SUPPLEMENTARY INFORMATION

Size: px
Start display at page:

Download "SUPPLEMENTARY INFORMATION"

Transcription

1 doi: /nature10458 Active Site Remodeling in the Bifunctional Fructose-1,6- bisphosphate aldolase/phosphatase Juan Du, Rafael F. Say, Wei Lü, Georg Fuchs & Oliver Einsle SUPPLEMENTARY FIGURES Figure S1: Structure of T. neutrophilus FBPAP. a) The monomer folds into a compact domain with a C-terminal extension that wraps around a neighboring protomer of the octameric complex. Phosphatase lid is shown in blue, the aldolase loop in red and the anchor loop in yellow. b) The FBPAP octamer in surface representation, with a single monomer shown as cartoon to emphasize the position of the chain. 1

2 Figure S2: Stereo view of the active site of TnFBPAP in the native state with two bound Mg 2+ ions. Direct ligands of the two cations are D11, H18, D52, D53, D132 and D234. The water molecule coordinated to D11, D53 and Mg2 (marked H 2 O) is at the position from which the nucleophilic attack is carried out in the phosphatase reaction. This position was occupied with a water in all structures. When treated with 50 mm EDTA, Mg 1 is removed, but Mg 2 remains bound to the protein. 2

3 3

4 Figure S3 (previous page): Top view of the active site in the four structures of TnFBPAP. A) Native state, B) DHAP-bound state with 2 molecules of DHAP as ligands, C) FBP complex and D) F6P product complex. For all soaked ligands, F o F c omit difference electron density maps were calculated after simulated annealing refinement without the adduct and contoured at the 3.5σ level. Figure S4: Stereo view of the active site of TnFBPAP in complex with FBP and four bound Mg 2+ ions (Fig. 1C, 2C). The phosphatase lid is in its closed conformation and the aldolase loop is in the locked conformation, with the side chain of the catalytic residue for the aldol condensation, K232, forming a hydrogen bond to the backbone carbonyl of P111 at the base of the phosphatase lid. Residue D233 that points away from the active site when the enzyme acts as an aldolase (in conformation of the aldolase loop) now coordinates both Mg3 and Mg4. E357 in the anchor loop contacts Mg4 through two well-defined water molecules and the substrate is fixed in place by Y91, D297 and Y

5 Figure S5: Mg 2+ binding to native TnFBPAP. Isothermal calorimetric titration of the enzyme at 50 C after EDTA-treatment shows entropy-driven binding to a single site with a K d = 27 µm. The structure of the EDTA-treated form revealed that Mg 2 is retained, so that the above event represents the binding of Mg 1. The experiment was carried out in the absence of DHAP, and no binding of a second Mg 2+ ion, Mg 3, is observed. Hollow squares indicate the reference curve that was subtracted from the experimental data. 5

6 Figure S6: TnFBPAP activities dependent on the concentration of Mg 2+ in the reaction buffer. a) aldolase activity and b) phosphatase activity differ in v max, but show very similar K M values. Under physiological conditions of > 10 mm Mg 2+ the availability of the cation should not be limiting for enzymatic activity. 6

7 Figure S7: Binding of the first substrate, DHAP. At 42 C the binding of substrate is an entropy-driven process with a dissociation constant of K d = 25.5 µm. The experiment was carried out in the presence of 10 mm MgCl 2 in the reaction buffer. Note that only a single binding event is observed. The second binding site for DHAP that was observed in the crystal structure will likely be only occupied when the substrate is added in large excess, as was the case during crystal soaking. 7

8 SUPPLEMENTARY METHODS Isothermal Titration Calorimetry Thermodynamic parameters for binding of Mg 2+ and the substrates G3P and DHAP to TnFBPAP were determined by isothermal calorimetric titrations on a Microcal VP-ITC calorimeter (GE Healthcare). Both protein and ligand solutions were prepared in the same buffer condition. As a control, a reference titration was performed by adding the ligand to buffer without protein, in order to correct for the heat of dilution of the titrant. ITC measurements of Mg 2+ binding to the enzyme were carried out at 30 C and 50 C in buffer containing 20 mm Tris-HCl (ph 8.0), 150 mm NaCl and 10% glycerol. Mg ions in the enzyme were removed by 50 mm EDTA. In this instance 122 µl Mg 2+ (3 mm MgCl 2, 20mM Tris/HCl at ph 8.0, 150 mm NaCl and 10% glycerol) was titrated to 1.4 ml TnFBPAP (0.08 mm) in 13 injections (1 2 µl µl). Due to the instability of the triose phosphates at high temperatures, the titrations of G3P and DHAP (1 mm and 1.2 mm in 20 mm Tris/HCl at ph 8.0, 150 mm NaCl, 10 mm MgCl 2 and 10% glycerol) to TnFBPAP (0.04 mm) were done at 42 C, with 13 injections (1 x 3 µl + 12 x 10 µl). Microcal Origin was used for processing and analysis of the calorimetric data. 8

9 SUPPLEMENTARY TABLES Table S1 Data collection and refinement statistics Ligand-free DHAP Fru-1,6-BP Fru-6-P EDTA Y229F Data collection Space group I422 I422 I422 I422 I422 I422 Cell dimensions a, b, c (Å) 112.5, 112.5, , 112.4, , 112.3, , 112.3, , 112,3, , 112.4, α, β, γ ( ) 90.0, 90.0, , 90.0, , 90.0, , 90.0, , 90.0, , 90.0, 90.0 Resolution (Å) ( ) * ( ) ( ) ( ) ( ) ( ) R sym or R merge (0.363) (0.373) (0.424) (0.371) (0.714) (0.599) I/σI 22.4 (6.0) 17.4 (4.9) 18.5 (5.1) 15.3 (5.2) 16.6 (2.5) 10.7 (3.0) Completeness (%) 99.9 (99.9) 99.8 (99.9) 99.9 (99.9) 99.8 (99.9) (100) 99.3 (99.6) Redundancy 10.0 (10.3) 7.9 (7.3) 9.2 (8.5) 8.0 (7.3) 5.8 (5.9) 6.4 (6.5) Refinement Resolution (Å) ( ) ( ) ( ) ( ) ( ) ( ) No. reflections 70,543 (5,416) 111,585 (8,613) 97,834 (7,534) 54,151 (4,060) 38,467 (3,111) 9,583 (680) R work/ R free 0.165/0.188 (0.236/0.259) 0.108/0.129 (0.167/0.186) 0.104/0.126 (0.160/0.204) 0.149/0.178 (0.210/0.231) 0.154/0.191 (0.217/0.274) 0.178/0.234 (0.198/0.288) No. atoms Protein Ligand/ion Water B-factors Protein Ligand/ion Water R.m.s deviations Bond lengths (Å) Bond angles (º) *Highest resolution shell is shown in parenthesis. 9

10 Table S2 Specific activities and substrate affinities for the FBP-Aldolase/Phosphatase from Cenarchaeum symbiosum (CS) and Thermoproteus neutrophilus (TN) and its variants. The specific activities correspond to the relative activities in Fig. 3. Enzyme variant Phosphatase reaction Specific activity (µmol min -1 mg -1 ) K M (mm) Aldolase reaction (catabolic*) Specific activity (µmol min -1 mg -1 ) K M (mm) CS wildtype ± ± ± ± 20 CS Y229F ± ± ± i.m. CS K232R ± ± < i.m. CS D233N ± i.m ± i.m. CS E347Q ± i.m ± ND CS Y348F ± i.m ± ND TN wildtype ± ND ± ND TN Y229F ± ND < i.m. TN D297N ± ND < i.m. ND = not determined i.m. = incapable of measurement * = measured with 100 mm FBP 10

SUPPLEMENTARY FIGURES

SUPPLEMENTARY FIGURES SUPPLEMENTARY FIGURES Supplementary Figure 1 Protein sequence alignment of Vibrionaceae with either a 40-residue insertion or a 44-residue insertion. Identical residues are indicated by red background.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Table of Contents Page Supplementary Table 1. Diffraction data collection statistics 2 Supplementary Table 2. Crystallographic refinement statistics 3 Supplementary Fig. 1. casic1mfc packing in the R3

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary materials Figure S1 Fusion protein of Sulfolobus solfataricus SRP54 and a signal peptide. a, Expression vector for the fusion protein. The signal peptide of yeast dipeptidyl aminopeptidase

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION www.nature.com/nature 1 Figure S1 Sequence alignment. a Structure based alignment of the plgic of E. chrysanthemi (ELIC), the acetylcholine binding protein from the snail Lymnea stagnalis (AchBP, PDB code

More information

SUPPLEMENTARY INFORMATION. doi: /nature07461

SUPPLEMENTARY INFORMATION. doi: /nature07461 Figure S1 Electrophysiology. a ph-activation of. Two-electrode voltage clamp recordings of Xenopus oocytes expressing in comparison to waterinjected oocytes. Currents were recorded at 40 mv. The ph of

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Table 1: Data collection, phasing and refinement statistics ChbC/Ta 6 Br 12 Native ChbC Data collection Space group P4 3 2 1 2 P4 3 2 1 2 Cell dimensions a, c (Å) 132.75, 453.57 132.81, 452.95

More information

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2 Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11524 Supplementary discussion Functional analysis of the sugar porter family (SP) signature motifs. As seen in Fig. 5c, single point mutation of the conserved

More information

Supplementary Figures

Supplementary Figures 1 Supplementary Figures Supplementary Figure 1 Type I FGFR1 inhibitors (a) Chemical structures of a pyrazolylaminopyrimidine inhibitor (henceforth referred to as PAPI; PDB-code of the FGFR1-PAPI complex:

More information

The structure of a nucleolytic ribozyme that employs a catalytic metal ion. Yijin Liu, Timothy J. Wilson and David M.J. Lilley

The structure of a nucleolytic ribozyme that employs a catalytic metal ion. Yijin Liu, Timothy J. Wilson and David M.J. Lilley SUPPLEMENTARY INFORMATION The structure of a nucleolytic ribozyme that employs a catalytic metal ion Yijin Liu, Timothy J. Wilson and David M.J. Lilley Cancer Research UK Nucleic Acid Structure Research

More information

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-

More information

Supplementary Information

Supplementary Information Supplementary Information The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis Marta C. Marques a, Cristina Tapia b, Oscar Gutiérrez-Sanz b, Ana Raquel Ramos a, Kimberly L.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Dph2 SeMet (iron-free) # Dph2 (iron-free) Dph2-[4Fe-4S] Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell dimensions a, b, c (Å) 58.26, 82.08, 160.42 58.74, 81.87, 160.01 55.70, 80.53,

More information

The structure of a nucleolytic ribozyme that employs a catalytic metal ion Liu, Yijin; Wilson, Timothy; Lilley, David

The structure of a nucleolytic ribozyme that employs a catalytic metal ion Liu, Yijin; Wilson, Timothy; Lilley, David University of Dundee The structure of a nucleolytic ribozyme that employs a catalytic metal ion Liu, Yijin; Wilson, Timothy; Lilley, David Published in: Nature Chemical Biology DOI: 10.1038/nchembio.2333

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:1.138/nature1737 Supplementary Table 1 variant Description FSEC - 2B12 a FSEC - 6A1 a K d (leucine) c Leucine uptake e K (wild-type like) K (Y18F) K (TS) K (TSY) K288A mutant, lipid facing side chain

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Results DNA binding property of the SRA domain was examined by an electrophoresis mobility shift assay (EMSA) using synthesized 12-bp oligonucleotide duplexes containing unmodified, hemi-methylated,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11054 Supplementary Fig. 1 Sequence alignment of Na v Rh with NaChBac, Na v Ab, and eukaryotic Na v and Ca v homologs. Secondary structural elements of Na v Rh are indicated above the

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/5/243/ra68/dc1 Supplementary Materials for Superbinder SH2 Domains Act as Antagonists of Cell Signaling Tomonori Kaneko, Haiming Huang, Xuan Cao, Xing Li, Chengjun

More information

Cholera Toxin Invasion

Cholera Toxin Invasion Protein-carbohydrate interactions: Isothermal Titration Calorimetry Dr Bruce Turnbull School of Chemistry and Astbury Centre for Structural Molecular Biology University of Leeds Cholera Toxin Invasion

More information

S2004 Methods for characterization of biomolecular interactions - classical versus modern

S2004 Methods for characterization of biomolecular interactions - classical versus modern S2004 Methods for characterization of biomolecular interactions - classical versus modern Isothermal Titration Calorimetry (ITC) Eva Dubská email: eva.dubska@ceitec.cz Outline Calorimetry - history + a

More information

ISoTherMal TITraTIon Calorimetry

ISoTherMal TITraTIon Calorimetry ISoTherMal TITraTIon Calorimetry With the Nano ITC, heat effects as small as 1 nanojoules are detectable using one nanomole or less of biopolymer. The Nano ITC uses a solid-state thermoelectric heating

More information

Diphthamide biosynthesis requires a radical iron-sulfur enzyme. Pennsylvania State University, University Park, Pennsylvania 16802, USA

Diphthamide biosynthesis requires a radical iron-sulfur enzyme. Pennsylvania State University, University Park, Pennsylvania 16802, USA Diphthamide biosynthesis requires a radical iron-sulfur enzyme Yang Zhang, 1,4 Xuling Zhu, 1,4 Andrew T. Torelli, 1 Michael Lee, 2 Boris Dzikovski, 1 Rachel Koralewski, 1 Eileen Wang, 1 Jack Freed, 1 Carsten

More information

Bacterial protease uses distinct thermodynamic signatures for substrate recognition

Bacterial protease uses distinct thermodynamic signatures for substrate recognition Bacterial protease uses distinct thermodynamic signatures for substrate recognition Gustavo Arruda Bezerra, Yuko Ohara-Nemoto, Irina Cornaciu, Sofiya Fedosyuk, Guillaume Hoffmann, Adam Round, José A. Márquez,

More information

According to the manufacture s direction (Pierce), RNA and DNA

According to the manufacture s direction (Pierce), RNA and DNA Supplementary method Electrophoretic Mobility-shift assay (EMSA) According to the manufacture s direction (Pierce), RNA and DNA oligonuleotides were firstly labeled by biotin. TAVb (1pM) was incubated

More information

SUPPLEMENTARY INFORMATION. Pistol Ribozyme Adopts a Pseudoknot Fold. Facilitating Site-specific In-line Cleavage

SUPPLEMENTARY INFORMATION. Pistol Ribozyme Adopts a Pseudoknot Fold. Facilitating Site-specific In-line Cleavage UPPLEMENTAY INFMATIN Pistol ibozyme Adopts a Pseudoknot Fold Facilitating ite-specific In-line Cleavage Aiming en 1,2,4, Nikola Vušurović 3,4, Jennifer Gebetsberger 3, Pu Gao 2, Michael Juen 3, Christoph

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature12045 Supplementary Table 1 Data collection and refinement statistics. Native Pt-SAD X-ray source SSRF BL17U SPring-8 BL41XU Wavelength (Å) 0.97947 1.07171 Space group P2 1 2 1 2 1 P2

More information

Analysis of nucleotide binding to p97 reveals the properties of a tandem AAA hexameric ATPase

Analysis of nucleotide binding to p97 reveals the properties of a tandem AAA hexameric ATPase SUPPLEMENTARY INFORMATION Analysis of nucleotide binding to p97 reveals the properties of a tandem AAA hexameric ATPase Louise C Briggs, Geoff S Baldwin, Non Miyata, Hisao Kondo, Xiaodong Zhang, Paul S

More information

Presentation Microcalorimetry for Life Science Research

Presentation Microcalorimetry for Life Science Research Presentation Microcalorimetry for Life Science Research MicroCalorimetry The Universal Detector Heat is either generated or absorbed in every chemical process Capable of thermal measurements over a wide

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Table 1: Amplitudes of three current levels. Level 0 (pa) Level 1 (pa) Level 2 (pa) TrkA- TrkH WT 200 K 0.01 ± 0.01 9.5 ± 0.01 18.7 ± 0.03 200 Na * 0.001 ± 0.01 3.9 ± 0.01 12.5 ± 0.03 200

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11539 Supplementary Figure 1 Schematic representation of plant (A) and mammalian (B) P 2B -ATPase domain organization. Actuator (A-), nucleotide binding (N-),

More information

Structurale, Université Grenoble Alpes, CNRS, CEA, Grenoble, France

Structurale, Université Grenoble Alpes, CNRS, CEA, Grenoble, France Supplementary Information to Lysine relay mechanism coordinates intermediate transfer in vitamin B6 biosynthesis Matthew J. Rodrigues 1,2, Volker Windeisen 1,3, Yang Zhang 4, Gabriela Guédez 3, Stefan

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.108/nature11899 Supplementar Table 1. Data collection and refinement statistics (+TPMP, native) (-TPMP, native) (+TPMP, recombinant) (MgCl ) (MgSO ) Data collection Space group C P 1 C P 1 1 P 1

More information

The copper active site in CBM33 polysaccharide oxygenases

The copper active site in CBM33 polysaccharide oxygenases Supporting Information for: The copper active site in CBM33 polysaccharide oxygenases Glyn R. Hemsworth, Edward J. Taylor, Robbert Q. Kim, Rebecca C. Gregory, Sally J. Lewis, Johan P. Turkenburg, Alison

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Table S1 Kinetic Analyses of the AMSH-LP mutants AMSH-LP K M (μm) k cat x 10-3 (s -1 ) WT 71.8 ± 6.3 860 ± 65.4 T353A 76.8 ± 11.7 46.3 ± 3.7 F355A 58.9 ± 10.4 5.33 ± 0.30 proximal S358A 75.1

More information

type GroEL-GroES complex. Crystals were grown in buffer D (100 mm HEPES, ph 7.5,

type GroEL-GroES complex. Crystals were grown in buffer D (100 mm HEPES, ph 7.5, Supplementary Material Supplementary Materials and Methods Structure Determination of SR1-GroES-ADP AlF x SR1-GroES-ADP AlF x was purified as described in Materials and Methods for the wild type GroEL-GroES

More information

Plasmid Relevant features Source. W18N_D20N and TrXE-W18N_D20N-anti

Plasmid Relevant features Source. W18N_D20N and TrXE-W18N_D20N-anti Table S1. E. coli plasmids Plasmid Relevant features Source pdg680 T. reesei XynII AA 2-190 with C-terminal His 6 tag optimized for E. coli expression in pjexpress401 Wan et al. (in press) psbn44d psbn44h

More information

Supplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization

Supplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization Supplementary Information Structural basis for precursor protein-directed ribosomal peptide macrocyclization Kunhua Li 1,3, Heather L. Condurso 1,3, Gengnan Li 1, Yousong Ding 2 and Steven D. Bruner 1*

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Fig. 1 Influences of crystal lattice contacts on Pol η structures. a. The dominant lattice contact between two hpol η molecules (silver and gold) in the type 1 crystals. b. A close-up view of the hydrophobic

More information

Enzymes Enzyme Mechanism

Enzymes Enzyme Mechanism Mechanisms of Enzymes BCMB 3100 Chapters 6, 7, 8 Enzymes Enzyme Mechanism 1 Energy diagrams Binding modes of enzyme catalysis Chemical modes of enzyme catalysis Acid-Base catalysis Covalent catalysis Binding

More information

Enzymes Enzyme Mechanism

Enzymes Enzyme Mechanism BCMB 3100 Chapters 6, 7, 8 Enzymes Enzyme Mechanism 1 Mechanisms of Enzymes Energy diagrams Binding modes of enzyme catalysis Chemical modes of enzyme catalysis Acid-Base catalysis Covalent catalysis Binding

More information

13.3A: The general mechanism for an aldol reaction

13.3A: The general mechanism for an aldol reaction Ashley Robison My Preferences Site Tools FAQ Sign Out If you like us, please share us on social media. The latest UCD Hyperlibrary newsletter is now complete, check it out. ChemWiki BioWiki GeoWiki StatWiki

More information

The structure of vanadium nitrogenase reveals an unusual bridging ligand

The structure of vanadium nitrogenase reveals an unusual bridging ligand SUPPLEMENTARY INFORMATION The structure of vanadium nitrogenase reveals an unusual bridging ligand Daniel Sippel and Oliver Einsle Lehrstuhl Biochemie, Institut für Biochemie, Albert-Ludwigs-Universität

More information

Redox-Responsive Complexation between a. Pillar[5]arene with Mono ethylene oxide Substituents. and Paraquat

Redox-Responsive Complexation between a. Pillar[5]arene with Mono ethylene oxide Substituents. and Paraquat Redox-Responsive Complexation between a Pillar[5]arene with Mono ethylene oxide Substituents and Paraquat Xiaodong Chi, Min Xue, Yong Yao and Feihe Huang* MOE Key Laboratory of Macromolecular Synthesis

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10955 Supplementary Figures Supplementary Figure 1. Electron-density maps and crystallographic dimer structures of the motor domain. (a f) Stereo views of the final electron-density maps

More information

Energetics of chitooligosaccharide binding to pumpkin (Cucurbita maxima) phloem exudate Lectin

Energetics of chitooligosaccharide binding to pumpkin (Cucurbita maxima) phloem exudate Lectin Chapter 3 Energetics of chitooligosaccharide binding to pumpkin (Cucurbita maxima) phloem exudate Lectin 50 Chapter 3 Energetics of 51 Summary Binding of chitooligosaccharides [(GlcNAc) 2-6 ] to pumpkin

More information

Chemistry 5.07SC Biological Chemistry I Fall Semester, 2013

Chemistry 5.07SC Biological Chemistry I Fall Semester, 2013 Chemistry 5.07SC Biological Chemistry I Fall Semester, 2013 Lecture 9 Biochemical Transformations I. Carbon-carbon bond forming and cleaving reactions in Biology (see the Lexicon). Enzymes catalyze a limited

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Information Modest stabilization by most hydrogen-bonded side-chain interactions in membrane proteins Nathan HyunJoong Joh 1, Andrew Min 1, Salem Faham 2, Julian P. Whitelegge 3, Duan Yang

More information

MicroCal itc 200. System MicroCal Auto-iTC 200. System. GE Healthcare Life Sciences. System design and description. provide:

MicroCal itc 200. System MicroCal Auto-iTC 200. System. GE Healthcare Life Sciences. System design and description. provide: GE Healthcare Life Sciences Data file 28-97822 AC MicroCal label-free interaction analysis MicroCal itc 2 System MicroCal Auto-iTC 2 System MicroCal itc 2 and MicroCal Auto-iTC 2 isothermal titration calorimetry

More information

for Molecular Biology and Neuroscience and Institute of Medical Microbiology, Rikshospitalet-Radiumhospitalet

for Molecular Biology and Neuroscience and Institute of Medical Microbiology, Rikshospitalet-Radiumhospitalet SUPPLEMENTARY INFORMATION TO Structural basis for enzymatic excision of N -methyladenine and N 3 -methylcytosine from DNA Ingar Leiros,5, Marivi P. Nabong 2,3,5, Kristin Grøsvik 3, Jeanette Ringvoll 2,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Figure S1. Secondary structure of CAP (in the camp 2 -bound state) 10. α-helices are shown as cylinders and β- strands as arrows. Labeling of secondary structure is indicated. CDB, DBD and the hinge are

More information

Supplementary Materials for

Supplementary Materials for advances.sciencemag.org/cgi/content/full/3/4/e1600663/dc1 Supplementary Materials for A dynamic hydrophobic core orchestrates allostery in protein kinases Jonggul Kim, Lalima G. Ahuja, Fa-An Chao, Youlin

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature12242 C. thermophilum 666 RPAVLDNVYIRPALE-GKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQN S. pombe 659 RPAHINDVYVRPAID-GKRLPGFIEIHQNGIRYQSPLRSDSHIDLLFSNMKHLFFQPCEG

More information

Supplementary Materials for

Supplementary Materials for www.advances.sciencemag.org/cgi/content/full/1/7/e1500263/dc1 Supplementary Materials for Newton s cradle proton relay with amide imidic acid tautomerization in inverting cellulase visualized by neutron

More information

Oxidative Phosphorylation versus. Photophosphorylation

Oxidative Phosphorylation versus. Photophosphorylation Photosynthesis Oxidative Phosphorylation versus Photophosphorylation Oxidative Phosphorylation Electrons from the reduced cofactors NADH and FADH 2 are passed to proteins in the respiratory chain. In eukaryotes,

More information

1. Ion exchange chromatography

1. Ion exchange chromatography 1. Ion exchange chromatography Ion Exchange Chromatography Most popular method for the separation or purification of charged molecules. In cation exchange chromatography, positively charged molecules are

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Figure 1: The HpUreI crystal used for collection of native diffraction data. The crystal belongs to spacegroup P4 2 2 1 2 and has an approximate maximal dimension of 0.25 mm. Supplementary

More information

Supplementary Material

Supplementary Material upplementary Material Molecular docking and ligand specificity in fragmentbased inhibitor discovery Chen & hoichet 26 27 (a) 2 1 2 3 4 5 6 7 8 9 10 11 12 15 16 13 14 17 18 19 (b) (c) igure 1 Inhibitors

More information

Potassium channel gating and structure!

Potassium channel gating and structure! Reading: Potassium channel gating and structure Hille (3rd ed.) chapts 10, 13, 17 Doyle et al. The Structure of the Potassium Channel: Molecular Basis of K1 Conduction and Selectivity. Science 280:70-77

More information

Full-length GlpG sequence was generated by PCR from E. coli genomic DNA. (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),

Full-length GlpG sequence was generated by PCR from E. coli genomic DNA. (with two sequence variations, D51E/L52V, from the gene bank entry aac28166), Supplementary Methods Protein expression and purification Full-length GlpG sequence was generated by PCR from E. coli genomic DNA (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),

More information

Microcalorimetry for the Life Sciences

Microcalorimetry for the Life Sciences Microcalorimetry for the Life Sciences Why Microcalorimetry? Microcalorimetry is universal detector Heat is generated or absorbed in every chemical process In-solution No molecular weight limitations Label-free

More information

Lecture 15: Enzymes & Kinetics. Mechanisms ROLE OF THE TRANSITION STATE. H-O-H + Cl - H-O δ- H Cl δ- HO - + H-Cl. Margaret A. Daugherty.

Lecture 15: Enzymes & Kinetics. Mechanisms ROLE OF THE TRANSITION STATE. H-O-H + Cl - H-O δ- H Cl δ- HO - + H-Cl. Margaret A. Daugherty. Lecture 15: Enzymes & Kinetics Mechanisms Margaret A. Daugherty Fall 2004 ROLE OF THE TRANSITION STATE Consider the reaction: H-O-H + Cl - H-O δ- H Cl δ- HO - + H-Cl Reactants Transition state Products

More information

Serine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition

Serine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition Supplementary Information to Serine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition Nadine Czudnochowski 1,2, *, Christian A. Bösken 1, * & Matthias Geyer 1 1 Max-Planck-Institut

More information

Problem solving steps

Problem solving steps Problem solving steps Determine the reaction Write the (balanced) equation ΔG K v Write the equilibrium constant v Find the equilibrium constant using v If necessary, solve for components K K = [ p ] ν

More information

schematic diagram; EGF binding, dimerization, phosphorylation, Grb2 binding, etc.

schematic diagram; EGF binding, dimerization, phosphorylation, Grb2 binding, etc. Lecture 1: Noncovalent Biomolecular Interactions Bioengineering and Modeling of biological processes -e.g. tissue engineering, cancer, autoimmune disease Example: RTK signaling, e.g. EGFR Growth responses

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis Sergio de Cima, Luis M. Polo, Carmen Díez-Fernández, Ana I. Martínez, Javier

More information

SUPPLEMENTARY INFORMATION. Structural basis of laminin binding to the LARGE glycans on dystroglycan

SUPPLEMENTARY INFORMATION. Structural basis of laminin binding to the LARGE glycans on dystroglycan SUPPLEMENTARY INFORMATION Structural asis of laminin inding to the LARGE glycans on dystroglycan David C. Briggs 1, Takako Yoshida-Moriguchi 2, Tianqing Zheng 2, David Venzke 2, Mary Anderson 2, Andrea

More information

Supplementary Information

Supplementary Information Supplementary Information Structural analysis of leader peptide binding enables leaderfree cyanobactin processing Jesko Koehnke 1,2, Greg Mann 1,2, Andrew F Bent 1,2, Hannes Ludewig 1, Sally Shirran 1,

More information

Isothermal titration calorimetry (ITC)

Isothermal titration calorimetry (ITC) Isothermal titration calorimetry (ITC) Peter.gimeson@malvern.com Why microcalorimetry? Label-free Broad dynamic range Information rich Ease-of-use Direct measurement of heat change (ITC) Direct measurement

More information

Microcalorimetric techniques

Microcalorimetric techniques Microcalorimetric techniques Isothermal titration calorimetry (ITC) Differential scanning calorimetry (DSC) Filip Šupljika Filip.Supljika@irb.hr Laboratory for the study of interactions of biomacromolecules

More information

Structural basis for catalytically restrictive dynamics of a high-energy enzyme state

Structural basis for catalytically restrictive dynamics of a high-energy enzyme state Supplementary Material Structural basis for catalytically restrictive dynamics of a high-energy enzyme state Michael Kovermann, Jörgen Ådén, Christin Grundström, A. Elisabeth Sauer-Eriksson, Uwe H. Sauer

More information

Nature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1. Experimental approach for enhancement of unbiased Fo Fc maps.

Nature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1. Experimental approach for enhancement of unbiased Fo Fc maps. Supplementary Figure 1 Experimental approach for enhancement of unbiased Fo Fc maps. a, c, Unbiased Fo-Fc maps of the Tth 70S post-catalysis complex at 2.55 Å resolution with (a) or without (c) bulk solvent

More information

2. In regards to the fluid mosaic model, which of the following is TRUE?

2. In regards to the fluid mosaic model, which of the following is TRUE? General Biology: Exam I Sample Questions 1. How many electrons are required to fill the valence shell of a neutral atom with an atomic number of 24? a. 0 the atom is inert b. 1 c. 2 d. 4 e. 6 2. In regards

More information

Carbazole Derivatives Binding to c-kit G-quadruplex DNA

Carbazole Derivatives Binding to c-kit G-quadruplex DNA Supplementary Materials Carbazole Derivatives Binding to c-kit G-quadruplex DNA Agata Głuszyńska 1, *, Bernard Juskowiak 1, Martyna Kuta-Siejkowska 2, Marcin Hoffmann 2 and Shozeb Haider 3 1 Laboratory

More information

Biological Thermodynamics

Biological Thermodynamics Biological Thermodynamics Classical thermodynamics is the only physical theory of universal content concerning which I am convinced that, within the framework of applicability of its basic contents, will

More information

T H E J O U R N A L O F G E N E R A L P H Y S I O L O G Y. jgp

T H E J O U R N A L O F G E N E R A L P H Y S I O L O G Y. jgp S u p p l e m e n ta l m at e r i a l jgp Lee et al., http://www.jgp.org/cgi/content/full/jgp.201411219/dc1 T H E J O U R N A L O F G E N E R A L P H Y S I O L O G Y S u p p l e m e n ta l D I S C U S

More information

Supplementary materials. Crystal structure of the carboxyltransferase domain. of acetyl coenzyme A carboxylase. Department of Biological Sciences

Supplementary materials. Crystal structure of the carboxyltransferase domain. of acetyl coenzyme A carboxylase. Department of Biological Sciences Supplementary materials Crystal structure of the carboxyltransferase domain of acetyl coenzyme A carboxylase Hailong Zhang, Zhiru Yang, 1 Yang Shen, 1 Liang Tong Department of Biological Sciences Columbia

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11744 Supplementary Table 1. Crystallographic data collection and refinement statistics. Wild-type Se-Met-BcsA-B SmCl 3 -soaked EMTS-soaked Data collection Space

More information

Enzymes I. Dr. Mamoun Ahram Summer semester,

Enzymes I. Dr. Mamoun Ahram Summer semester, Enzymes I Dr. Mamoun Ahram Summer semester, 2017-2018 Resources Mark's Basic Medical Biochemistry Other resources NCBI Bookshelf: http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=books The Medical Biochemistry

More information

Supporting Information

Supporting Information Supporting Information Arai et al. 10.1073/pnas.15179911 SI Text Protein Expression and Purification. Myb3 (mouse, residues 84 315) was expressed in Escherichia coli as a fusion with the B1 domain of protein

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11085 Supplementary Tables: Supplementary Table 1. Summary of crystallographic and structure refinement data Structure BRIL-NOP receptor Data collection Number of crystals 23 Space group

More information

Supplementary Figure 1 Pairing alignments, turns and extensions within the structure of the ribozyme-product complex. (a) The alignment of the G27

Supplementary Figure 1 Pairing alignments, turns and extensions within the structure of the ribozyme-product complex. (a) The alignment of the G27 Supplementary Figure 1 Pairing alignments, turns and extensions within the structure of the ribozyme-product complex. (a) The alignment of the G27 A40 non-canonical pair stacked over the A41 (G1-C26) three-base

More information

Structural Mechanism for the Fidelity Modulation of DNA Polymerase λ. 128 Academia Road Sec. 2, Nankang, Taipei, 115, Taiwan

Structural Mechanism for the Fidelity Modulation of DNA Polymerase λ. 128 Academia Road Sec. 2, Nankang, Taipei, 115, Taiwan SUPPORTING INFORMATION Structural Mechanism for the Fidelity Modulation of DNA Polymerase λ Mu-Sen Liu, 1,3 Hsin-Yue Tsai, 1,# Xiao-Xia Liu, 1,# Meng-Chiao Ho, 1,3 Wen-Jin Wu, 1,* and Ming-Daw Tsai 1,2,3,*

More information

Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps

Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps Cell Reports Supplemental Information Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps Chih-Chia Su, Jani Reddy Bolla, Nitin Kumar, Abhijith Radhakrishnan,

More information

Materials. The three sulfonated calixarene host molecules, p- molecules, 5,6-dihydropyrazion[1,2,3,4-lmn][1,10]phenanthroline-4,7-diium (DP 2+ ) 4

Materials. The three sulfonated calixarene host molecules, p- molecules, 5,6-dihydropyrazion[1,2,3,4-lmn][1,10]phenanthroline-4,7-diium (DP 2+ ) 4 Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 214 Experimental Section Materials. The three sulfonated calixarene host molecules, p- sulfonatocalix[4]arene

More information

CH 3 CH 2 OH +H 2 O CHO. 2e + 2H + + O 2 H 2 O +HCOOH

CH 3 CH 2 OH +H 2 O CHO. 2e + 2H + + O 2 H 2 O +HCOOH 2 4 H CH 3 2e + 2H + + 2 H 2 2 H CH 2 H 2e + 2H + + 2 H 2 2 H +H 2 CH 2e + 2H + + 2 H 2 2 H +HCH Supplemental Figure S. The three-step 4DM reaction, each step requires two reducing equivalents from ADPH

More information

4 Examples of enzymes

4 Examples of enzymes Catalysis 1 4 Examples of enzymes Adding water to a substrate: Serine proteases. Carbonic anhydrase. Restrictions Endonuclease. Transfer of a Phosphoryl group from ATP to a nucleotide. Nucleoside monophosphate

More information

IgE binds asymmetrically to its B cell receptor CD23

IgE binds asymmetrically to its B cell receptor CD23 Supplementary Information IgE binds asymmetrically to its B cell receptor CD23 Balvinder Dhaliwal 1*, Marie O. Y. Pang 2, Anthony H. Keeble 2,3, Louisa K. James 2,4, Hannah J. Gould 2, James M. McDonnell

More information

Rational Design of Thermodynamic and Kinetic Binding Profiles by. Optimizing Surface Water Networks Coating Protein Bound Ligands

Rational Design of Thermodynamic and Kinetic Binding Profiles by. Optimizing Surface Water Networks Coating Protein Bound Ligands SUPPORTING INFORMATION Rational Design of Thermodynamic and Kinetic Binding Profiles by Optimizing Surface Water Networks Coating Protein Bound Ligands Stefan G. Krimmer,, Jonathan Cramer,, Michael Betz,

More information

It s the amino acids!

It s the amino acids! Catalytic Mechanisms HOW do enzymes do their job? Reducing activation energy sure, but HOW does an enzyme catalysis reduce the energy barrier ΔG? Remember: The rate of a chemical reaction of substrate

More information

Calorimetry: differential scanning calorimetry (DSC), isothermal titration calorimetry (ITC)

Calorimetry: differential scanning calorimetry (DSC), isothermal titration calorimetry (ITC) Calorimetry: differential scanning calorimetry (DSC), isothermal titration calorimetry (ITC) Dr. Yin Li Department of Biophysics, Medical School University of Pecs Thermal Analysis IUPAC definition - a

More information

Acta Crystallographica Section D

Acta Crystallographica Section D Supporting information Acta Crystallographica Section D Volume 70 (2014) Supporting information for article: Structural characterization of the virulence factor Nuclease A from Streptococcus agalactiae

More information

Supporting Information

Supporting Information Supporting Information Structural Basis of the Antiproliferative Activity of Largazole, a Depsipeptide Inhibitor of the Histone Deacetylases Kathryn E. Cole 1, Daniel P. Dowling 1,2, Matthew A. Boone 3,

More information

Supplementary Information. Overlap between folding and functional energy landscapes for. adenylate kinase conformational change

Supplementary Information. Overlap between folding and functional energy landscapes for. adenylate kinase conformational change Supplementary Information Overlap between folding and functional energy landscapes for adenylate kinase conformational change by Ulrika Olsson & Magnus Wolf-Watz Contents: 1. Supplementary Note 2. Supplementary

More information

CHEMICAL BONDS. Attraction that holds molecules together Involves valence electrons. Ionic Bonds Covalent Bonds. Involves sharing of.

CHEMICAL BONDS. Attraction that holds molecules together Involves valence electrons. Ionic Bonds Covalent Bonds. Involves sharing of. CHEMICAL BONDS DEFINITION/DESCRIPTION: Attraction that holds molecules together Involves valence electrons TYPES: Ionic Bonds Covalent Bonds Involves sharing of electrons Electronegativities O = 3.5 N

More information

Measurement of Enzyme Activity - ALP Activity (ALP: Alkaline phosphatase)

Measurement of Enzyme Activity - ALP Activity (ALP: Alkaline phosphatase) Measurement of Enzyme Activity - ALP Activity (ALP: Alkaline phosphatase) Measurement and analysis of enzyme activity is often used in the field of life science such as medicines and foods to investigate

More information

Isothermal Titration Calorimetry in Drug Discovery. Geoff Holdgate Structure & Biophysics, Discovery Sciences, AstraZeneca October 2017

Isothermal Titration Calorimetry in Drug Discovery. Geoff Holdgate Structure & Biophysics, Discovery Sciences, AstraZeneca October 2017 Isothermal Titration Calorimetry in Drug Discovery Geoff Holdgate Structure & Biophysics, Discovery Sciences, AstraZeneca October 217 Introduction Introduction to ITC Strengths / weaknesses & what is required

More information

Anion Binding by Biotin[6]uril in Water

Anion Binding by Biotin[6]uril in Water Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2014 Anion Binding by Biotin[6]uril in Water Micke Lisbjerg, Bjarne Enrico Nielsen,

More information

Supplementary Information for

Supplementary Information for Supplementary Information for Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains Hyoun Sook Kim

More information

[Urea] (M) k (s -1 )

[Urea] (M) k (s -1 ) BMB178 Fall 2018 Problem Set 1 Due: 10/26/2018, noon Office hour: 10/25/2018, SFL GSR218 7 9 pm Problem 1. Transition state theory (20 points): Consider a unimolecular reaction where a substrate S is converted

More information

Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R)

Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R) Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R) Shown in cyan and green are two adjacent tetramers from the crystallographic lattice of COP, forming the only unique inter-tetramer

More information