D. fructosovorans (PDB 1yqw) and D. gigas (PDB 1frv). Only one heterodimeric biological unit from 1yqw and 1frv is represented. Panels a and b display views rotated by 180º about an horizontal axis. The r.m.s. deviation between aligned C atoms in the large subunits w.r.t. the Ni-Sec489Cys structure is ca. 1.2 Å. Single-letter residue codes indicate different residues between Sec489Cys [NiFeSe] hidrogenases (black) and standard [NiFe] hydrogenases (red). The Ni and Fe atoms of the binuclear active site as well as the water molecules from all structures shown are represented as small spheres; the location of the four cysteine residues that coordinate the NiFe binuclear active site is indicated using the sequence numbering of the Ni-Sec489Cys structure; the proximal [4Fe-4S] cluster is labeled Prox; for all structures, non-carbon atom colors are blue for nitrogen, red for oxygen and gold for sulfur; carbon atoms are colored green for Ni-Sec489Cys, yellow for 1wuh, grey for 1yqw and salmon for 1frv.

SUPPLEMENTARY INFORMATION. doi: /nature07461

SUPPLEMENTARY INFORMATION. doi: /nature07461 Figure S1 Electrophysiology. a ph-activation of. Two-electrode voltage clamp recordings of Xenopus oocytes expressing in comparison to waterinjected oocytes. Currents were recorded at 40 mv. The ph of

More information

Nitrogenase MoFe protein from Clostridium pasteurianum at 1.08 Å resolution: comparison with the Azotobacter vinelandii MoFe protein

Nitrogenase MoFe protein from Clostridium pasteurianum at 1.08 Å resolution: comparison with the Azotobacter vinelandii MoFe protein Acta Cryst. (2015). D71, 274-282, doi:10.1107/s1399004714025243 Supporting information Volume 71 (2015) Supporting information for article: Nitrogenase MoFe protein from Clostridium pasteurianum at 1.08

More information

The structure of vanadium nitrogenase reveals an unusual bridging ligand

The structure of vanadium nitrogenase reveals an unusual bridging ligand SUPPLEMENTARY INFORMATION The structure of vanadium nitrogenase reveals an unusual bridging ligand Daniel Sippel and Oliver Einsle Lehrstuhl Biochemie, Institut für Biochemie, Albert-Ludwigs-Universität

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Table of Contents Page Supplementary Table 1. Diffraction data collection statistics 2 Supplementary Table 2. Crystallographic refinement statistics 3 Supplementary Fig. 1. casic1mfc packing in the R3

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11054 Supplementary Fig. 1 Sequence alignment of Na v Rh with NaChBac, Na v Ab, and eukaryotic Na v and Ca v homologs. Secondary structural elements of Na v Rh are indicated above the

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION www.nature.com/nature 1 Figure S1 Sequence alignment. a Structure based alignment of the plgic of E. chrysanthemi (ELIC), the acetylcholine binding protein from the snail Lymnea stagnalis (AchBP, PDB code

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Table 1: Amplitudes of three current levels. Level 0 (pa) Level 1 (pa) Level 2 (pa) TrkA- TrkH WT 200 K 0.01 ± 0.01 9.5 ± 0.01 18.7 ± 0.03 200 Na * 0.001 ± 0.01 3.9 ± 0.01 12.5 ± 0.03 200

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10458 Active Site Remodeling in the Bifunctional Fructose-1,6- bisphosphate aldolase/phosphatase Juan Du, Rafael F. Say, Wei Lü, Georg Fuchs & Oliver Einsle SUPPLEMENTARY FIGURES Figure

More information

SI Text S1 Solution Scattering Data Collection and Analysis. SI references

SI Text S1 Solution Scattering Data Collection and Analysis. SI references SI Text S1 Solution Scattering Data Collection and Analysis. The X-ray photon energy was set to 8 kev. The PILATUS hybrid pixel array detector (RIGAKU) was positioned at a distance of 606 mm from the sample.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11524 Supplementary discussion Functional analysis of the sugar porter family (SP) signature motifs. As seen in Fig. 5c, single point mutation of the conserved

More information

Diphthamide biosynthesis requires a radical iron-sulfur enzyme. Pennsylvania State University, University Park, Pennsylvania 16802, USA

Diphthamide biosynthesis requires a radical iron-sulfur enzyme. Pennsylvania State University, University Park, Pennsylvania 16802, USA Diphthamide biosynthesis requires a radical iron-sulfur enzyme Yang Zhang, 1,4 Xuling Zhu, 1,4 Andrew T. Torelli, 1 Michael Lee, 2 Boris Dzikovski, 1 Rachel Koralewski, 1 Eileen Wang, 1 Jack Freed, 1 Carsten

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Dph2 SeMet (iron-free) # Dph2 (iron-free) Dph2-[4Fe-4S] Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell dimensions a, b, c (Å) 58.26, 82.08, 160.42 58.74, 81.87, 160.01 55.70, 80.53,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Fig. 1 Influences of crystal lattice contacts on Pol η structures. a. The dominant lattice contact between two hpol η molecules (silver and gold) in the type 1 crystals. b. A close-up view of the hydrophobic

More information

Supplementary Figure 1. Biochemical and sequence alignment analyses the

Supplementary Figure 1. Biochemical and sequence alignment analyses the Supplementary Figure 1. Biochemical and sequence alignment analyses the interaction of OPTN and TBK1. (a) Analytical gel filtration chromatography analysis of the interaction between TBK1 CTD and OPTN(1-119).

More information

Supporting Information. UV-induced ligand exchange in MHC class I protein crystals

Supporting Information. UV-induced ligand exchange in MHC class I protein crystals Supporting Information for the article entitled UV-induced ligand exchange in MHC class I protein crystals by Patrick H.N. Celie 1, Mireille Toebes 2, Boris Rodenko 3, Huib Ovaa 3, Anastassis Perrakis

More information

Supplementary Figures

Supplementary Figures 1 Supplementary Figures Supplementary Figure 1 Type I FGFR1 inhibitors (a) Chemical structures of a pyrazolylaminopyrimidine inhibitor (henceforth referred to as PAPI; PDB-code of the FGFR1-PAPI complex:

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Table S1 Kinetic Analyses of the AMSH-LP mutants AMSH-LP K M (μm) k cat x 10-3 (s -1 ) WT 71.8 ± 6.3 860 ± 65.4 T353A 76.8 ± 11.7 46.3 ± 3.7 F355A 58.9 ± 10.4 5.33 ± 0.30 proximal S358A 75.1

More information

Supplemental Information. Molecular Basis of Spectral Diversity. in Near-Infrared Phytochrome-Based. Fluorescent Proteins

Supplemental Information. Molecular Basis of Spectral Diversity. in Near-Infrared Phytochrome-Based. Fluorescent Proteins Chemistry & Biology, Volume 22 Supplemental Information Molecular Basis of Spectral Diversity in Near-Infrared Phytochrome-Based Fluorescent Proteins Daria M. Shcherbakova, Mikhail Baloban, Sergei Pletnev,

More information

A Proton Gradient Across a Gold Supported Biomimetic Membrane Induced by Electro-Enzymatic H 2 Oxidation

A Proton Gradient Across a Gold Supported Biomimetic Membrane Induced by Electro-Enzymatic H 2 Oxidation A Proton Gradient Across a Gold Supported Biomimetic Membrane Induced by Electro-Enzymatic H 2 Oxidation Óscar Gutiérrez-Sanz [a], Cristina Tapia [a], Marta C. Marques [b], Sonia Zacarias [b], Marisela

More information

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1 Supplementary Figure 1 Identification of the ScDcp2 minimal region interacting with both ScDcp1 and the ScEdc3 LSm domain. Pull-down experiment of untagged ScEdc3 LSm with various ScDcp1-Dcp2-His 6 fragments.

More information

SUPPLEMENTARY FIGURES

SUPPLEMENTARY FIGURES SUPPLEMENTARY FIGURES Supplementary Figure 1 Protein sequence alignment of Vibrionaceae with either a 40-residue insertion or a 44-residue insertion. Identical residues are indicated by red background.

More information

Supplementary Figure 1. Aligned sequences of yeast IDH1 (top) and IDH2 (bottom) with isocitrate

Supplementary Figure 1. Aligned sequences of yeast IDH1 (top) and IDH2 (bottom) with isocitrate SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1. Aligned sequences of yeast IDH1 (top) and IDH2 (bottom) with isocitrate dehydrogenase from Escherichia coli [ICD, pdb 1PB1, Mesecar, A. D., and Koshland,

More information

Structurale, Université Grenoble Alpes, CNRS, CEA, Grenoble, France

Structurale, Université Grenoble Alpes, CNRS, CEA, Grenoble, France Supplementary Information to Lysine relay mechanism coordinates intermediate transfer in vitamin B6 biosynthesis Matthew J. Rodrigues 1,2, Volker Windeisen 1,3, Yang Zhang 4, Gabriela Guédez 3, Stefan

More information

THE CRYSTAL STRUCTURE OF THE SGT1-SKP1 COMPLEX: THE LINK BETWEEN

THE CRYSTAL STRUCTURE OF THE SGT1-SKP1 COMPLEX: THE LINK BETWEEN THE CRYSTAL STRUCTURE OF THE SGT1-SKP1 COMPLEX: THE LINK BETWEEN HSP90 AND BOTH SCF E3 UBIQUITIN LIGASES AND KINETOCHORES Oliver Willhoft, Richard Kerr, Dipali Patel, Wenjuan Zhang, Caezar Al-Jassar, Tina

More information

SUPPLEMENTARY INFORMATION. Structural basis of laminin binding to the LARGE glycans on dystroglycan

SUPPLEMENTARY INFORMATION. Structural basis of laminin binding to the LARGE glycans on dystroglycan SUPPLEMENTARY INFORMATION Structural asis of laminin inding to the LARGE glycans on dystroglycan David C. Briggs 1, Takako Yoshida-Moriguchi 2, Tianqing Zheng 2, David Venzke 2, Mary Anderson 2, Andrea

More information

Supplementary Information. The protease GtgE from Salmonella exclusively targets. inactive Rab GTPases

Supplementary Information. The protease GtgE from Salmonella exclusively targets. inactive Rab GTPases Supplementary Information The protease GtgE from Salmonella exclusively targets inactive Rab GTPases Table of Contents Supplementary Figures... 2 Supplementary Figure 1... 2 Supplementary Figure 2... 3

More information

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1 Supplementary Figure 1 Crystallization. a, Crystallization constructs of the ET B receptor are shown, with all of the modifications to the human wild-type the ET B receptor indicated. Residues interacting

More information

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-

More information

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2 Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell

More information

Supplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization

Supplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization Supplementary Information Structural basis for precursor protein-directed ribosomal peptide macrocyclization Kunhua Li 1,3, Heather L. Condurso 1,3, Gengnan Li 1, Yousong Ding 2 and Steven D. Bruner 1*

More information

Supplementary figure 1 Application of tmfret in LeuT. (a) To assess the feasibility of using tmfret for distance-dependent measurements in LeuT, a

Supplementary figure 1 Application of tmfret in LeuT. (a) To assess the feasibility of using tmfret for distance-dependent measurements in LeuT, a Supplementary figure 1 Application of tmfret in LeuT. (a) To assess the feasibility of using tmfret for distance-dependent measurements in LeuT, a series of tmfret-pairs comprised of single cysteine mutants

More information

Structural insights into Aspergillus fumigatus lectin specificity - AFL binding sites are functionally non-equivalent

Structural insights into Aspergillus fumigatus lectin specificity - AFL binding sites are functionally non-equivalent Acta Cryst. (2015). D71, doi:10.1107/s1399004714026595 Supporting information Volume 71 (2015) Supporting information for article: Structural insights into Aspergillus fumigatus lectin specificity - AFL

More information

Structural basis of PROTAC cooperative recognition for selective protein degradation

Structural basis of PROTAC cooperative recognition for selective protein degradation SUPPLEMENTARY INFORMATION Structural basis of PROTAC cooperative recognition for selective protein degradation Morgan S. Gadd 1, Andrea Testa 1, Xavier Lucas 1, Kwok-Ho Chan, Wenzhang Chen, Douglas J.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11744 Supplementary Table 1. Crystallographic data collection and refinement statistics. Wild-type Se-Met-BcsA-B SmCl 3 -soaked EMTS-soaked Data collection Space

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Table 1: Data collection, phasing and refinement statistics ChbC/Ta 6 Br 12 Native ChbC Data collection Space group P4 3 2 1 2 P4 3 2 1 2 Cell dimensions a, c (Å) 132.75, 453.57 132.81, 452.95

More information

Supplemental Data SUPPLEMENTAL FIGURES

Supplemental Data SUPPLEMENTAL FIGURES Supplemental Data CRYSTAL STRUCTURE OF THE MG.ADP-INHIBITED STATE OF THE YEAST F 1 C 10 ATP SYNTHASE Alain Dautant*, Jean Velours and Marie-France Giraud* From Université Bordeaux 2, CNRS; Institut de

More information

Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R)

Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R) Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R) Shown in cyan and green are two adjacent tetramers from the crystallographic lattice of COP, forming the only unique inter-tetramer

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature12045 Supplementary Table 1 Data collection and refinement statistics. Native Pt-SAD X-ray source SSRF BL17U SPring-8 BL41XU Wavelength (Å) 0.97947 1.07171 Space group P2 1 2 1 2 1 P2

More information

for Molecular Biology and Neuroscience and Institute of Medical Microbiology, Rikshospitalet-Radiumhospitalet

for Molecular Biology and Neuroscience and Institute of Medical Microbiology, Rikshospitalet-Radiumhospitalet SUPPLEMENTARY INFORMATION TO Structural basis for enzymatic excision of N -methyladenine and N 3 -methylcytosine from DNA Ingar Leiros,5, Marivi P. Nabong 2,3,5, Kristin Grøsvik 3, Jeanette Ringvoll 2,

More information

Full-length GlpG sequence was generated by PCR from E. coli genomic DNA. (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),

Full-length GlpG sequence was generated by PCR from E. coli genomic DNA. (with two sequence variations, D51E/L52V, from the gene bank entry aac28166), Supplementary Methods Protein expression and purification Full-length GlpG sequence was generated by PCR from E. coli genomic DNA (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),

More information

Supporting Information

Supporting Information Supporting Information Ottmann et al. 10.1073/pnas.0907587106 Fig. S1. Primary structure alignment of SBT3 with C5 peptidase from Streptococcus pyogenes. The Matchmaker tool in UCSF Chimera (http:// www.cgl.ucsf.edu/chimera)

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary materials Figure S1 Fusion protein of Sulfolobus solfataricus SRP54 and a signal peptide. a, Expression vector for the fusion protein. The signal peptide of yeast dipeptidyl aminopeptidase

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.108/nature11899 Supplementar Table 1. Data collection and refinement statistics (+TPMP, native) (-TPMP, native) (+TPMP, recombinant) (MgCl ) (MgSO ) Data collection Space group C P 1 C P 1 1 P 1

More information

Expanded View Figures

Expanded View Figures The EMBO Journal Structure of a Dm peptide bound to the OT module Tobias Raisch et al Expanded View Figures A Hs Dm 262 297 685 8 HEAT HEAT MIF4G 9BD 1SHD 761 91 193 169 1152 1317 16 1376 1467 HEAT HEAT

More information

Supporting Information

Supporting Information Supporting Information Oxaliplatin binding to human copper chaperone Atox1 and protein dimerization Benny D. Belviso, 1 Angela Galliani, 2 Alessia Lasorsa, 2 Valentina Mirabelli, 1,3 Rocco Caliandro, 1

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11085 Supplementary Tables: Supplementary Table 1. Summary of crystallographic and structure refinement data Structure BRIL-NOP receptor Data collection Number of crystals 23 Space group

More information

Purification, SDS-PAGE and cryo-em characterization of the MCM hexamer and Cdt1 MCM heptamer samples.

Purification, SDS-PAGE and cryo-em characterization of the MCM hexamer and Cdt1 MCM heptamer samples. Supplementary Figure 1 Purification, SDS-PAGE and cryo-em characterization of the MCM hexamer and Cdt1 MCM heptamer samples. (a-b) SDS-PAGE analysis of the hexamer and heptamer samples. The eluted hexamer

More information

CH 3 CH 2 OH +H 2 O CHO. 2e + 2H + + O 2 H 2 O +HCOOH

CH 3 CH 2 OH +H 2 O CHO. 2e + 2H + + O 2 H 2 O +HCOOH 2 4 H CH 3 2e + 2H + + 2 H 2 2 H CH 2 H 2e + 2H + + 2 H 2 2 H +H 2 CH 2e + 2H + + 2 H 2 2 H +HCH Supplemental Figure S. The three-step 4DM reaction, each step requires two reducing equivalents from ADPH

More information

Structural insights into WcbI, a novel polysaccharide-biosynthesis enzyme

Structural insights into WcbI, a novel polysaccharide-biosynthesis enzyme Volume 1 (2014) Supporting information for article: Structural insights into WcbI, a novel polysaccharide-biosynthesis enzyme Mirella Vivoli, Emily Ayres, Edward Beaumont, Michail N. Isupov and Nicholas

More information

Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps

Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps Cell Reports Supplemental Information Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps Chih-Chia Su, Jani Reddy Bolla, Nitin Kumar, Abhijith Radhakrishnan,

More information

Cyclams with ambidentate methylthiazolyl pendants for a stable, inert and selective Cu(II) coordination

Cyclams with ambidentate methylthiazolyl pendants for a stable, inert and selective Cu(II) coordination Supporting Information for: Cyclams with ambidentate methylthiazolyl pendants for a stable, inert and selective Cu(II) coordination Aurora Rodríguez-Rodríguez, Zakaria Halime, Luís M. P. Lima, Maryline

More information

Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27

Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27 Acta Cryst. (2014). D70, doi:10.1107/s1399004714021695 Supporting information Volume 70 (2014) Supporting information for article: Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase

More information

IgE binds asymmetrically to its B cell receptor CD23

IgE binds asymmetrically to its B cell receptor CD23 Supplementary Information IgE binds asymmetrically to its B cell receptor CD23 Balvinder Dhaliwal 1*, Marie O. Y. Pang 2, Anthony H. Keeble 2,3, Louisa K. James 2,4, Hannah J. Gould 2, James M. McDonnell

More information

Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits. AhpC and AhpF from Escherichia coli

Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits. AhpC and AhpF from Escherichia coli Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits AhpC and AhpF from Escherichia coli Phat Vinh Dip 1,#, Neelagandan Kamariah 2,#, Malathy Sony Subramanian Manimekalai

More information

Lipid Regulated Intramolecular Conformational Dynamics of SNARE-Protein Ykt6

Lipid Regulated Intramolecular Conformational Dynamics of SNARE-Protein Ykt6 Supplementary Information for: Lipid Regulated Intramolecular Conformational Dynamics of SNARE-Protein Ykt6 Yawei Dai 1, 2, Markus Seeger 3, Jingwei Weng 4, Song Song 1, 2, Wenning Wang 4, Yan-Wen 1, 2,

More information

Experimental and Computational Mutagenesis to Investigate the. Positioning of a General Base within an Enzyme Active Site

Experimental and Computational Mutagenesis to Investigate the. Positioning of a General Base within an Enzyme Active Site Experimental and Computational Mutagenesis to Investigate the Positioning of a General Base within an Enzyme Active Site Jason P. Schwans, Philip Hanoian, Benjamin J. Lengerich, Fanny Sunden, Ana Gonzalez

More information

Plasmid Relevant features Source. W18N_D20N and TrXE-W18N_D20N-anti

Plasmid Relevant features Source. W18N_D20N and TrXE-W18N_D20N-anti Table S1. E. coli plasmids Plasmid Relevant features Source pdg680 T. reesei XynII AA 2-190 with C-terminal His 6 tag optimized for E. coli expression in pjexpress401 Wan et al. (in press) psbn44d psbn44h

More information

Sensitive NMR Approach for Determining the Binding Mode of Tightly Binding Ligand Molecules to Protein Targets

Sensitive NMR Approach for Determining the Binding Mode of Tightly Binding Ligand Molecules to Protein Targets Supporting information Sensitive NMR Approach for Determining the Binding Mode of Tightly Binding Ligand Molecules to Protein Targets Wan-Na Chen, Christoph Nitsche, Kala Bharath Pilla, Bim Graham, Thomas

More information

Supporting Protocol This protocol describes the construction and the force-field parameters of the non-standard residue for the Ag + -site using CNS

Supporting Protocol This protocol describes the construction and the force-field parameters of the non-standard residue for the Ag + -site using CNS Supporting Protocol This protocol describes the construction and the force-field parameters of the non-standard residue for the Ag + -site using CNS CNS input file generatemetal.inp: remarks file generate/generatemetal.inp

More information

The structure of a nucleolytic ribozyme that employs a catalytic metal ion. Yijin Liu, Timothy J. Wilson and David M.J. Lilley

The structure of a nucleolytic ribozyme that employs a catalytic metal ion. Yijin Liu, Timothy J. Wilson and David M.J. Lilley SUPPLEMENTARY INFORMATION The structure of a nucleolytic ribozyme that employs a catalytic metal ion Yijin Liu, Timothy J. Wilson and David M.J. Lilley Cancer Research UK Nucleic Acid Structure Research

More information

Supplementary Information. Overlap between folding and functional energy landscapes for. adenylate kinase conformational change

Supplementary Information. Overlap between folding and functional energy landscapes for. adenylate kinase conformational change Supplementary Information Overlap between folding and functional energy landscapes for adenylate kinase conformational change by Ulrika Olsson & Magnus Wolf-Watz Contents: 1. Supplementary Note 2. Supplementary

More information

Supplementary Figure 3 a. Structural comparison between the two determined structures for the IL 23:MA12 complex. The overall RMSD between the two

Supplementary Figure 3 a. Structural comparison between the two determined structures for the IL 23:MA12 complex. The overall RMSD between the two Supplementary Figure 1. Biopanningg and clone enrichment of Alphabody binders against human IL 23. Positive clones in i phage ELISA with optical density (OD) 3 times higher than background are shown for

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Figure 1: The HpUreI crystal used for collection of native diffraction data. The crystal belongs to spacegroup P4 2 2 1 2 and has an approximate maximal dimension of 0.25 mm. Supplementary

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Results DNA binding property of the SRA domain was examined by an electrophoresis mobility shift assay (EMSA) using synthesized 12-bp oligonucleotide duplexes containing unmodified, hemi-methylated,

More information

Stabilizing the CH2 domain of an Antibody by Engineering in an Enhanced Aromatic Sequon

Stabilizing the CH2 domain of an Antibody by Engineering in an Enhanced Aromatic Sequon Stabilizing the CH2 domain of an Antibody by Engineering in an Enhanced Aromatic Sequon Wentao Chen,, Leopold Kong, Stephen Connelly, Julia M. Dendle,, Yu Liu,, Ian A. Wilson,#, Evan T. Powers, *, Jeffery

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION UPPEER ORO doi:10.1038/nature10753 D D D D P E ntracellular C1 W P P C EC1 D Q R H C D W D R C C2 D E D E C R Q Q W P W W R P P EC2 EC3 P C C P W P W W P C W H R C R E C3 P R R P P P C Extracellular embrane

More information

Structural characterization of NiV N 0 P in solution and in crystal.

Structural characterization of NiV N 0 P in solution and in crystal. Supplementary Figure 1 Structural characterization of NiV N 0 P in solution and in crystal. (a) SAXS analysis of the N 32-383 0 -P 50 complex. The Guinier plot for complex concentrations of 0.55, 1.1,

More information

CHEM 463: Advanced Inorganic Chemistry Modeling Metalloproteins for Structural Analysis

CHEM 463: Advanced Inorganic Chemistry Modeling Metalloproteins for Structural Analysis CHEM 463: Advanced Inorganic Chemistry Modeling Metalloproteins for Structural Analysis Purpose: The purpose of this laboratory is to introduce some of the basic visualization and modeling tools for viewing

More information

The structure of a nucleolytic ribozyme that employs a catalytic metal ion Liu, Yijin; Wilson, Timothy; Lilley, David

The structure of a nucleolytic ribozyme that employs a catalytic metal ion Liu, Yijin; Wilson, Timothy; Lilley, David University of Dundee The structure of a nucleolytic ribozyme that employs a catalytic metal ion Liu, Yijin; Wilson, Timothy; Lilley, David Published in: Nature Chemical Biology DOI: 10.1038/nchembio.2333

More information

Supplementary Figure 1. Proposed mechanism for AusE, PrhA, and these mutants. (a) 5 is desaturated

Supplementary Figure 1. Proposed mechanism for AusE, PrhA, and these mutants. (a) 5 is desaturated S1 Supplementary Figure 1. Proposed mechanism for AusE, PrhA, and these mutants. (a) 5 is desaturated to form 6 through hydrogen atom abstraction at C-2 followed by the second hydrogen atom abstraction

More information

Rational Design of Thermodynamic and Kinetic Binding Profiles by. Optimizing Surface Water Networks Coating Protein Bound Ligands

Rational Design of Thermodynamic and Kinetic Binding Profiles by. Optimizing Surface Water Networks Coating Protein Bound Ligands SUPPORTING INFORMATION Rational Design of Thermodynamic and Kinetic Binding Profiles by Optimizing Surface Water Networks Coating Protein Bound Ligands Stefan G. Krimmer,, Jonathan Cramer,, Michael Betz,

More information

Impact of the crystallization condition on importin-β conformation

Impact of the crystallization condition on importin-β conformation Supporting information Volume 72 (2016) Supporting information for article: Impact of the crystallization condition on importin-β conformation Marcel J. Tauchert, Clément Hémonnot, Piotr Neumann, Sarah

More information

Supplementary information

Supplementary information Supplementary information The structural basis of modularity in ECF-type ABC transporters Guus B. Erkens 1,2, Ronnie P-A. Berntsson 1,2, Faizah Fulyani 1,2, Maria Majsnerowska 1,2, Andreja Vujičić-Žagar

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/5/243/ra68/dc1 Supplementary Materials for Superbinder SH2 Domains Act as Antagonists of Cell Signaling Tomonori Kaneko, Haiming Huang, Xuan Cao, Xing Li, Chengjun

More information

Structure and RNA-binding properties. of the Not1 Not2 Not5 module of the yeast Ccr4 Not complex

Structure and RNA-binding properties. of the Not1 Not2 Not5 module of the yeast Ccr4 Not complex Structure and RNA-binding properties of the Not1 Not2 Not5 module of the yeast Ccr4 Not complex Varun Bhaskar 1, Vladimir Roudko 2,3, Jerome Basquin 1, Kundan Sharma 4, Henning Urlaub 4, Bertrand Seraphin

More information

Photosystem I in Arabidopsis Thaliana

Photosystem I in Arabidopsis Thaliana Photosystem I in Arabidopsis Thaliana Part A. Photosystem I in Arabidopsis Thaliana Arabidopsis thaliana is a small flowering plant related to the cabbage and mustard plants. Like all plants, Arabidopsis

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10955 Supplementary Figures Supplementary Figure 1. Electron-density maps and crystallographic dimer structures of the motor domain. (a f) Stereo views of the final electron-density maps

More information

PAN-modular Structure of Parasite Sarcocystis muris Microneme Protein SML-2 at 1.95 Å Resolution and the Complex with 1-Thio-β-D-Galactose

PAN-modular Structure of Parasite Sarcocystis muris Microneme Protein SML-2 at 1.95 Å Resolution and the Complex with 1-Thio-β-D-Galactose Supplementary Material to the paper: PAN-modular Structure of Parasite Sarcocystis muris Microneme Protein SML-2 at 1.95 Å Resolution and the Complex with 1-Thio-β-D-Galactose Jürgen J. Müller, a Manfred

More information

Chemical Science PERSPECTIVE. Hydrogenases and oxygen. Dynamic Article Links C < Cite this: Chem. Sci., 2012, 3,

Chemical Science PERSPECTIVE. Hydrogenases and oxygen. Dynamic Article Links C < Cite this: Chem. Sci., 2012, 3, Chemical Science / Journal Homepage / Table of Contents for this issue Dynamic Article Links C < Cite this: Chem. Sci., 2012, 3, 1739 www.rsc.org/chemicalscience Hydrogenases and oxygen PERSPECTIVE Martin

More information

Destruction of Amyloid Fibrils by Graphene through Penetration and Extraction of Peptides

Destruction of Amyloid Fibrils by Graphene through Penetration and Extraction of Peptides Electronic Supplementary Material (ESI) for Nanoscale. This journal is The Royal Society of Chemistry 2015 Destruction of Amyloid Fibrils by Graphene through Penetration and Extraction of Peptides Zaixing

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature12242 C. thermophilum 666 RPAVLDNVYIRPALE-GKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQN S. pombe 659 RPAHINDVYVRPAID-GKRLPGFIEIHQNGIRYQSPLRSDSHIDLLFSNMKHLFFQPCEG

More information

Supporting Information

Supporting Information Supporting Information Structural Analysis of the Binding of Type I, I 1/2, and II Inhibitors to Eph Tyrosine Kinases Jing Dong, *1 Hongtao Zhao, 1 Ting Zhou, 1 Dimitrios Spiliotopoulos, 1 Chitra Rajendran,

More information

Biophysics 490M Project

Biophysics 490M Project Biophysics 490M Project Dan Han Department of Biochemistry Structure Exploration of aa 3 -type Cytochrome c Oxidase from Rhodobacter sphaeroides I. Introduction: All organisms need energy to live. They

More information

Acta Cryst. (2014). D70, doi: /s

Acta Cryst. (2014). D70, doi: /s Acta Cryst. (2014). D70, doi:10.1107/s1399004714021166 Supporting information Volume 70 (2014) Supporting information for article: Elucidation of the bicarbonate binding site and insights into the carboxylation

More information

type GroEL-GroES complex. Crystals were grown in buffer D (100 mm HEPES, ph 7.5,

type GroEL-GroES complex. Crystals were grown in buffer D (100 mm HEPES, ph 7.5, Supplementary Material Supplementary Materials and Methods Structure Determination of SR1-GroES-ADP AlF x SR1-GroES-ADP AlF x was purified as described in Materials and Methods for the wild type GroEL-GroES

More information

of the Guanine Nucleotide Exchange Factor FARP2

of the Guanine Nucleotide Exchange Factor FARP2 Structure, Volume 21 Supplemental Information Structural Basis for Autoinhibition of the Guanine Nucleotide Exchange Factor FARP2 Xiaojing He, Yi-Chun Kuo, Tyler J. Rosche, and Xuewu Zhang Inventory of

More information

Supplementary Figure 1 Crystal packing of ClR and electron density maps. Crystal packing of type A crystal (a) and type B crystal (b).

Supplementary Figure 1 Crystal packing of ClR and electron density maps. Crystal packing of type A crystal (a) and type B crystal (b). Supplementary Figure 1 Crystal packing of ClR and electron density maps. Crystal packing of type A crystal (a) and type B crystal (b). Crystal contacts at B-C loop are magnified and stereo view of A-weighted

More information

Supplementary materials. Crystal structure of the carboxyltransferase domain. of acetyl coenzyme A carboxylase. Department of Biological Sciences

Supplementary materials. Crystal structure of the carboxyltransferase domain. of acetyl coenzyme A carboxylase. Department of Biological Sciences Supplementary materials Crystal structure of the carboxyltransferase domain of acetyl coenzyme A carboxylase Hailong Zhang, Zhiru Yang, 1 Yang Shen, 1 Liang Tong Department of Biological Sciences Columbia

More information

ml. ph 7.5 ph 6.5 ph 5.5 ph 4.5. β 2 AR-Gs complex + GDP β 2 AR-Gs complex + GTPγS

ml. ph 7.5 ph 6.5 ph 5.5 ph 4.5. β 2 AR-Gs complex + GDP β 2 AR-Gs complex + GTPγS a UV28 absorption (mau) 9 8 7 5 3 β 2 AR-Gs complex β 2 AR-Gs complex + GDP β 2 AR-Gs complex + GTPγS β 2 AR-Gs complex dissociated complex excess nucleotides b 9 8 7 5 3 β 2 AR-Gs complex β 2 AR-Gs complex

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis Sergio de Cima, Luis M. Polo, Carmen Díez-Fernández, Ana I. Martínez, Javier

More information

Supplemental Information

Supplemental Information Supplemental Information Combinatorial Readout of Unmodified H3R2 and Acetylated H3K14 by the Tandem PHD Finger of MOZ Reveals a Regulatory Mechanism for HOXA9 Transcription Yu Qiu 1, Lei Liu 1, Chen Zhao

More information

Nature Structural and Molecular Biology: doi: /nsmb.2938

Nature Structural and Molecular Biology: doi: /nsmb.2938 Supplementary Figure 1 Characterization of designed leucine-rich-repeat proteins. (a) Water-mediate hydrogen-bond network is frequently visible in the convex region of LRR crystal structures. Examples

More information

Exam I Answer Key: Summer 2006, Semester C

Exam I Answer Key: Summer 2006, Semester C 1. Which of the following tripeptides would migrate most rapidly towards the negative electrode if electrophoresis is carried out at ph 3.0? a. gly-gly-gly b. glu-glu-asp c. lys-glu-lys d. val-asn-lys

More information

Enhancing hydrogen production of microalgae by redirecting electrons from photosystem I to hydrogenase

Enhancing hydrogen production of microalgae by redirecting electrons from photosystem I to hydrogenase Electronic Supplementary Material (ESI) for Energy & Environmental Science. This journal is The Royal Society of Chemistry 2014 Supplementary information for Enhancing hydrogen production of microalgae

More information

Crystal Structure of Fibroblast Growth Factor 9 (FGF9) Reveals Regions. Implicated in Dimerization and Autoinhibition

Crystal Structure of Fibroblast Growth Factor 9 (FGF9) Reveals Regions. Implicated in Dimerization and Autoinhibition JBC Papers in Press. Published on November 1, 2000 as Manuscript M006502200 Crystal Structure of Fibroblast Growth Factor 9 (FGF9) Reveals Regions Implicated in Dimerization and Autoinhibition 1 Copyright

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Data collection Supplementary Table 1 Statistics of data collection, phasing and refinement Native Se-MAD Space group P2 1 2 1 2 1 P2 1 2 1 2 1 Cell dimensions a, b, c (Å) 50.4, 94.2, 115.4 49.8, 94.2,

More information

SUPPLEMENTARY INFORMATION. Pistol Ribozyme Adopts a Pseudoknot Fold. Facilitating Site-specific In-line Cleavage

SUPPLEMENTARY INFORMATION. Pistol Ribozyme Adopts a Pseudoknot Fold. Facilitating Site-specific In-line Cleavage UPPLEMENTAY INFMATIN Pistol ibozyme Adopts a Pseudoknot Fold Facilitating ite-specific In-line Cleavage Aiming en 1,2,4, Nikola Vušurović 3,4, Jennifer Gebetsberger 3, Pu Gao 2, Michael Juen 3, Christoph

More information

Supplementary Material

Supplementary Material upplementary Material Molecular docking and ligand specificity in fragmentbased inhibitor discovery Chen & hoichet 26 27 (a) 2 1 2 3 4 5 6 7 8 9 10 11 12 15 16 13 14 17 18 19 (b) (c) igure 1 Inhibitors

More information

Lecture 12. Metalloproteins - II

Lecture 12. Metalloproteins - II Lecture 12 Metalloproteins - II Metalloenzymes Metalloproteins with one labile coordination site around the metal centre are known as metalloenzyme. As with all enzymes, the shape of the active site is

More information

The copper active site in CBM33 polysaccharide oxygenases

The copper active site in CBM33 polysaccharide oxygenases Supporting Information for: The copper active site in CBM33 polysaccharide oxygenases Glyn R. Hemsworth, Edward J. Taylor, Robbert Q. Kim, Rebecca C. Gregory, Sally J. Lewis, Johan P. Turkenburg, Alison

More information