Supplementary information

Size: px
Start display at page:

Download "Supplementary information"

Transcription

1 Supplementary information The structural basis of modularity in ECF-type ABC transporters Guus B. Erkens 1,2, Ronnie P-A. Berntsson 1,2, Faizah Fulyani 1,2, Maria Majsnerowska 1,2, Andreja Vujičić-Žagar 1,2, Josy ter Beek 1,2, Bert Poolman 1,2 and Dirk Jan Slotboom 1,2 1 University of Groningen, Groningen Biomolecular Science and Biotechnology Institute, Nijenborgh 4, 9747 AG Groningen, the Netherlands. 2 University of Groningen, Zernike Institute for Advanced Materials, Nijenborgh 4, 9747 AG Groningen, the Netherlands. Supplementary information comprises: Supplementary Figures 1 8 Supplementary Table 1 Supplementary References 1

2 Supplementary Figure 1. The orientation of ThiT in the membrane. The orientation of ThiT in the membrane was deduced from the distribution of positive charges (positive inside rule 2 ). The positively charged amino acids (Lys, Arg) are colored blue; all other amino acids are depicted in gray. 2

3 Supplementary Figure 2. Sequence alignment of L. lactis ThiT with orthologs from various bacterial species. The position of the transmembrane helices in L. lactis ThiT is indicated above the sequences. Conserved residues not involved in ligand binding (e.g. structurally important residues) are colored green. The amino acids that interact directly with thiamin are highlighted in blue. Residues forming the network of hydrogen bonds and aromatic interactions around the substrate are colored yellow. The mechanistically important L1 loop is indicated by the purple bar. 3

4 Supplementary Figure 3: Schematic representation of the interactions in the high affinity thiamin binding site. Hydrogen bonds are depicted as red dashed lines and aromatic ring-stacking is indicated by blue dashed semi-circles. An ordered water molecule is represented by the black asterisk (*). 4

5 << helix 1 >> ThiT ---MSNSKFNVRLLTEIAFMAALAFIISLIPNTVYG-- 33 RibU MSKTRRMVLIAMLAALSTILLL-PILQFPL- 29 BioY ----MTNNQKVKTLTYSAFMTAFIIILGFLPGIPIGF- 33 PanT -----MKKSKASDVAILAIFIAIMVVVQLFTQFVINV- 32 HmpT --MKLMDNKNIKKLTLLAIWTALTFVLGRLFTFPI QeuT -----MKKSKTYDIVTIAIVAALYVILTMTPGLSAIS- 32 NiaX TQMTQTKKAKVRNLIIAAMLTALGILIPMMMPVKLIIG 38 BioY2 ----MQN-TKLYSLTLIALGAAIIAVLSPLA-IPIGI- 31 : : *: *: :: Supplementary Figure 4. Multiple-sequence alignment of the N-terminal residues containing the first transmembrane helix from all S-components that interact with the same energizing module in L. lactis. The amino acids in the first transmembrane helix of ThiT are shaded with a blue background. Highlighted in red is an alanine motif that is exposed to the predicted EcfT interface in ThiT. We found that the alanine motif is moderately conserved in sequence alignments of all S-components with their orthologs (not shown). 5

6 Supplementary Figure 5. Thiamin binding to WT ThiT and mutants. The assay was performed as described 3 using substrate free ThiT expressed in L. lactis. The dissociation constant values (inset) were determined by fitting the data to the binding equation as described 3. 6

7 Walker A EcfA MNKILEVENLVFKYEKES--DVNQLNGVSFSITKG-EWVSIIGQNGSGKSTTARLIDGLF 57 EcfA' ---MIKFEKVNYTYQPNSPFASRALFDIDLEVKKG-SYTALIGHTGSGKSTLLQHLNGLL 56 MetN ----MIKLSNITKVFHQGTRTIQALNNVSLHVPAG-QIYGVIGASGAGKSTLIRCVNLLE 55 ModC_AF MFLKVRAEKRLGNFRLN----VDFEMGRDYCVLLGPTGAGKSVFLELIAGIV 48 ModC_MA MIEIESLSRKWKNFSLDNLS-LKVESG-EYFVILGPTGAGKTLFLELIAGFH 50 MalK MASVQLQNVTKAWGEVVVSKDINLDIHEG-EFVVFVGPSGCGKSTLLRMIAGLE 53 BtuD MSIVMQLQDVAESTRLGPLSGEVRAG-EILHLVGPNGAGKSTLLARMAGMT 50.. *..:*.*.**: : : Q-loop EcfA EEFEGIVKIDGERLTAEN----VWNLRRKIGMVFQNPDNQFVGATVEDDVAFGMENQGIP 113 EcfA' QPTEGKVTVGDIVVSSTSKQKEIKPVRKKVGVVFQFPESQLFEETVLKDVAFGPQNFGIP 116 MetN RPTEGSVLVDGQELTTLS-ESELTKARRQIGMIFQHFNLL-SSRTVFGNVALPLELDNTP 113 ModC_AF KPDRGEVRLNGADITPLP------PERRGIGFVPQDYALF-PHLSVYRNIAYGLRNVERV 101 ModC_MA VPDSGRILLDGKDVTDLS------PEKHDIAFVYQNYSLF-PHMNVKKNLEFGMR-MKKI 102 MalK TITSGDLFIGEKRMNDTP------PAERGVGMVFQSYALY-PHLSVAENMSFGLKLAGAK 106 BtuD S-GKGSIQFAGQPLEAWS---ATKLALH-RAYLSQQQ------TPPFATPVWHYLTLHQH 99 * :. : : : * Signature motif Walker B EcfA REEMIKRVDEALLAVNMLD-FKTREPARLSGGQKQRVAVAGIIALRP EIIILD 165 EcfA' KEKAEKIAAEKLEMVGLADEFWEKSPFELSGGQMRRVAIAGILAMEP EVLVLD 169 MetN KDEVKRRVTELLSLVGLGD-KHDSYPSNLSGGQKQRVAIARALASNP KVLLCD 165 ModC_AF ERDR--RVREMAEKLGIAH-LLDRKPARLSGGERQRVALARALVIQP RLLLLD 151 ModC_MA KDPK--RVLDTARDLKIEH-LLDRNPLTLSGGEQQRVALARALVTNP KILLLD 152 MalK KEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEP SVFLLD 158 BtuD DKTRTELLNDVAGALALDD-KLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLLD 158 : : :.. ****: :** :. :. ::: * H-loop EcfA ESTSMLDPTGRSEIMRVIHEIKDKYHLTVLSITHDLDEAASSDRILVMRAGEIIKEAAP 224 EcfA' EPTAGLDPKARIEMMQLFESIHQS-GQTVVLVTHLMDDVADYADYVYLLEKGHIISCGTP 228 MetN EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225 ModC_AF EPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLADEVAVMLNGRIVEKGKL 211 ModC_MA EPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARIMADRIAVVMDGKLIQVGKP 212 MalK QPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 218 BtuD EPMNSLDVAQQSALDKILSALCQQ-GLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRR 217 :. :* : : :: :*.. :: *.: EcfA SELFATSEDMVEIGLDVP FSSNLMKDLRTNG EcfA' SDVFQEVDFLKAHELGVP KATHFADQLQKTG MetN SEVFSHPKTPLAQKFIQS----TLHLDIPEDYQERLQAEP ModC_AF KELFS-AKNGEVAEFL SARNLLLKVSK---ILD ModC_MA EEIFEKPVEGRVASFVGFENVLKGRVISAEQGLLRIRVGEVVIDAAGDMEVG---DQVYA 269 MalK LELYHYPADRFVAGFIG SPKMNFLPVKVTATAIDQVQVELPMPNRQQVWL 268 BtuD EEVLTPPNLAQAYGMN FRRLDIEG :: : : Supplementary Figure 6. Sequence alignment of NBDs from ABC transporters with available structures and EcfA and A from L. lactis. The conserved ABC transporter motifs are: Walker A (P-loop) (orange), conserved glutamine of the Q-loop (blue), the ABC transporter signature motif (red), Walker B motif (yellow) and the H-loop (green). We have used two orthologs of ModC for this alignment: ModC from Archaeoglobus fulgidus (ModC_AF) and from Methanosarcina acetivorans (ModC_MA). The residues that line 7

8 the coupling helix binding groove are colored purple. These residues are remarkably conserved between EcfA and EcfA, and MetN, ModC, MalK and (to lesser extent) BtuD, from which structures were used to locate the groove, strongly suggesting that both EcfA and EcfA interact with a coupling helix, presumably present in the long cytoplasmic loop of EcfT as discussed in the main text. 8

9 Supplementary Figure 7. Predicted membrane topology of EcfT from L. lactis (gi: ). The cytoplasmic domain between helices 4 and 5 contains two moderately hydrophobic segments that could form coupling helices. The length of this domain could comfortably accommodate two coupling helices. The lipid membrane is indicated by the black dashed line. 9

10 a b Supplementary Figure 8. The ThiT molecules in the asymmetric unit. (a) Both chains of ThiT are shown in ribbon representation and colored in a rainbow fashion, from the N-terminus blue to the C-terminus in red. Peaks for the Se atoms in the anomalous difference Fourier map, calculated between 48.0 and 2.9 Å and contoured at 5σ, are shown in a grey mesh. A total of four SeMet were visible in the map. SeMet at position 1 and 9 in the protein construct were in a disordered region of the protein. Peak heights are as follows: Mse68: 34.9σ and 28.0σ (in chain A and B, respectively), Mse17: 26.7σ and 26.3σ (in chain A and B, respectively). No noise peaks were present at a 5σ cut-off. (b) Experimental electron density, the density is show as a gray mesh 10

11 (2F o - F c map contoured at 1.5σ). The ThiT main chain is depicted as a ribbon representation and colored as in Fig

12 Supplementary Table 1. The intricate network of hydrogen bonds and aromatic interactions between binding site residues. The following types of interactions were found: Hydrogen Bond (HB), Salt Bridge (SB), Aromatic L-shaped conformation 1 (A L ), Aromatic T-shaped conformation 1 (A T ). Residue Interactions with Trp-34 Tyr-74 (A L ) Glu-38 Tyr-122 (HB), Lys-121 (SB) Tyr-74 Trp-34 (A L ), Tyr-85 (HB, to OH-group C-α) Leu-76 Gln-80 (HB) Gln-80 Glu-84 (HB), Leu-76 (HB, to backbone N) Glu-84 Trp-133 (HB), His-125(HB), Gln-80(HB) Tyr-85 Tyr-74 (HB) Lys-121 His-125 (HB), Glu-38 (SB) Tyr-122 Glu-38 (HB) His-125 Lys-121 (HB), Glu-84 (HB) Trp-133 Glu-84 (HB) Trp-138 Tyr-146 (A T ) Trp-141 Tyr-146 (A T ) Tyr-146 Trp-138 (A T ), Trp-141 (A T ) Ser-147 Asn-151 (HB) Asn-151 Ser-147 (HB) 12

13 Supplementary References 1. Burley, S.K. & Petsko, G.A. Aromatic-aromatic interaction: a mechanism of protein structure stabilization. Science 229, (1985). 2. Von Heijne, G. Control of topology and mode of assembly of a polytopic membrane protein by positively charged residues. Nature 341, (1989). 3. Erkens, G.B. & Slotboom, D.J. Biochemical characterization of ThiT from Lactococcus lactis: a thiamin transporter with picomolar substrate binding affinity. Biochemistry 49, (2010). 13

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature12045 Supplementary Table 1 Data collection and refinement statistics. Native Pt-SAD X-ray source SSRF BL17U SPring-8 BL41XU Wavelength (Å) 0.97947 1.07171 Space group P2 1 2 1 2 1 P2

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11524 Supplementary discussion Functional analysis of the sugar porter family (SP) signature motifs. As seen in Fig. 5c, single point mutation of the conserved

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Data collection Supplementary Table 1 Statistics of data collection, phasing and refinement Native Se-MAD Space group P2 1 2 1 2 1 P2 1 2 1 2 1 Cell dimensions a, b, c (Å) 50.4, 94.2, 115.4 49.8, 94.2,

More information

Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27

Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27 Acta Cryst. (2014). D70, doi:10.1107/s1399004714021695 Supporting information Volume 70 (2014) Supporting information for article: Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase

More information

Supplementary Figure 3 a. Structural comparison between the two determined structures for the IL 23:MA12 complex. The overall RMSD between the two

Supplementary Figure 3 a. Structural comparison between the two determined structures for the IL 23:MA12 complex. The overall RMSD between the two Supplementary Figure 1. Biopanningg and clone enrichment of Alphabody binders against human IL 23. Positive clones in i phage ELISA with optical density (OD) 3 times higher than background are shown for

More information

Nitrogenase MoFe protein from Clostridium pasteurianum at 1.08 Å resolution: comparison with the Azotobacter vinelandii MoFe protein

Nitrogenase MoFe protein from Clostridium pasteurianum at 1.08 Å resolution: comparison with the Azotobacter vinelandii MoFe protein Acta Cryst. (2015). D71, 274-282, doi:10.1107/s1399004714025243 Supporting information Volume 71 (2015) Supporting information for article: Nitrogenase MoFe protein from Clostridium pasteurianum at 1.08

More information

Transmembrane Domains (TMDs) of ABC transporters

Transmembrane Domains (TMDs) of ABC transporters Transmembrane Domains (TMDs) of ABC transporters Most ABC transporters contain heterodimeric TMDs (e.g. HisMQ, MalFG) TMDs show only limited sequence homology (high diversity) High degree of conservation

More information

NB-DNJ/GCase-pH 7.4 NB-DNJ+/GCase-pH 7.4 NB-DNJ+/GCase-pH 4.5

NB-DNJ/GCase-pH 7.4 NB-DNJ+/GCase-pH 7.4 NB-DNJ+/GCase-pH 4.5 SUPPLEMENTARY TABLES Suppl. Table 1. Protonation states at ph 7.4 and 4.5. Protonation states of titratable residues in GCase at ph 7.4 and 4.5. Histidine: HID, H at δ-nitrogen; HIE, H at ε-nitrogen; HIP,

More information

Supplementary figure 1. Comparison of unbound ogm-csf and ogm-csf as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine

Supplementary figure 1. Comparison of unbound ogm-csf and ogm-csf as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine Supplementary figure 1. Comparison of unbound and as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine GM-CSF (slate) with bound GM-CSF in the GIF:GM-CSF complex (GIF: green,

More information

Viewing and Analyzing Proteins, Ligands and their Complexes 2

Viewing and Analyzing Proteins, Ligands and their Complexes 2 2 Viewing and Analyzing Proteins, Ligands and their Complexes 2 Overview Viewing the accessible surface Analyzing the properties of proteins containing thousands of atoms is best accomplished by representing

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Results DNA binding property of the SRA domain was examined by an electrophoresis mobility shift assay (EMSA) using synthesized 12-bp oligonucleotide duplexes containing unmodified, hemi-methylated,

More information

Secondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure

Secondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted

More information

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2 Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell

More information

SUPPLEMENTARY INFORMATION. doi: /nature07461

SUPPLEMENTARY INFORMATION. doi: /nature07461 Figure S1 Electrophysiology. a ph-activation of. Two-electrode voltage clamp recordings of Xenopus oocytes expressing in comparison to waterinjected oocytes. Currents were recorded at 40 mv. The ph of

More information

What makes a good graphene-binding peptide? Adsorption of amino acids and peptides at aqueous graphene interfaces: Electronic Supplementary

What makes a good graphene-binding peptide? Adsorption of amino acids and peptides at aqueous graphene interfaces: Electronic Supplementary Electronic Supplementary Material (ESI) for Journal of Materials Chemistry B. This journal is The Royal Society of Chemistry 21 What makes a good graphene-binding peptide? Adsorption of amino acids and

More information

Peptides And Proteins

Peptides And Proteins Kevin Burgess, May 3, 2017 1 Peptides And Proteins from chapter(s) in the recommended text A. Introduction B. omenclature And Conventions by amide bonds. on the left, right. 2 -terminal C-terminal triglycine

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Table 1: Data collection, phasing and refinement statistics ChbC/Ta 6 Br 12 Native ChbC Data collection Space group P4 3 2 1 2 P4 3 2 1 2 Cell dimensions a, c (Å) 132.75, 453.57 132.81, 452.95

More information

Packing of Secondary Structures

Packing of Secondary Structures 7.88 Lecture Notes - 4 7.24/7.88J/5.48J The Protein Folding and Human Disease Professor Gossard Retrieving, Viewing Protein Structures from the Protein Data Base Helix helix packing Packing of Secondary

More information

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1 Supplementary Figure 1 Crystallization. a, Crystallization constructs of the ET B receptor are shown, with all of the modifications to the human wild-type the ET B receptor indicated. Residues interacting

More information

Supplementary Figure 1. Biochemical and sequence alignment analyses the

Supplementary Figure 1. Biochemical and sequence alignment analyses the Supplementary Figure 1. Biochemical and sequence alignment analyses the interaction of OPTN and TBK1. (a) Analytical gel filtration chromatography analysis of the interaction between TBK1 CTD and OPTN(1-119).

More information

Structure and mechanism of the ECF-type ABC transporter for thiamin Erkens, Guus Bjorn

Structure and mechanism of the ECF-type ABC transporter for thiamin Erkens, Guus Bjorn University of Groningen Structure and mechanism of the ECF-type ABC transporter for thiamin Erkens, Guus Bjorn IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's PDF) if you

More information

Physiochemical Properties of Residues

Physiochemical Properties of Residues Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)

More information

Supporting Information

Supporting Information Supporting Information Ottmann et al. 10.1073/pnas.0907587106 Fig. S1. Primary structure alignment of SBT3 with C5 peptidase from Streptococcus pyogenes. The Matchmaker tool in UCSF Chimera (http:// www.cgl.ucsf.edu/chimera)

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11085 Supplementary Tables: Supplementary Table 1. Summary of crystallographic and structure refinement data Structure BRIL-NOP receptor Data collection Number of crystals 23 Space group

More information

FW 1 CDR 1 FW 2 CDR 2

FW 1 CDR 1 FW 2 CDR 2 Supplementary Figure 1 Supplementary Figure 1: Interface of the E9:Fas structure. The two interfaces formed by V H and V L of E9 with Fas are shown in stereo. The Fas receptor is represented as a surface

More information

Supplementary Figure S1. Urea-mediated buffering mechanism of H. pylori. Gastric urea is funneled to a cytoplasmic urease that is presumably attached

Supplementary Figure S1. Urea-mediated buffering mechanism of H. pylori. Gastric urea is funneled to a cytoplasmic urease that is presumably attached Supplementary Figure S1. Urea-mediated buffering mechanism of H. pylori. Gastric urea is funneled to a cytoplasmic urease that is presumably attached to HpUreI. Urea hydrolysis products 2NH 3 and 1CO 2

More information

Supporting information to: Time-resolved observation of protein allosteric communication. Sebastian Buchenberg, Florian Sittel and Gerhard Stock 1

Supporting information to: Time-resolved observation of protein allosteric communication. Sebastian Buchenberg, Florian Sittel and Gerhard Stock 1 Supporting information to: Time-resolved observation of protein allosteric communication Sebastian Buchenberg, Florian Sittel and Gerhard Stock Biomolecular Dynamics, Institute of Physics, Albert Ludwigs

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/5/243/ra68/dc1 Supplementary Materials for Superbinder SH2 Domains Act as Antagonists of Cell Signaling Tomonori Kaneko, Haiming Huang, Xuan Cao, Xing Li, Chengjun

More information

Exam I Answer Key: Summer 2006, Semester C

Exam I Answer Key: Summer 2006, Semester C 1. Which of the following tripeptides would migrate most rapidly towards the negative electrode if electrophoresis is carried out at ph 3.0? a. gly-gly-gly b. glu-glu-asp c. lys-glu-lys d. val-asn-lys

More information

Model Mélange. Physical Models of Peptides and Proteins

Model Mélange. Physical Models of Peptides and Proteins Model Mélange Physical Models of Peptides and Proteins In the Model Mélange activity, you will visit four different stations each featuring a variety of different physical models of peptides or proteins.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Table 1: Amplitudes of three current levels. Level 0 (pa) Level 1 (pa) Level 2 (pa) TrkA- TrkH WT 200 K 0.01 ± 0.01 9.5 ± 0.01 18.7 ± 0.03 200 Na * 0.001 ± 0.01 3.9 ± 0.01 12.5 ± 0.03 200

More information

Major Types of Association of Proteins with Cell Membranes. From Alberts et al

Major Types of Association of Proteins with Cell Membranes. From Alberts et al Major Types of Association of Proteins with Cell Membranes From Alberts et al Proteins Are Polymers of Amino Acids Peptide Bond Formation Amino Acid central carbon atom to which are attached amino group

More information

Supporting Information

Supporting Information Supporting Information Micelle-Triggered b-hairpin to a-helix Transition in a 14-Residue Peptide from a Choline-Binding Repeat of the Pneumococcal Autolysin LytA HØctor Zamora-Carreras, [a] Beatriz Maestro,

More information

Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R)

Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R) Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R) Shown in cyan and green are two adjacent tetramers from the crystallographic lattice of COP, forming the only unique inter-tetramer

More information

Bahnson Biochemistry Cume, April 8, 2006 The Structural Biology of Signal Transduction

Bahnson Biochemistry Cume, April 8, 2006 The Structural Biology of Signal Transduction Name page 1 of 6 Bahnson Biochemistry Cume, April 8, 2006 The Structural Biology of Signal Transduction Part I. The ion Ca 2+ can function as a 2 nd messenger. Pick a specific signal transduction pathway

More information

Bacterial protease uses distinct thermodynamic signatures for substrate recognition

Bacterial protease uses distinct thermodynamic signatures for substrate recognition Bacterial protease uses distinct thermodynamic signatures for substrate recognition Gustavo Arruda Bezerra, Yuko Ohara-Nemoto, Irina Cornaciu, Sofiya Fedosyuk, Guillaume Hoffmann, Adam Round, José A. Márquez,

More information

Membrane proteins Porins: FadL. Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella

Membrane proteins Porins: FadL. Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella Membrane proteins Porins: FadL Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella INDEX 1. INTRODUCTION TO MEMBRANE PROTEINS 2. FADL: OUTER MEMBRANE TRANSPORT PROTEIN 3. MAIN FEATURES OF FADL STRUCTURE

More information

Supplementary Information

Supplementary Information Supplementary Information Resveratrol Serves as a Protein-Substrate Interaction Stabilizer in Human SIRT1 Activation Xuben Hou,, David Rooklin, Hao Fang *,,, Yingkai Zhang Department of Medicinal Chemistry

More information

Supplement information

Supplement information Electronic Supplementary Material (ESI) for Physil Chemistry Chemil Physics. This journal is the Owner Societies 216 Supplement information Fullerenol C 6 (OH) 16 prevents amyloid fibrillization of Aβ

More information

Gene regulation II Biochemistry 302. February 27, 2006

Gene regulation II Biochemistry 302. February 27, 2006 Gene regulation II Biochemistry 302 February 27, 2006 Molecular basis of inhibition of RNAP by Lac repressor 35 promoter site 10 promoter site CRP/DNA complex 60 Lewis, M. et al. (1996) Science 271:1247

More information

Any protein that can be labelled by both procedures must be a transmembrane protein.

Any protein that can be labelled by both procedures must be a transmembrane protein. 1. What kind of experimental evidence would indicate that a protein crosses from one side of the membrane to the other? Regions of polypeptide part exposed on the outside of the membrane can be probed

More information

Bioinformatics Practical for Biochemists

Bioinformatics Practical for Biochemists Bioinformatics Practical for Biochemists Andrei Lupas, Birte Höcker, Steffen Schmidt WS 2013/14 03. Sequence Features Targeting proteins signal peptide targets proteins to the secretory pathway N-terminal

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Fig. 1 Influences of crystal lattice contacts on Pol η structures. a. The dominant lattice contact between two hpol η molecules (silver and gold) in the type 1 crystals. b. A close-up view of the hydrophobic

More information

Potassium channel gating and structure!

Potassium channel gating and structure! Reading: Potassium channel gating and structure Hille (3rd ed.) chapts 10, 13, 17 Doyle et al. The Structure of the Potassium Channel: Molecular Basis of K1 Conduction and Selectivity. Science 280:70-77

More information

Protein Structure Bioinformatics Introduction

Protein Structure Bioinformatics Introduction 1 Swiss Institute of Bioinformatics Protein Structure Bioinformatics Introduction Basel, 27. September 2004 Torsten Schwede Biozentrum - Universität Basel Swiss Institute of Bioinformatics Klingelbergstr

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11054 Supplementary Fig. 1 Sequence alignment of Na v Rh with NaChBac, Na v Ab, and eukaryotic Na v and Ca v homologs. Secondary structural elements of Na v Rh are indicated above the

More information

Review. Membrane proteins. Membrane transport

Review. Membrane proteins. Membrane transport Quiz 1 For problem set 11 Q1, you need the equation for the average lateral distance transversed (s) of a molecule in the membrane with respect to the diffusion constant (D) and time (t). s = (4 D t) 1/2

More information

Structural and mechanistic insights into ABC-type ECF transporters for vitamin uptake Majsnerowska, Maria

Structural and mechanistic insights into ABC-type ECF transporters for vitamin uptake Majsnerowska, Maria University of Groningen Structural and mechanistic insights into ABC-type ECF transporters for vitamin uptake Majsnerowska, Maria IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's

More information

Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits. AhpC and AhpF from Escherichia coli

Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits. AhpC and AhpF from Escherichia coli Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits AhpC and AhpF from Escherichia coli Phat Vinh Dip 1,#, Neelagandan Kamariah 2,#, Malathy Sony Subramanian Manimekalai

More information

Detailed description of overall and active site architecture of PPDC- 3dThDP, PPDC-2HE3dThDP, PPDC-3dThDP-PPA and PPDC- 3dThDP-POVA

Detailed description of overall and active site architecture of PPDC- 3dThDP, PPDC-2HE3dThDP, PPDC-3dThDP-PPA and PPDC- 3dThDP-POVA Online Supplemental Results Detailed description of overall and active site architecture of PPDC- 3dThDP, PPDC-2HE3dThDP, PPDC-3dThDP-PPA and PPDC- 3dThDP-POVA Structure solution and overall architecture

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10955 Supplementary Figures Supplementary Figure 1. Electron-density maps and crystallographic dimer structures of the motor domain. (a f) Stereo views of the final electron-density maps

More information

Homology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6

Homology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6 Homology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6 Hsuan-Liang Liu* and Chin-Wen Chen Department of Chemical Engineering and Graduate Institute

More information

Supplementary Information

Supplementary Information 1 Supplementary Information Figure S1 The V=0.5 Harker section of an anomalous difference Patterson map calculated using diffraction data from the NNQQNY crystal at 1.3 Å resolution. The position of the

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:1.138/nature1737 Supplementary Table 1 variant Description FSEC - 2B12 a FSEC - 6A1 a K d (leucine) c Leucine uptake e K (wild-type like) K (Y18F) K (TS) K (TSY) K288A mutant, lipid facing side chain

More information

It s really this simple.

It s really this simple. Background Light harvesting complexes exist to facilitate and maximize the absorption capacity of the reaction centers (RC) as well as PSI and PSII Purple bacteria utilize these functions by having an

More information

BIRKBECK COLLEGE (University of London)

BIRKBECK COLLEGE (University of London) BIRKBECK COLLEGE (University of London) SCHOOL OF BIOLOGICAL SCIENCES M.Sc. EXAMINATION FOR INTERNAL STUDENTS ON: Postgraduate Certificate in Principles of Protein Structure MSc Structural Molecular Biology

More information

Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013

Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013 Hydration of protein-rna recognition sites Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India 1 st November, 2013 Central Dogma of life DNA

More information

Cks1 CDK1 CDK1 CDK1 CKS1. are ice- lobe. conserved. conserved

Cks1 CDK1 CDK1 CDK1 CKS1. are ice- lobe. conserved. conserved Cks1 d CKS1 Supplementary Figure 1 The -Cks1 crystal lattice. (a) Schematic of the - Cks1 crystal lattice. -Cks1 crystallizes in a lattice that contains c 4 copies of the t - Cks1 dimer in the crystallographic

More information

The Structure and Functions of Proteins

The Structure and Functions of Proteins Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science and Engineering 2003 The Structure and Functions of Proteins Dan E. Krane Wright State University

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION www.nature.com/nature 1 Figure S1 Sequence alignment. a Structure based alignment of the plgic of E. chrysanthemi (ELIC), the acetylcholine binding protein from the snail Lymnea stagnalis (AchBP, PDB code

More information

Supplementary figure 1 Application of tmfret in LeuT. (a) To assess the feasibility of using tmfret for distance-dependent measurements in LeuT, a

Supplementary figure 1 Application of tmfret in LeuT. (a) To assess the feasibility of using tmfret for distance-dependent measurements in LeuT, a Supplementary figure 1 Application of tmfret in LeuT. (a) To assess the feasibility of using tmfret for distance-dependent measurements in LeuT, a series of tmfret-pairs comprised of single cysteine mutants

More information

Supplementary Figure 1. Aligned sequences of yeast IDH1 (top) and IDH2 (bottom) with isocitrate

Supplementary Figure 1. Aligned sequences of yeast IDH1 (top) and IDH2 (bottom) with isocitrate SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1. Aligned sequences of yeast IDH1 (top) and IDH2 (bottom) with isocitrate dehydrogenase from Escherichia coli [ICD, pdb 1PB1, Mesecar, A. D., and Koshland,

More information

Impact of the crystallization condition on importin-β conformation

Impact of the crystallization condition on importin-β conformation Supporting information Volume 72 (2016) Supporting information for article: Impact of the crystallization condition on importin-β conformation Marcel J. Tauchert, Clément Hémonnot, Piotr Neumann, Sarah

More information

Three-dimensional structure of a viral genome-delivery portal vertex

Three-dimensional structure of a viral genome-delivery portal vertex Three-dimensional structure of a viral genome-delivery portal vertex Adam S. Olia 1, Peter E. Prevelige Jr. 2, John E. Johnson 3 and Gino Cingolani 4 1 Department of Biological Sciences, Purdue University,

More information

Nature Structural & Molecular Biology: doi: /nsmb.3343

Nature Structural & Molecular Biology: doi: /nsmb.3343 Supplementary Figure 1 Sequence alignment for PC2 and related orthologs. The sequence of human PC2 P185-D723 (hspc2; TRPP1) is shown along with the corresponding PC2 sequences from C. elegans (ce) and

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary materials Figure S1 Fusion protein of Sulfolobus solfataricus SRP54 and a signal peptide. a, Expression vector for the fusion protein. The signal peptide of yeast dipeptidyl aminopeptidase

More information

Electro-Mechanical Conductance Modulation of a Nanopore Using a Removable Gate

Electro-Mechanical Conductance Modulation of a Nanopore Using a Removable Gate Electro-Mechanical Conductance Modulation of a Nanopore Using a Removable Gate Shidi Zhao a, Laura Restrepo-Pérez b, Misha Soskine c, Giovanni Maglia c, Chirlmin Joo b, Cees Dekker b and Aleksei Aksimentiev

More information

Problem Set 1

Problem Set 1 2006 7.012 Problem Set 1 Due before 5 PM on FRIDAY, September 15, 2006. Turn answers in to the box outside of 68-120. PLEASE WRITE YOUR ANSWERS ON THIS PRINTOUT. 1. For each of the following parts, pick

More information

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1 Supplementary Figure 1 Chemical structure of LPS and LPS biogenesis in Gram-negative bacteria. a. Chemical structure of LPS. LPS molecule consists of Lipid A, core oligosaccharide and O-antigen. The polar

More information

Biophysics 490M Project

Biophysics 490M Project Biophysics 490M Project Dan Han Department of Biochemistry Structure Exploration of aa 3 -type Cytochrome c Oxidase from Rhodobacter sphaeroides I. Introduction: All organisms need energy to live. They

More information

Supplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization

Supplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization Supplementary Information Structural basis for precursor protein-directed ribosomal peptide macrocyclization Kunhua Li 1,3, Heather L. Condurso 1,3, Gengnan Li 1, Yousong Ding 2 and Steven D. Bruner 1*

More information

Comparison between Bacteriorhodopsin and Halorhodopsin. Halorhodopsin (HR) and Bacteriorhodopsin (BR) belong to a subfamily of

Comparison between Bacteriorhodopsin and Halorhodopsin. Halorhodopsin (HR) and Bacteriorhodopsin (BR) belong to a subfamily of Comparison between Bacteriorhodopsin and Halorhodopsin Halorhodopsin (HR) and Bacteriorhodopsin (BR) belong to a subfamily of heptahelical membrane proteins, the archaeal rhodopsins. They are found in

More information

Introduction to Comparative Protein Modeling. Chapter 4 Part I

Introduction to Comparative Protein Modeling. Chapter 4 Part I Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature

More information

Final Chem 4511/6501 Spring 2011 May 5, 2011 b Name

Final Chem 4511/6501 Spring 2011 May 5, 2011 b Name Key 1) [10 points] In RNA, G commonly forms a wobble pair with U. a) Draw a G-U wobble base pair, include riboses and 5 phosphates. b) Label the major groove and the minor groove. c) Label the atoms of

More information

Properties of amino acids in proteins

Properties of amino acids in proteins Properties of amino acids in proteins one of the primary roles of DNA (but not the only one!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids repeated

More information

Lecture 10 (10/4/17) Lecture 10 (10/4/17)

Lecture 10 (10/4/17) Lecture 10 (10/4/17) Lecture 10 (10/4/17) Reading: Ch4; 125, 138-141, 141-142 Problems: Ch4 (text); 7, 9, 11 Ch4 (study guide); 1, 2 NEXT Reading: Ch4; 125, 132-136 (structure determination) Ch4; 12-130 (Collagen) Problems:

More information

Substrate and Cation Binding Mechanism of Glutamate Transporter Homologs Jensen, Sonja

Substrate and Cation Binding Mechanism of Glutamate Transporter Homologs Jensen, Sonja University of Groningen Substrate and Cation Binding Mechanism of Glutamate Transporter Homologs Jensen, Sonja IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's PDF) if you

More information

Advanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions

Advanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start

More information

Structural insights into Aspergillus fumigatus lectin specificity - AFL binding sites are functionally non-equivalent

Structural insights into Aspergillus fumigatus lectin specificity - AFL binding sites are functionally non-equivalent Acta Cryst. (2015). D71, doi:10.1107/s1399004714026595 Supporting information Volume 71 (2015) Supporting information for article: Structural insights into Aspergillus fumigatus lectin specificity - AFL

More information

SUPPLEMENTARY FIGURES. Figure S1

SUPPLEMENTARY FIGURES. Figure S1 SUPPLEMENTARY FIGURES Figure S1 The substrate for DH domain (2R,3R,4R,6R,7S,8S,9R)-3,7,9-trihydroxy-5-oxo-2,4,6,8 tetramethylundecanoate) was docked as two separate fragments shown in magenta and blue

More information

Membrane Proteins: 1. Integral proteins: 2. Peripheral proteins: 3. Amphitropic proteins:

Membrane Proteins: 1. Integral proteins: 2. Peripheral proteins: 3. Amphitropic proteins: Membrane Proteins: 1. Integral proteins: proteins that insert into/span the membrane bilayer; or covalently linked to membrane lipids. (Interact with the hydrophobic part of the membrane) 2. Peripheral

More information

Supplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation

Supplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation Supplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation Javier L. Baylon, Ivan L. Lenov, Stephen G. Sligar and Emad Tajkhorshid

More information

Using Higher Calculus to Study Biologically Important Molecules Julie C. Mitchell

Using Higher Calculus to Study Biologically Important Molecules Julie C. Mitchell Using Higher Calculus to Study Biologically Important Molecules Julie C. Mitchell Mathematics and Biochemistry University of Wisconsin - Madison 0 There Are Many Kinds Of Proteins The word protein comes

More information

Central Dogma. modifications genome transcriptome proteome

Central Dogma. modifications genome transcriptome proteome entral Dogma DA ma protein post-translational modifications genome transcriptome proteome 83 ierarchy of Protein Structure 20 Amino Acids There are 20 n possible sequences for a protein of n residues!

More information

Biomolecules: lecture 10

Biomolecules: lecture 10 Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Figure S1. Secondary structure of CAP (in the camp 2 -bound state) 10. α-helices are shown as cylinders and β- strands as arrows. Labeling of secondary structure is indicated. CDB, DBD and the hinge are

More information

Tracking Protein Allostery in Evolution

Tracking Protein Allostery in Evolution Tracking Protein Allostery in Evolution Glycogen phosphorylase frees sugars to provide energy GP orthologs diverged 600,000,000 years can respond to transcription controls, metabolite concentrations and

More information

Journal of Pharmacology and Experimental Therapy-JPET#172536

Journal of Pharmacology and Experimental Therapy-JPET#172536 A NEW NON-PEPTIDIC INHIBITOR OF THE 14-3-3 DOCKING SITE INDUCES APOPTOTIC CELL DEATH IN CHRONIC MYELOID LEUKEMIA SENSITIVE OR RESISTANT TO IMATINIB Manuela Mancini, Valentina Corradi, Sara Petta, Enza

More information

Protein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods

Protein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods Cell communication channel Bioinformatics Methods Iosif Vaisman Email: ivaisman@gmu.edu SEQUENCE STRUCTURE DNA Sequence Protein Sequence Protein Structure Protein structure ATGAAATTTGGAAACTTCCTTCTCACTTATCAGCCACCT...

More information

What binds to Hb in addition to O 2?

What binds to Hb in addition to O 2? Reading: Ch5; 158-169, 162-166, 169-174 Problems: Ch5 (text); 3,7,8,10 Ch5 (study guide-facts); 1,2,3,4,5,8 Ch5 (study guide-apply); 2,3 Remember Today at 5:30 in CAS-522 is the second chance for the MB

More information

Protein Structure. Role of (bio)informatics in drug discovery. Bioinformatics

Protein Structure. Role of (bio)informatics in drug discovery. Bioinformatics Bioinformatics Protein Structure Principles & Architecture Marjolein Thunnissen Dep. of Biochemistry & Structural Biology Lund University September 2011 Homology, pattern and 3D structure searches need

More information

RNA Polymerase I Contains a TFIIF-Related DNA-Binding Subcomplex

RNA Polymerase I Contains a TFIIF-Related DNA-Binding Subcomplex Molecular Cell, Volume 39 Supplemental Information RNA Polymerase I Contains a TFIIFRelated DNABinding Subcomplex Sebastian R. Geiger, Kristina Lorenzen, Amelie Schreieck, Patrizia Hanecker, Dirk Kostrewa,

More information

Supporting Information for: Mechanism of Reversible Peptide-Bilayer. Attachment: Combined Simulation and Experimental Single-Molecule Study

Supporting Information for: Mechanism of Reversible Peptide-Bilayer. Attachment: Combined Simulation and Experimental Single-Molecule Study Supporting Information for: Mechanism of Reversible Peptide-Bilayer Attachment: Combined Simulation and Experimental Single-Molecule Study Nadine Schwierz a,, Stefanie Krysiak c, Thorsten Hugel c,d, Martin

More information

Structural characterization of NiV N 0 P in solution and in crystal.

Structural characterization of NiV N 0 P in solution and in crystal. Supplementary Figure 1 Structural characterization of NiV N 0 P in solution and in crystal. (a) SAXS analysis of the N 32-383 0 -P 50 complex. The Guinier plot for complex concentrations of 0.55, 1.1,

More information

Supplementary Figure 1 Crystal packing of ClR and electron density maps. Crystal packing of type A crystal (a) and type B crystal (b).

Supplementary Figure 1 Crystal packing of ClR and electron density maps. Crystal packing of type A crystal (a) and type B crystal (b). Supplementary Figure 1 Crystal packing of ClR and electron density maps. Crystal packing of type A crystal (a) and type B crystal (b). Crystal contacts at B-C loop are magnified and stereo view of A-weighted

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11744 Supplementary Table 1. Crystallographic data collection and refinement statistics. Wild-type Se-Met-BcsA-B SmCl 3 -soaked EMTS-soaked Data collection Space

More information

LS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor

LS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor LS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor Note: Adequate space is given for each answer. Questions that require a brief explanation should

More information

7.012 Problem Set 1. i) What are two main differences between prokaryotic cells and eukaryotic cells?

7.012 Problem Set 1. i) What are two main differences between prokaryotic cells and eukaryotic cells? ame 7.01 Problem Set 1 Section Question 1 a) What are the four major types of biological molecules discussed in lecture? Give one important function of each type of biological molecule in the cell? b)

More information

Amino Acids and Proteins at ZnO-water Interfaces in Molecular Dynamics Simulations: Electronic Supplementary Information

Amino Acids and Proteins at ZnO-water Interfaces in Molecular Dynamics Simulations: Electronic Supplementary Information Amino Acids and Proteins at ZnO-water Interfaces in Molecular Dynamics Simulations: Electronic Supplementary Information Grzegorz Nawrocki and Marek Cieplak Institute of Physics, Polish Academy of Sciences,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION In the format provided by the authors and unedited. SUPPLEMENTARY INFORMATION DOI: 10.1038/NCHEM.2720 1 2 3 Tuning underwater adhesion with cation-π interactions Matthew A. Gebbie, Wei Wei, Alex M. Schrader,

More information