SUPPLEMENTARY INFORMATION
|
|
- Gordon Lester
- 5 years ago
- Views:
Transcription
1 doi: /nature10458 Active Site Remodeling in the Bifunctional Fructose-1,6- bisphosphate aldolase/phosphatase Juan Du, Rafael F. Say, Wei Lü, Georg Fuchs & Oliver Einsle SUPPLEMENTARY FIGURES Figure S1: Structure of T. neutrophilus FBPAP. a) The monomer folds into a compact domain with a C-terminal extension that wraps around a neighboring protomer of the octameric complex. Phosphatase lid is shown in blue, the aldolase loop in red and the anchor loop in yellow. b) The FBPAP octamer in surface representation, with a single monomer shown as cartoon to emphasize the position of the chain. 1
2 Figure S2: Stereo view of the active site of TnFBPAP in the native state with two bound Mg 2+ ions. Direct ligands of the two cations are D11, H18, D52, D53, D132 and D234. The water molecule coordinated to D11, D53 and Mg2 (marked H 2 O) is at the position from which the nucleophilic attack is carried out in the phosphatase reaction. This position was occupied with a water in all structures. When treated with 50 mm EDTA, Mg 1 is removed, but Mg 2 remains bound to the protein. 2
3 3
4 Figure S3 (previous page): Top view of the active site in the four structures of TnFBPAP. A) Native state, B) DHAP-bound state with 2 molecules of DHAP as ligands, C) FBP complex and D) F6P product complex. For all soaked ligands, F o F c omit difference electron density maps were calculated after simulated annealing refinement without the adduct and contoured at the 3.5σ level. Figure S4: Stereo view of the active site of TnFBPAP in complex with FBP and four bound Mg 2+ ions (Fig. 1C, 2C). The phosphatase lid is in its closed conformation and the aldolase loop is in the locked conformation, with the side chain of the catalytic residue for the aldol condensation, K232, forming a hydrogen bond to the backbone carbonyl of P111 at the base of the phosphatase lid. Residue D233 that points away from the active site when the enzyme acts as an aldolase (in conformation of the aldolase loop) now coordinates both Mg3 and Mg4. E357 in the anchor loop contacts Mg4 through two well-defined water molecules and the substrate is fixed in place by Y91, D297 and Y
5 Figure S5: Mg 2+ binding to native TnFBPAP. Isothermal calorimetric titration of the enzyme at 50 C after EDTA-treatment shows entropy-driven binding to a single site with a K d = 27 µm. The structure of the EDTA-treated form revealed that Mg 2 is retained, so that the above event represents the binding of Mg 1. The experiment was carried out in the absence of DHAP, and no binding of a second Mg 2+ ion, Mg 3, is observed. Hollow squares indicate the reference curve that was subtracted from the experimental data. 5
6 Figure S6: TnFBPAP activities dependent on the concentration of Mg 2+ in the reaction buffer. a) aldolase activity and b) phosphatase activity differ in v max, but show very similar K M values. Under physiological conditions of > 10 mm Mg 2+ the availability of the cation should not be limiting for enzymatic activity. 6
7 Figure S7: Binding of the first substrate, DHAP. At 42 C the binding of substrate is an entropy-driven process with a dissociation constant of K d = 25.5 µm. The experiment was carried out in the presence of 10 mm MgCl 2 in the reaction buffer. Note that only a single binding event is observed. The second binding site for DHAP that was observed in the crystal structure will likely be only occupied when the substrate is added in large excess, as was the case during crystal soaking. 7
8 SUPPLEMENTARY METHODS Isothermal Titration Calorimetry Thermodynamic parameters for binding of Mg 2+ and the substrates G3P and DHAP to TnFBPAP were determined by isothermal calorimetric titrations on a Microcal VP-ITC calorimeter (GE Healthcare). Both protein and ligand solutions were prepared in the same buffer condition. As a control, a reference titration was performed by adding the ligand to buffer without protein, in order to correct for the heat of dilution of the titrant. ITC measurements of Mg 2+ binding to the enzyme were carried out at 30 C and 50 C in buffer containing 20 mm Tris-HCl (ph 8.0), 150 mm NaCl and 10% glycerol. Mg ions in the enzyme were removed by 50 mm EDTA. In this instance 122 µl Mg 2+ (3 mm MgCl 2, 20mM Tris/HCl at ph 8.0, 150 mm NaCl and 10% glycerol) was titrated to 1.4 ml TnFBPAP (0.08 mm) in 13 injections (1 2 µl µl). Due to the instability of the triose phosphates at high temperatures, the titrations of G3P and DHAP (1 mm and 1.2 mm in 20 mm Tris/HCl at ph 8.0, 150 mm NaCl, 10 mm MgCl 2 and 10% glycerol) to TnFBPAP (0.04 mm) were done at 42 C, with 13 injections (1 x 3 µl + 12 x 10 µl). Microcal Origin was used for processing and analysis of the calorimetric data. 8
9 SUPPLEMENTARY TABLES Table S1 Data collection and refinement statistics Ligand-free DHAP Fru-1,6-BP Fru-6-P EDTA Y229F Data collection Space group I422 I422 I422 I422 I422 I422 Cell dimensions a, b, c (Å) 112.5, 112.5, , 112.4, , 112.3, , 112.3, , 112,3, , 112.4, α, β, γ ( ) 90.0, 90.0, , 90.0, , 90.0, , 90.0, , 90.0, , 90.0, 90.0 Resolution (Å) ( ) * ( ) ( ) ( ) ( ) ( ) R sym or R merge (0.363) (0.373) (0.424) (0.371) (0.714) (0.599) I/σI 22.4 (6.0) 17.4 (4.9) 18.5 (5.1) 15.3 (5.2) 16.6 (2.5) 10.7 (3.0) Completeness (%) 99.9 (99.9) 99.8 (99.9) 99.9 (99.9) 99.8 (99.9) (100) 99.3 (99.6) Redundancy 10.0 (10.3) 7.9 (7.3) 9.2 (8.5) 8.0 (7.3) 5.8 (5.9) 6.4 (6.5) Refinement Resolution (Å) ( ) ( ) ( ) ( ) ( ) ( ) No. reflections 70,543 (5,416) 111,585 (8,613) 97,834 (7,534) 54,151 (4,060) 38,467 (3,111) 9,583 (680) R work/ R free 0.165/0.188 (0.236/0.259) 0.108/0.129 (0.167/0.186) 0.104/0.126 (0.160/0.204) 0.149/0.178 (0.210/0.231) 0.154/0.191 (0.217/0.274) 0.178/0.234 (0.198/0.288) No. atoms Protein Ligand/ion Water B-factors Protein Ligand/ion Water R.m.s deviations Bond lengths (Å) Bond angles (º) *Highest resolution shell is shown in parenthesis. 9
10 Table S2 Specific activities and substrate affinities for the FBP-Aldolase/Phosphatase from Cenarchaeum symbiosum (CS) and Thermoproteus neutrophilus (TN) and its variants. The specific activities correspond to the relative activities in Fig. 3. Enzyme variant Phosphatase reaction Specific activity (µmol min -1 mg -1 ) K M (mm) Aldolase reaction (catabolic*) Specific activity (µmol min -1 mg -1 ) K M (mm) CS wildtype ± ± ± ± 20 CS Y229F ± ± ± i.m. CS K232R ± ± < i.m. CS D233N ± i.m ± i.m. CS E347Q ± i.m ± ND CS Y348F ± i.m ± ND TN wildtype ± ND ± ND TN Y229F ± ND < i.m. TN D297N ± ND < i.m. ND = not determined i.m. = incapable of measurement * = measured with 100 mm FBP 10
SUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES Supplementary Figure 1 Protein sequence alignment of Vibrionaceae with either a 40-residue insertion or a 44-residue insertion. Identical residues are indicated by red background.
More informationSUPPLEMENTARY INFORMATION
Table of Contents Page Supplementary Table 1. Diffraction data collection statistics 2 Supplementary Table 2. Crystallographic refinement statistics 3 Supplementary Fig. 1. casic1mfc packing in the R3
More informationSUPPLEMENTARY INFORMATION
Supplementary materials Figure S1 Fusion protein of Sulfolobus solfataricus SRP54 and a signal peptide. a, Expression vector for the fusion protein. The signal peptide of yeast dipeptidyl aminopeptidase
More informationSUPPLEMENTARY INFORMATION
www.nature.com/nature 1 Figure S1 Sequence alignment. a Structure based alignment of the plgic of E. chrysanthemi (ELIC), the acetylcholine binding protein from the snail Lymnea stagnalis (AchBP, PDB code
More informationSUPPLEMENTARY INFORMATION. doi: /nature07461
Figure S1 Electrophysiology. a ph-activation of. Two-electrode voltage clamp recordings of Xenopus oocytes expressing in comparison to waterinjected oocytes. Currents were recorded at 40 mv. The ph of
More informationSUPPLEMENTARY INFORMATION
Supplementary Table 1: Data collection, phasing and refinement statistics ChbC/Ta 6 Br 12 Native ChbC Data collection Space group P4 3 2 1 2 P4 3 2 1 2 Cell dimensions a, c (Å) 132.75, 453.57 132.81, 452.95
More informationTable 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2
Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11524 Supplementary discussion Functional analysis of the sugar porter family (SP) signature motifs. As seen in Fig. 5c, single point mutation of the conserved
More informationSupplementary Figures
1 Supplementary Figures Supplementary Figure 1 Type I FGFR1 inhibitors (a) Chemical structures of a pyrazolylaminopyrimidine inhibitor (henceforth referred to as PAPI; PDB-code of the FGFR1-PAPI complex:
More informationThe structure of a nucleolytic ribozyme that employs a catalytic metal ion. Yijin Liu, Timothy J. Wilson and David M.J. Lilley
SUPPLEMENTARY INFORMATION The structure of a nucleolytic ribozyme that employs a catalytic metal ion Yijin Liu, Timothy J. Wilson and David M.J. Lilley Cancer Research UK Nucleic Acid Structure Research
More informationTable S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.
Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-
More informationSupplementary Information
Supplementary Information The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis Marta C. Marques a, Cristina Tapia b, Oscar Gutiérrez-Sanz b, Ana Raquel Ramos a, Kimberly L.
More informationSUPPLEMENTARY INFORMATION
Dph2 SeMet (iron-free) # Dph2 (iron-free) Dph2-[4Fe-4S] Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell dimensions a, b, c (Å) 58.26, 82.08, 160.42 58.74, 81.87, 160.01 55.70, 80.53,
More informationThe structure of a nucleolytic ribozyme that employs a catalytic metal ion Liu, Yijin; Wilson, Timothy; Lilley, David
University of Dundee The structure of a nucleolytic ribozyme that employs a catalytic metal ion Liu, Yijin; Wilson, Timothy; Lilley, David Published in: Nature Chemical Biology DOI: 10.1038/nchembio.2333
More informationSUPPLEMENTARY INFORMATION
doi:1.138/nature1737 Supplementary Table 1 variant Description FSEC - 2B12 a FSEC - 6A1 a K d (leucine) c Leucine uptake e K (wild-type like) K (Y18F) K (TS) K (TSY) K288A mutant, lipid facing side chain
More informationSUPPLEMENTARY INFORMATION
Supplementary Results DNA binding property of the SRA domain was examined by an electrophoresis mobility shift assay (EMSA) using synthesized 12-bp oligonucleotide duplexes containing unmodified, hemi-methylated,
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11054 Supplementary Fig. 1 Sequence alignment of Na v Rh with NaChBac, Na v Ab, and eukaryotic Na v and Ca v homologs. Secondary structural elements of Na v Rh are indicated above the
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/5/243/ra68/dc1 Supplementary Materials for Superbinder SH2 Domains Act as Antagonists of Cell Signaling Tomonori Kaneko, Haiming Huang, Xuan Cao, Xing Li, Chengjun
More informationCholera Toxin Invasion
Protein-carbohydrate interactions: Isothermal Titration Calorimetry Dr Bruce Turnbull School of Chemistry and Astbury Centre for Structural Molecular Biology University of Leeds Cholera Toxin Invasion
More informationS2004 Methods for characterization of biomolecular interactions - classical versus modern
S2004 Methods for characterization of biomolecular interactions - classical versus modern Isothermal Titration Calorimetry (ITC) Eva Dubská email: eva.dubska@ceitec.cz Outline Calorimetry - history + a
More informationISoTherMal TITraTIon Calorimetry
ISoTherMal TITraTIon Calorimetry With the Nano ITC, heat effects as small as 1 nanojoules are detectable using one nanomole or less of biopolymer. The Nano ITC uses a solid-state thermoelectric heating
More informationDiphthamide biosynthesis requires a radical iron-sulfur enzyme. Pennsylvania State University, University Park, Pennsylvania 16802, USA
Diphthamide biosynthesis requires a radical iron-sulfur enzyme Yang Zhang, 1,4 Xuling Zhu, 1,4 Andrew T. Torelli, 1 Michael Lee, 2 Boris Dzikovski, 1 Rachel Koralewski, 1 Eileen Wang, 1 Jack Freed, 1 Carsten
More informationBacterial protease uses distinct thermodynamic signatures for substrate recognition
Bacterial protease uses distinct thermodynamic signatures for substrate recognition Gustavo Arruda Bezerra, Yuko Ohara-Nemoto, Irina Cornaciu, Sofiya Fedosyuk, Guillaume Hoffmann, Adam Round, José A. Márquez,
More informationAccording to the manufacture s direction (Pierce), RNA and DNA
Supplementary method Electrophoretic Mobility-shift assay (EMSA) According to the manufacture s direction (Pierce), RNA and DNA oligonuleotides were firstly labeled by biotin. TAVb (1pM) was incubated
More informationSUPPLEMENTARY INFORMATION. Pistol Ribozyme Adopts a Pseudoknot Fold. Facilitating Site-specific In-line Cleavage
UPPLEMENTAY INFMATIN Pistol ibozyme Adopts a Pseudoknot Fold Facilitating ite-specific In-line Cleavage Aiming en 1,2,4, Nikola Vušurović 3,4, Jennifer Gebetsberger 3, Pu Gao 2, Michael Juen 3, Christoph
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12045 Supplementary Table 1 Data collection and refinement statistics. Native Pt-SAD X-ray source SSRF BL17U SPring-8 BL41XU Wavelength (Å) 0.97947 1.07171 Space group P2 1 2 1 2 1 P2
More informationAnalysis of nucleotide binding to p97 reveals the properties of a tandem AAA hexameric ATPase
SUPPLEMENTARY INFORMATION Analysis of nucleotide binding to p97 reveals the properties of a tandem AAA hexameric ATPase Louise C Briggs, Geoff S Baldwin, Non Miyata, Hisao Kondo, Xiaodong Zhang, Paul S
More informationPresentation Microcalorimetry for Life Science Research
Presentation Microcalorimetry for Life Science Research MicroCalorimetry The Universal Detector Heat is either generated or absorbed in every chemical process Capable of thermal measurements over a wide
More informationSUPPLEMENTARY INFORMATION
Supplementary Table 1: Amplitudes of three current levels. Level 0 (pa) Level 1 (pa) Level 2 (pa) TrkA- TrkH WT 200 K 0.01 ± 0.01 9.5 ± 0.01 18.7 ± 0.03 200 Na * 0.001 ± 0.01 3.9 ± 0.01 12.5 ± 0.03 200
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11539 Supplementary Figure 1 Schematic representation of plant (A) and mammalian (B) P 2B -ATPase domain organization. Actuator (A-), nucleotide binding (N-),
More informationStructurale, Université Grenoble Alpes, CNRS, CEA, Grenoble, France
Supplementary Information to Lysine relay mechanism coordinates intermediate transfer in vitamin B6 biosynthesis Matthew J. Rodrigues 1,2, Volker Windeisen 1,3, Yang Zhang 4, Gabriela Guédez 3, Stefan
More informationSUPPLEMENTARY INFORMATION
doi:10.108/nature11899 Supplementar Table 1. Data collection and refinement statistics (+TPMP, native) (-TPMP, native) (+TPMP, recombinant) (MgCl ) (MgSO ) Data collection Space group C P 1 C P 1 1 P 1
More informationThe copper active site in CBM33 polysaccharide oxygenases
Supporting Information for: The copper active site in CBM33 polysaccharide oxygenases Glyn R. Hemsworth, Edward J. Taylor, Robbert Q. Kim, Rebecca C. Gregory, Sally J. Lewis, Johan P. Turkenburg, Alison
More informationSUPPLEMENTARY INFORMATION
Supplementary Table S1 Kinetic Analyses of the AMSH-LP mutants AMSH-LP K M (μm) k cat x 10-3 (s -1 ) WT 71.8 ± 6.3 860 ± 65.4 T353A 76.8 ± 11.7 46.3 ± 3.7 F355A 58.9 ± 10.4 5.33 ± 0.30 proximal S358A 75.1
More informationtype GroEL-GroES complex. Crystals were grown in buffer D (100 mm HEPES, ph 7.5,
Supplementary Material Supplementary Materials and Methods Structure Determination of SR1-GroES-ADP AlF x SR1-GroES-ADP AlF x was purified as described in Materials and Methods for the wild type GroEL-GroES
More informationPlasmid Relevant features Source. W18N_D20N and TrXE-W18N_D20N-anti
Table S1. E. coli plasmids Plasmid Relevant features Source pdg680 T. reesei XynII AA 2-190 with C-terminal His 6 tag optimized for E. coli expression in pjexpress401 Wan et al. (in press) psbn44d psbn44h
More informationSupplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization
Supplementary Information Structural basis for precursor protein-directed ribosomal peptide macrocyclization Kunhua Li 1,3, Heather L. Condurso 1,3, Gengnan Li 1, Yousong Ding 2 and Steven D. Bruner 1*
More informationSUPPLEMENTARY INFORMATION
Fig. 1 Influences of crystal lattice contacts on Pol η structures. a. The dominant lattice contact between two hpol η molecules (silver and gold) in the type 1 crystals. b. A close-up view of the hydrophobic
More informationEnzymes Enzyme Mechanism
Mechanisms of Enzymes BCMB 3100 Chapters 6, 7, 8 Enzymes Enzyme Mechanism 1 Energy diagrams Binding modes of enzyme catalysis Chemical modes of enzyme catalysis Acid-Base catalysis Covalent catalysis Binding
More informationEnzymes Enzyme Mechanism
BCMB 3100 Chapters 6, 7, 8 Enzymes Enzyme Mechanism 1 Mechanisms of Enzymes Energy diagrams Binding modes of enzyme catalysis Chemical modes of enzyme catalysis Acid-Base catalysis Covalent catalysis Binding
More information13.3A: The general mechanism for an aldol reaction
Ashley Robison My Preferences Site Tools FAQ Sign Out If you like us, please share us on social media. The latest UCD Hyperlibrary newsletter is now complete, check it out. ChemWiki BioWiki GeoWiki StatWiki
More informationThe structure of vanadium nitrogenase reveals an unusual bridging ligand
SUPPLEMENTARY INFORMATION The structure of vanadium nitrogenase reveals an unusual bridging ligand Daniel Sippel and Oliver Einsle Lehrstuhl Biochemie, Institut für Biochemie, Albert-Ludwigs-Universität
More informationRedox-Responsive Complexation between a. Pillar[5]arene with Mono ethylene oxide Substituents. and Paraquat
Redox-Responsive Complexation between a Pillar[5]arene with Mono ethylene oxide Substituents and Paraquat Xiaodong Chi, Min Xue, Yong Yao and Feihe Huang* MOE Key Laboratory of Macromolecular Synthesis
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10955 Supplementary Figures Supplementary Figure 1. Electron-density maps and crystallographic dimer structures of the motor domain. (a f) Stereo views of the final electron-density maps
More informationEnergetics of chitooligosaccharide binding to pumpkin (Cucurbita maxima) phloem exudate Lectin
Chapter 3 Energetics of chitooligosaccharide binding to pumpkin (Cucurbita maxima) phloem exudate Lectin 50 Chapter 3 Energetics of 51 Summary Binding of chitooligosaccharides [(GlcNAc) 2-6 ] to pumpkin
More informationChemistry 5.07SC Biological Chemistry I Fall Semester, 2013
Chemistry 5.07SC Biological Chemistry I Fall Semester, 2013 Lecture 9 Biochemical Transformations I. Carbon-carbon bond forming and cleaving reactions in Biology (see the Lexicon). Enzymes catalyze a limited
More informationSUPPLEMENTARY INFORMATION
Supplementary Information Modest stabilization by most hydrogen-bonded side-chain interactions in membrane proteins Nathan HyunJoong Joh 1, Andrew Min 1, Salem Faham 2, Julian P. Whitelegge 3, Duan Yang
More informationMicroCal itc 200. System MicroCal Auto-iTC 200. System. GE Healthcare Life Sciences. System design and description. provide:
GE Healthcare Life Sciences Data file 28-97822 AC MicroCal label-free interaction analysis MicroCal itc 2 System MicroCal Auto-iTC 2 System MicroCal itc 2 and MicroCal Auto-iTC 2 isothermal titration calorimetry
More informationfor Molecular Biology and Neuroscience and Institute of Medical Microbiology, Rikshospitalet-Radiumhospitalet
SUPPLEMENTARY INFORMATION TO Structural basis for enzymatic excision of N -methyladenine and N 3 -methylcytosine from DNA Ingar Leiros,5, Marivi P. Nabong 2,3,5, Kristin Grøsvik 3, Jeanette Ringvoll 2,
More informationSUPPLEMENTARY INFORMATION
Figure S1. Secondary structure of CAP (in the camp 2 -bound state) 10. α-helices are shown as cylinders and β- strands as arrows. Labeling of secondary structure is indicated. CDB, DBD and the hinge are
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/3/4/e1600663/dc1 Supplementary Materials for A dynamic hydrophobic core orchestrates allostery in protein kinases Jonggul Kim, Lalima G. Ahuja, Fa-An Chao, Youlin
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature12242 C. thermophilum 666 RPAVLDNVYIRPALE-GKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQN S. pombe 659 RPAHINDVYVRPAID-GKRLPGFIEIHQNGIRYQSPLRSDSHIDLLFSNMKHLFFQPCEG
More informationSupplementary Materials for
www.advances.sciencemag.org/cgi/content/full/1/7/e1500263/dc1 Supplementary Materials for Newton s cradle proton relay with amide imidic acid tautomerization in inverting cellulase visualized by neutron
More informationOxidative Phosphorylation versus. Photophosphorylation
Photosynthesis Oxidative Phosphorylation versus Photophosphorylation Oxidative Phosphorylation Electrons from the reduced cofactors NADH and FADH 2 are passed to proteins in the respiratory chain. In eukaryotes,
More information1. Ion exchange chromatography
1. Ion exchange chromatography Ion Exchange Chromatography Most popular method for the separation or purification of charged molecules. In cation exchange chromatography, positively charged molecules are
More informationSUPPLEMENTARY INFORMATION
Supplementary Figure 1: The HpUreI crystal used for collection of native diffraction data. The crystal belongs to spacegroup P4 2 2 1 2 and has an approximate maximal dimension of 0.25 mm. Supplementary
More informationSupplementary Material
upplementary Material Molecular docking and ligand specificity in fragmentbased inhibitor discovery Chen & hoichet 26 27 (a) 2 1 2 3 4 5 6 7 8 9 10 11 12 15 16 13 14 17 18 19 (b) (c) igure 1 Inhibitors
More informationPotassium channel gating and structure!
Reading: Potassium channel gating and structure Hille (3rd ed.) chapts 10, 13, 17 Doyle et al. The Structure of the Potassium Channel: Molecular Basis of K1 Conduction and Selectivity. Science 280:70-77
More informationFull-length GlpG sequence was generated by PCR from E. coli genomic DNA. (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),
Supplementary Methods Protein expression and purification Full-length GlpG sequence was generated by PCR from E. coli genomic DNA (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),
More informationMicrocalorimetry for the Life Sciences
Microcalorimetry for the Life Sciences Why Microcalorimetry? Microcalorimetry is universal detector Heat is generated or absorbed in every chemical process In-solution No molecular weight limitations Label-free
More informationLecture 15: Enzymes & Kinetics. Mechanisms ROLE OF THE TRANSITION STATE. H-O-H + Cl - H-O δ- H Cl δ- HO - + H-Cl. Margaret A. Daugherty.
Lecture 15: Enzymes & Kinetics Mechanisms Margaret A. Daugherty Fall 2004 ROLE OF THE TRANSITION STATE Consider the reaction: H-O-H + Cl - H-O δ- H Cl δ- HO - + H-Cl Reactants Transition state Products
More informationSerine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition
Supplementary Information to Serine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition Nadine Czudnochowski 1,2, *, Christian A. Bösken 1, * & Matthias Geyer 1 1 Max-Planck-Institut
More informationProblem solving steps
Problem solving steps Determine the reaction Write the (balanced) equation ΔG K v Write the equilibrium constant v Find the equilibrium constant using v If necessary, solve for components K K = [ p ] ν
More informationschematic diagram; EGF binding, dimerization, phosphorylation, Grb2 binding, etc.
Lecture 1: Noncovalent Biomolecular Interactions Bioengineering and Modeling of biological processes -e.g. tissue engineering, cancer, autoimmune disease Example: RTK signaling, e.g. EGFR Growth responses
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis Sergio de Cima, Luis M. Polo, Carmen Díez-Fernández, Ana I. Martínez, Javier
More informationSUPPLEMENTARY INFORMATION. Structural basis of laminin binding to the LARGE glycans on dystroglycan
SUPPLEMENTARY INFORMATION Structural asis of laminin inding to the LARGE glycans on dystroglycan David C. Briggs 1, Takako Yoshida-Moriguchi 2, Tianqing Zheng 2, David Venzke 2, Mary Anderson 2, Andrea
More informationSupplementary Information
Supplementary Information Structural analysis of leader peptide binding enables leaderfree cyanobactin processing Jesko Koehnke 1,2, Greg Mann 1,2, Andrew F Bent 1,2, Hannes Ludewig 1, Sally Shirran 1,
More informationIsothermal titration calorimetry (ITC)
Isothermal titration calorimetry (ITC) Peter.gimeson@malvern.com Why microcalorimetry? Label-free Broad dynamic range Information rich Ease-of-use Direct measurement of heat change (ITC) Direct measurement
More informationMicrocalorimetric techniques
Microcalorimetric techniques Isothermal titration calorimetry (ITC) Differential scanning calorimetry (DSC) Filip Šupljika Filip.Supljika@irb.hr Laboratory for the study of interactions of biomacromolecules
More informationStructural basis for catalytically restrictive dynamics of a high-energy enzyme state
Supplementary Material Structural basis for catalytically restrictive dynamics of a high-energy enzyme state Michael Kovermann, Jörgen Ådén, Christin Grundström, A. Elisabeth Sauer-Eriksson, Uwe H. Sauer
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1. Experimental approach for enhancement of unbiased Fo Fc maps.
Supplementary Figure 1 Experimental approach for enhancement of unbiased Fo Fc maps. a, c, Unbiased Fo-Fc maps of the Tth 70S post-catalysis complex at 2.55 Å resolution with (a) or without (c) bulk solvent
More information2. In regards to the fluid mosaic model, which of the following is TRUE?
General Biology: Exam I Sample Questions 1. How many electrons are required to fill the valence shell of a neutral atom with an atomic number of 24? a. 0 the atom is inert b. 1 c. 2 d. 4 e. 6 2. In regards
More informationCarbazole Derivatives Binding to c-kit G-quadruplex DNA
Supplementary Materials Carbazole Derivatives Binding to c-kit G-quadruplex DNA Agata Głuszyńska 1, *, Bernard Juskowiak 1, Martyna Kuta-Siejkowska 2, Marcin Hoffmann 2 and Shozeb Haider 3 1 Laboratory
More informationBiological Thermodynamics
Biological Thermodynamics Classical thermodynamics is the only physical theory of universal content concerning which I am convinced that, within the framework of applicability of its basic contents, will
More informationT H E J O U R N A L O F G E N E R A L P H Y S I O L O G Y. jgp
S u p p l e m e n ta l m at e r i a l jgp Lee et al., http://www.jgp.org/cgi/content/full/jgp.201411219/dc1 T H E J O U R N A L O F G E N E R A L P H Y S I O L O G Y S u p p l e m e n ta l D I S C U S
More informationSupplementary materials. Crystal structure of the carboxyltransferase domain. of acetyl coenzyme A carboxylase. Department of Biological Sciences
Supplementary materials Crystal structure of the carboxyltransferase domain of acetyl coenzyme A carboxylase Hailong Zhang, Zhiru Yang, 1 Yang Shen, 1 Liang Tong Department of Biological Sciences Columbia
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11744 Supplementary Table 1. Crystallographic data collection and refinement statistics. Wild-type Se-Met-BcsA-B SmCl 3 -soaked EMTS-soaked Data collection Space
More informationEnzymes I. Dr. Mamoun Ahram Summer semester,
Enzymes I Dr. Mamoun Ahram Summer semester, 2017-2018 Resources Mark's Basic Medical Biochemistry Other resources NCBI Bookshelf: http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=books The Medical Biochemistry
More informationSupporting Information
Supporting Information Arai et al. 10.1073/pnas.15179911 SI Text Protein Expression and Purification. Myb3 (mouse, residues 84 315) was expressed in Escherichia coli as a fusion with the B1 domain of protein
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11085 Supplementary Tables: Supplementary Table 1. Summary of crystallographic and structure refinement data Structure BRIL-NOP receptor Data collection Number of crystals 23 Space group
More informationSupplementary Figure 1 Pairing alignments, turns and extensions within the structure of the ribozyme-product complex. (a) The alignment of the G27
Supplementary Figure 1 Pairing alignments, turns and extensions within the structure of the ribozyme-product complex. (a) The alignment of the G27 A40 non-canonical pair stacked over the A41 (G1-C26) three-base
More informationStructural Mechanism for the Fidelity Modulation of DNA Polymerase λ. 128 Academia Road Sec. 2, Nankang, Taipei, 115, Taiwan
SUPPORTING INFORMATION Structural Mechanism for the Fidelity Modulation of DNA Polymerase λ Mu-Sen Liu, 1,3 Hsin-Yue Tsai, 1,# Xiao-Xia Liu, 1,# Meng-Chiao Ho, 1,3 Wen-Jin Wu, 1,* and Ming-Daw Tsai 1,2,3,*
More informationStructure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps
Cell Reports Supplemental Information Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps Chih-Chia Su, Jani Reddy Bolla, Nitin Kumar, Abhijith Radhakrishnan,
More informationMaterials. The three sulfonated calixarene host molecules, p- molecules, 5,6-dihydropyrazion[1,2,3,4-lmn][1,10]phenanthroline-4,7-diium (DP 2+ ) 4
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 214 Experimental Section Materials. The three sulfonated calixarene host molecules, p- sulfonatocalix[4]arene
More informationCH 3 CH 2 OH +H 2 O CHO. 2e + 2H + + O 2 H 2 O +HCOOH
2 4 H CH 3 2e + 2H + + 2 H 2 2 H CH 2 H 2e + 2H + + 2 H 2 2 H +H 2 CH 2e + 2H + + 2 H 2 2 H +HCH Supplemental Figure S. The three-step 4DM reaction, each step requires two reducing equivalents from ADPH
More information4 Examples of enzymes
Catalysis 1 4 Examples of enzymes Adding water to a substrate: Serine proteases. Carbonic anhydrase. Restrictions Endonuclease. Transfer of a Phosphoryl group from ATP to a nucleotide. Nucleoside monophosphate
More informationIgE binds asymmetrically to its B cell receptor CD23
Supplementary Information IgE binds asymmetrically to its B cell receptor CD23 Balvinder Dhaliwal 1*, Marie O. Y. Pang 2, Anthony H. Keeble 2,3, Louisa K. James 2,4, Hannah J. Gould 2, James M. McDonnell
More informationRational Design of Thermodynamic and Kinetic Binding Profiles by. Optimizing Surface Water Networks Coating Protein Bound Ligands
SUPPORTING INFORMATION Rational Design of Thermodynamic and Kinetic Binding Profiles by Optimizing Surface Water Networks Coating Protein Bound Ligands Stefan G. Krimmer,, Jonathan Cramer,, Michael Betz,
More informationIt s the amino acids!
Catalytic Mechanisms HOW do enzymes do their job? Reducing activation energy sure, but HOW does an enzyme catalysis reduce the energy barrier ΔG? Remember: The rate of a chemical reaction of substrate
More informationCalorimetry: differential scanning calorimetry (DSC), isothermal titration calorimetry (ITC)
Calorimetry: differential scanning calorimetry (DSC), isothermal titration calorimetry (ITC) Dr. Yin Li Department of Biophysics, Medical School University of Pecs Thermal Analysis IUPAC definition - a
More informationActa Crystallographica Section D
Supporting information Acta Crystallographica Section D Volume 70 (2014) Supporting information for article: Structural characterization of the virulence factor Nuclease A from Streptococcus agalactiae
More informationSupporting Information
Supporting Information Structural Basis of the Antiproliferative Activity of Largazole, a Depsipeptide Inhibitor of the Histone Deacetylases Kathryn E. Cole 1, Daniel P. Dowling 1,2, Matthew A. Boone 3,
More informationSupplementary Information. Overlap between folding and functional energy landscapes for. adenylate kinase conformational change
Supplementary Information Overlap between folding and functional energy landscapes for adenylate kinase conformational change by Ulrika Olsson & Magnus Wolf-Watz Contents: 1. Supplementary Note 2. Supplementary
More informationCHEMICAL BONDS. Attraction that holds molecules together Involves valence electrons. Ionic Bonds Covalent Bonds. Involves sharing of.
CHEMICAL BONDS DEFINITION/DESCRIPTION: Attraction that holds molecules together Involves valence electrons TYPES: Ionic Bonds Covalent Bonds Involves sharing of electrons Electronegativities O = 3.5 N
More informationMeasurement of Enzyme Activity - ALP Activity (ALP: Alkaline phosphatase)
Measurement of Enzyme Activity - ALP Activity (ALP: Alkaline phosphatase) Measurement and analysis of enzyme activity is often used in the field of life science such as medicines and foods to investigate
More informationIsothermal Titration Calorimetry in Drug Discovery. Geoff Holdgate Structure & Biophysics, Discovery Sciences, AstraZeneca October 2017
Isothermal Titration Calorimetry in Drug Discovery Geoff Holdgate Structure & Biophysics, Discovery Sciences, AstraZeneca October 217 Introduction Introduction to ITC Strengths / weaknesses & what is required
More informationAnion Binding by Biotin[6]uril in Water
Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2014 Anion Binding by Biotin[6]uril in Water Micke Lisbjerg, Bjarne Enrico Nielsen,
More informationSupplementary Information for
Supplementary Information for Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains Hyoun Sook Kim
More information[Urea] (M) k (s -1 )
BMB178 Fall 2018 Problem Set 1 Due: 10/26/2018, noon Office hour: 10/25/2018, SFL GSR218 7 9 pm Problem 1. Transition state theory (20 points): Consider a unimolecular reaction where a substrate S is converted
More informationSupplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R)
Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R) Shown in cyan and green are two adjacent tetramers from the crystallographic lattice of COP, forming the only unique inter-tetramer
More information