Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
|
|
- Brittney Merritt
- 3 years ago
- Views:
Transcription
1 Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
2 Outline Basic Concepts Tree Construction Methods Distance-based methods Character-based methods Bootstrap Analysis
3 What is Phylogenetics The term phylogenetics derives from Greek phyle (φυλή) : tribe and race ; genetikos (γενετικός): relative to birth "Phylogenetics" is the study or estimation of the evolutionary history that underlies that biological diversity. This organization is visually described through "trees".
4 Molecular phylogenetics Molecular phylogenetics: the study of evolutionary relationships among organisms or genes by using molecular data (e.g., DNA or protein sequences) and statistical techniques. Molecular systematics, if the relationships of organisms are the concern.
5 Why Study Molecular Phylogenetics? Provides insights into relationships among organisms - through "species" trees. Provides insights into the evolution and history of genes - through "gene" trees.
6 Example: Phylogeny of human and apes Apes Great apes: chimpanzee, bonobo (pygmy chimp), gorilla, orangutan Lesser apes: Gibbon
7 White-handed gibbon Hylobates lar
8 Borneo orangutan
9 Western lowland gorilla
10 Common chimpanzee
11 Homo sapiens
12 Traditional view Species Human Chimpanzee Gorilla Orangutan Gibbon
13 Same tree, different presentations Human Chimpanzee Gorilla Orangutan Gibbon Human Chimpanzee Gorilla Orangutan Gibbon Rectangular tree Curved tree
14
15 An example of gene tree Lin et al PNAS 2006
16 Objectives To understand the basic concepts and terminology of molecular phylogenetics; To understand tree topologies and how to read them To understand the basic concepts of different tree building methods
17 Tree Terminology Topology: the branching pattern of a tree
18 Nodes and OTUs External (or terminal) nodes: Nodes at the tips of the tree. Nodes A, B, C, D, and E. They represent extant taxonomic units: operational taxonomic units (OTUs). Internal nodes: all others(f,g,h,i). Internal nodes represent ancestral units. I G F H A B C D E
19 (a) Rooted tree One sequence the most basal ancestor of the tree R A B C (b) Unrooted tree Unrooted trees do not imply a known ancestral root A C D D B E E Time
20 The branches of a phylogenetic tree may be represented two different ways: Unscaled - branch lengths not proportional to the number of changes on the branches, shows topology only. Scaled - branch lengths proportional to the numbers of changes that have occurred in the branches (a) Unscaled I 2 G 6 2 F H 1 2 A B C D (b) Scaled A 3 B 2 1 D C E 1 unit E
21 Bifurcating vs. Multifurcating Human Chimpanzee Gorilla Orangutan Gibbon Bifurcating Tree: a node has only two immediate descendant lineages in a rooted tree Human Chimpanzee Gorilla Orangutan Gibbon Multifurcating tree: more than two children at some nodes and a rooted tree
22 Classification of Tree Reconstruction Methods 1. Distance methods or distance matrix method 2. Character state methods Inferring a phylogeny: an estimation procedure
23 Data set collection Multiple sequence alignment Character-based Tree construction Distance-based Parsimony Maximum Optimal criteria Likelihood UPGMA Neighbor Joining Fitch- Margoliash Kitch Distance Test reliability of the tree by analytical and/or resampling procedure
24 Inference Procedure: Two steps (1) Define an optimality criterion, or objective function, i.e., the value that is assigned to a tree and used to compare one tree to another (2) Develop algorithms to compute the value of the objective function, thereby to identify the tree or a set of trees that have the best values according to this criterion.
25 Optimality criterion Global optimality criterion: Consider all possible trees Local optimality criterion: Consider only a limited number of trees at each stage of tree reconstruction.
26 v Types of data used in phylogenetic inference Character-based methods: Use the aligned characters, such as DNA or protein sequences directly during tree inference. Distance-based methods: Transform the sequence data into pairwise distances, and use the matrix during tree building. 26
27 Types of Data: Characters and distances Character: A nucleotide at a site in a DNA seq. An amino acid at a site in a protein seq. Sequence 1: GACTGGTAC-A Sequence 2: GATTGGTAC-A Sequence 3: GATAGGCACTA Sequence 4: GACAAGCACTA Binary state characters: insertions and deletions Multi-state characters: 4 nucleotides or 20 amino acids
28 Distance Matrix Methods The evolutionary distances for all pairs of taxa are presented in a matrix. Algorithms based on some functional relationships among the distance values
29 Distance Methods - Example distances between sequences distance table 29
30 Distance-based method Unweighted Pair-Group Method with Arithmetic Mean (UPGMA)
31 Unweighted Pair-Group Method with Arithmetic Mean (UPGMA) Sequential clustering algorithm Local topological relationships are inferred in order of decreasing similarity and a phylogenetic tree is built in a stepwise manner.
32 Distance Methods - UPGMA Unweighted Pair Group Method with Arithmetic mean molecular clock assumed Clustering All leaves are iteratively merged according to their distance Construct a distance tree A -GCTTGTCCGTTACGAT B ACTTGTCTGTTACGAT C ACTTGTCCGAAACGAT D -ACTTGACCGTTTCCTT E AGATGACCGTTTCGAT F -ACTACACCCTTATGAG A B C D E B 2 C 4 4 D E F
33 v Molecular Clocks The Molecular Clock Hypothesis Proposed by Zuckerkandl and Pauling (1965) The rate of evolution in a given protein (or DNA) molecule is approximately constant over time and among evolutionary lineages Amount of genetic difference between sequences is statistically proportional to the time since separation 33
34 OTU A B C B d AB C d AC d BC D d AD d BD d CD Assume that d AB has the smallest value. OTUs A and B are the first to be clustered. Branching point: at a distance of d AB /2. Fig. 4 OTUs A and B are now considered as a single OTU, called a composite OTU.
35 OTU (AB) C C d (AB)C D d (AB)D d CD d (AB)C = (d AC + d BC ) /2 d (AB)D = (d AD + d BD ) /2 Assume that d (AB)C is the smallest: Branching point at a distance of d (AB)C /2
36 (a) d AB / 2 A B (c) A B (b) A B d (ABC)D / 2 C D d (AB)C / 2 C
37 Distance between two Composite OTUs OTUs (ij) and (mn): d (ij)(mn) = (d im + d in + d jm + d jn )/4 Arithmatic mean Same weight for all pairs of OTUs
38 Distance Methods - UPGMA First round 1 A A B C D E B 1 B 2 d C 4 4 (AB)C = (d AC +d BC )/2 = 4 d D (AB)D = (d AD +d BD )/2 = 6 d (AB)E = (d AE +d BE )/2 = 6 E d (AB)F = (d AF +d BF )/2 = 8 F Choose the most similar pair, cluster them together and calculate the new distance matrix. A,B C D E C 4 D 6 6 E F
39 Distance Methods - UPGMA Second round A,B C D E C 4 D 6 6 E F Third round A,B C D,E C 4 D,E 6 6 F A B d (DE)(AB) = (d D(AB) +d E(AB) )/2 = 6 d (DE)C = (d DC +d EC )/2 = 6 d (DE)F = (d DF +d EF )/2 = d (ABC)(DE) = (d (AB)(DE) +d C(DE) )/2 = 6 d (ABC)F = (d (AB)F +d CF )/2 = D E A B C D E 39
40 Distance Methods - UPGMA Fourth round AB,C D,E D,E 6 F A B C D E Fifth round ABC, DE F 8 d (ABCDE)F = (d (ABCD)F +d (DE)F )/2 = A 1 1 B 1 2 C D 4 E F
41 Human Chimp Gorilla Chimp 1.24 Gorilla Orang
42 H C G C 1.24 G O ~6.4 Mya 12 ~ 16 Mya 6.3 ~ 8.5 Mya Human Chimpanzee Gorilla Orangutan Mya : million years before present
43 Common chimpanzee: our closest relative
44 Supposed that you have the following tree: Since the divergence of A and B, B has accumulated mutations at a much higher rate than A.
45
46 Conclusion: The unequal rates of mutation has led to a completely different tree topology.
47 UPGMA Good for explaining some basic concepts and principles in tree reconstruction. UPGMA clustering method is very sensitive to unequal evolutionary rates. When one of the OTUs has incorporated more mutations over time, than the other OTU, one may end up with a tree that has the wrong topology There are better methods
48 Distance-based method Neighbors-relation method
49 Neighbors Two OTUs are said to be neighbors if they are connected through one single internal node. In Fig. (a) : A and B are neighbors, and so are D and E, but not A and C. (a) A B D C E
50 However, if A and B are treated as a composite OTU, then (AB) and C are neighbors. D E (A B) C
51 Additive Trees Molecular clock defines additive distances A tree is said to be additive if the distance between any two nodes is equal to the sum of the lengths of all the branches connecting them. As shown below A B C D E B 2 C 4 4 D E F A B C D E F
52 Four-Point Condition If additivity holds A a x c C d AC + d BD = d AD + d BC = a + c + X + b + d +x B b d D = a + b + c + d + 2x = d AB + d CD +2x, so d AC + d BD > d AB + d CD x: the length of the internal branch
53 d AB + d CD < d AC + d BD d AB + d CD < d AD + d BC A a x c C The two equations are the four-point condition B b d D Conversely: for four OTUs with unknown phylogeny, the two conditions can be used to identify the neighbors. Once the two pairs of neighbors are determined, the tree topology is determined.
54 Sattath and Tversky (1977): Neighbors relation method First, compute a distance matrix For every possible quadruple, say OUT i, j, m and n, compute (1) d ij + d mn (2) d im + d jn, and i j i j m n d ij (3) d in + d jm m d im d jm Choose the two neighbor pairs n d in d jn d mn
55 Neighbors relation method For a pair that is chosen to be neighbors, it receives a score of 1; otherwise, it receives 0. After every possible quadruple is considered, the pair with the highest score is chosen as the first pair of neighbors. They are then treated as a composite OUT. A new distance matrix is computed to search the next pair of neighbors. This procedure is repeated until the number of OTUs is reduced to 3.
56 A B C D B 22 C D E Chosen set of 4 Sum of distances Pairs chosen ABCD nab + ncd = = 40 AB, CD nac + nbd = = 80 nad + nbc = = 80 ABCE nab + nce = = 42 AB, CE nac + nbe = = 82 nae + nbc = = 82 ABDE nab + nde = = 32 AB, DE nad + nbe = = 82 nae + nbd = = 82 ACDE nac + nde = = 49 AC, DE nad + nce = = 59 nae + ncd = = 59 BCDE nbc + nde = = 51 BC, DE nbd + nce = = 61 nbe + ncd = = 61 AB (3) DE (3) CD (1) CE (1) BC (1). AB and DE are therefore closest neighbors
57 Distance-based method Neighbor-joining Method
58 Neighbor-joining Method Minimum evolution tree: a tree with the smallest sum of branch lengths. The neighbor-joining method finds neighbors sequentially that may minimize the total length of the tree.
59 Procedure Start with a star-like tree X < < = = = = = m j i ij m j i ij m i ix d T m T d m L S
60 Procedure Try one pair of neighbors, but put the rest in a star-cluster. = = = = + = m i i m i i d R d R d m R R T S ) 2( 2 Y X
61 Procedure Try all possible n(n - 1)/2 pairs Choose the pair with the smallest sum of branch lengths as neighbors (a composite OUT). Y X Y X Y X
62 Convert matrix Original distance matrix d 12 3 d 13 d 23 4 d 14 d 24 d 34 5 d 15 d 25 d 35 d 45 6 d 16 d 26 d 38 d 46 d 56 7 d 17 d 27 d 37 d 47 d 57 d 67 8 d 18 d 28 d 38 d 48 d 58 d 68 d 78 New distance matrix S 12 3 S 13 S 23 4 S 14 S 24 S 34 5 S 15 S 25 S 35 S 45 6 S 16 S 26 S 38 S 46 S 56 7 S 17 S 27 S 37 S 47 S 57 S 67 8 S 18 S 28 S 38 S 48 S 58 S 68 S 78
63 An example Molecular Evolution and Phylogenetics 2000, Nei and Kumar
64
65
66
67 Advantages and disadvantages of the neighbor-joining method Advantages is fast and thus suited for large datasets and for bootstrap analysis permits lineages with largely different branch lengths permits correction for multiple substitutions Disadvantages sequence information is reduced gives only one possible tree strongly dependent on the model of evolution used.
68 Character-based method Maximum Parsimony Method
69 Maximum Parsimony Method Uses character state data Search for a tree that requires the smallest number of evolutionary changes to explain the data. A tree thus inferred is called the maximum parsimony tree
70 Maximum Parsimony Methods Using character state data for a given multiple sequence alignment Give a score to a phylogenetic tree The score is a measure of the number of evolutionary changes that would be required to generate the data given that particular tree. Of the possible trees, the one considered most likely to represent the true history of the OTUs is the one with the lowest score (i.e., the one requiring the fewest evolutionary changes). A tree thus inferred is called the maximum parsimony tree
71 Informative sites A site is parsimony-informative if it favors some trees over the others, that is it contains at least two types of nucleotides (or amino acids), and at least two of them occur with a minimum frequency of two. Sites Sequence A A G A G T G C A 2 A G C C G T G C G 3 A G A T A T C C A 4 A G A G A T C C G
72 Sites Sequence A A G A G T G C A 2 A G C C G T G C G 3 A G A T A T C C A 4 A G A G A T C C G A A 1 3 Invariable site A A 1 2 A A A A 4 A A A A 0 CHANGE 0 CHANGE 0 CHANGE 4 4 3
73 Sites Sequence A A G A G T G C A 2 A G C C G T G C G 3 A G A T A T C C A 4 A G A G A T C C G A G 1 3 Uninformative sites A G 1 2 A G G G 3 G G 4 4 G G 1 CHANGE 1 CHANGE 1 CHANGE 3
74 Sites Sequence A A G A G T G C A 2 A G C C G T G C G 3 A G A T A T C C A 4 A G A G A T C C G G A 1 3 G A Informative sites G G 1 2 G G G A 1 CHANGE A A A A 2 CHANGES 2 CHANGES 4 3
75
76 Character 5 is invariant site (uninformative)
77 Character 9 is uninformative
78
79 Number of possible trees
80 Tree search methods Exhaustive = Examine all trees, get the best tree (guaranteed). Branch-and-Bound = Examine some trees, get the best tree (guaranteed). Heuristic = Examine some trees, get a tree that may or may not be the best tree.
81 Exhaustive
82 Branch-and-Bound Obtain a tree by a fast method. (e.g., the neighbor-joining method) Compute minimum number of substitutions (L) for the obtained tree. Turn L into an upper bound value. If the local parsimony score of the current incomplete tree T 0 is larger or equal to the best global score for any complete tree seen so far, then we do not generate or search the enumeration subtree
83 Branch-and-Bound
84 Branch-and-Bound: an example Assume we are given an msa A = {a1, a2,..., a5} and at a given position i the characters are: a1i = A, a2i = A, a3i = C, a4i = C and a5i = A. Assume that the Neighbor-Joining tree on A looks like this: Parsimony score of an alignment PS = 2
85 Only the first of the three trees fulfills the bound criterion and we do not pursue the other two trees.
86 The second step: The first three trees are optimal. Note that the bound criterion in the first step reduced the number of full trees to be considered by two thirds.
87 Heuristic
88 Heuristic
89 Heuristic
90 Heuristic
91 Heuristic
92 Maximum Likelihood Methods Well-established approach in statistics The ML method requires a probabilistic model for the process of nucleotide substitution. That is, we must specify the transition probability from one nucleotide state to another in a time interval in each branch.
93 Maximum Likelihood Method Likelihood provides probabilities of the sequences given a model of their evolution on a particular tree. The more probable the sequences given the tree, the more the tree is preferred. All possible trees are considered; computationally intense. Because the user can choose a model of evolution, the method can be useful for widely divergent groups or other difficult situations.
94 One-Parameter Model P ii ( t ) = e 4 4αt P ij ( t ) = e 4 4αt
95 Likelihood function Example: Four sequences A constant rate of substitution
96 x y t 1 t 1 + t 2+ t 3 t 2+ t 3 z t 2 t 3 4 l 3 k 2 j 1 i
97 The likelihood function for a site with nucleotides i, j, k, and l in sequences 1, 2, 3, and 4: If the nucleotide at the root was x, the probability of having nucleotide l in sequence 4 is P (t xl 1 +t 2 +t 3 ) because t 1 +t 2 +t 3 is the total amount of time between the two nodes. Probability of having nucleotide y at the common ancestral node of sequences 1, 2, and 3 is P (t xy 1 ), and so on.
98 Since we do not know the ancestral nucleotide, we can only assign a probability g, usually the frequency x of nucleotide x in the sequence. Noting that x, y, and z can be any of the 4 nucleotides, we sum over all possibilities and obtain the following likelihood function:
99 h(i, j, k, l) = x g x P xl (t 1 +t 2 +t 3 ) y P xy (t 1 )P yk (t 2 +t 3 ) z P yz (t 2 )P zi (t 3 )P zj (t 3 )
100 The above formula is for a single site. The likelihood for all sites is the product of the likelihoods for individual sites if all the nucleotide sites evolve independently.
101 For a given set of data, one computes the maximum likelihood value for each tree topology; this procedure is essentially to find the branch lengths that give the largest value for the likelihood function. Finally, chooses the topology with the highest maximum likelihood value as the best tree, which is called the maximum likelihood tree.
102 Estimation of Branch Lengths Tree topology: Phylogenetic relationships Branch lengths: Degree of separation Topology and branch lengths are estimated at the same time: UPGMA Maximum parsimony Maximum likelihood
103 Tree Reliability Tests-Bootstrap analysis Reliability refers to the probability that members of a clade will be part of the true tree. Bootstrapping is the most common reliability test. In bootstrapping, re-sampling of the sites in the alignment is used to build new trees. These extra samples are created with "replacement" - it is possible that some positions will be repeated in the subsample, while some positions will be left out. Multiple re-samples (hundreds to thousands) are run.
104 Bootstrap analysis Thus bootstrap analysis: is a statistical method for obtaining an estimate of error is used to evaluate the reliability of a tree is used to examine how often a particular cluster in a tree appears when nucleotides or amino acids are re-sampled
105 The closer the score is to 100, the more significant the grouping. Bootstrapping can be used with distance, parsimony and likelihood methods.
106 An example of bootstrap analysis
107
108 Bootstrap dataset Bootstrap dataset 999
109
110
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
Evolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
Phylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
EVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
Michael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D
7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood
Phylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
Evolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
Phylogeny: traditional and Bayesian approaches
Phylogeny: traditional and Bayesian approaches 5-Feb-2014 DEKM book Notes from Dr. B. John Holder and Lewis, Nature Reviews Genetics 4, 275-284, 2003 1 Phylogeny A graph depicting the ancestor-descendent
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
Theory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
A (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
Phylogeny. November 7, 2017
Phylogeny November 7, 2017 Phylogenetics Phylon = tribe/race, genetikos = relative to birth Phylogenetics: study of evolutionary relationships among organisms, sequences, or anything in between Related
Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction
Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
Phylogeny Tree Algorithms
Phylogeny Tree lgorithms Jianlin heng, PhD School of Electrical Engineering and omputer Science University of entral Florida 2006 Free for academic use. opyright @ Jianlin heng & original sources for some
9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
How to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
Consistency Index (CI)
Consistency Index (CI) minimum number of changes divided by the number required on the tree. CI=1 if there is no homoplasy negatively correlated with the number of species sampled Retention Index (RI)
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
A Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
Evolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies Anatomical features were the dominant
Estimating Phylogenies (Evolutionary Trees) II. Biol4230 Thurs, March 2, 2017 Bill Pearson Jordan 6-057
Estimating Phylogenies (Evolutionary Trees) II Biol4230 Thurs, March 2, 2017 Bill Pearson wrp@virginia.edu 4-2818 Jordan 6-057 Tree estimation strategies: Parsimony?no model, simply count minimum number
Workshop III: Evolutionary Genomics
Identifying Species Trees from Gene Trees Elizabeth S. Allman University of Alaska IPAM Los Angeles, CA November 17, 2011 Workshop III: Evolutionary Genomics Collaborators The work in today s talk is joint
Lecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science
Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
Phylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
Page 1. Evolutionary Trees. Why build evolutionary tree? Outline
Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1. Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1 Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003 Lecturer: Wing-Kin Sung Scribe: Ning K., Shan T., Xiang
Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony
ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),
Bioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
Phylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
Plan: Evolutionary trees, characters. Perfect phylogeny Methods: NJ, parsimony, max likelihood, Quartet method
Phylogeny 1 Plan: Phylogeny is an important subject. We have 2.5 hours. So I will teach all the concepts via one example of a chain letter evolution. The concepts we will discuss include: Evolutionary
Inferring phylogeny. Today s topics. Milestones of molecular evolution studies Contributions to molecular evolution
Today s topics Inferring phylogeny Introduction! Distance methods! Parsimony method!"#$%&'(!)* +,-.'/01!23454(6!7!2845*0&4'9#6!:&454(6 ;?@AB=C?DEF Overview of phylogenetic inferences Methodology Methods
C.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki
Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço jcarrico@fm.ul.pt Charles Darwin (1809-1882) Charles Darwin s tree of life in Notebook B, 1837-1838 Ernst Haeckel (1934-1919)
DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi
DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :
Cladistics and Bioinformatics Questions 2013
AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species
CHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
Thanks to Paul Lewis, Jeff Thorne, and Joe Felsenstein for the use of slides
hanks to Paul Lewis, Jeff horne, and Joe Felsenstein for the use of slides Hennigian logic reconstructs the tree if we know polarity of characters and there is no homoplasy UPM infers a tree from a distance
Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley
Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley B.D. Mishler Feb. 14, 2018. Phylogenetic trees VI: Dating in the 21st century: clocks, & calibrations;
Inferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies
Inferring Phylogenetic Trees Distance Approaches Representing distances in rooted and unrooted trees The distance approach to phylogenies given: an n n matrix M where M ij is the distance between taxa
Phylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
Intraspecific gene genealogies: trees grafting into networks
Intraspecific gene genealogies: trees grafting into networks by David Posada & Keith A. Crandall Kessy Abarenkov Tartu, 2004 Article describes: Population genetics principles Intraspecific genetic variation
Phylogenetic inference: from sequences to trees
W ESTFÄLISCHE W ESTFÄLISCHE W ILHELMS -U NIVERSITÄT NIVERSITÄT WILHELMS-U ÜNSTER MM ÜNSTER VOLUTIONARY FUNCTIONAL UNCTIONAL GENOMICS ENOMICS EVOLUTIONARY Bioinformatics 1 Phylogenetic inference: from sequences
Theory of Evolution. Charles Darwin
Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches
Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell
Michael Yaffe Lecture #4 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D
7.91 Lecture #4 Database Searching & Molecular Phylogenetics Michael Yaffe A B C D A B C D (((A,B)C)D) Outline FASTA, Blast searching, Smith-Waterman Psi-Blast Review of enomic DNA structure Substitution
Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) p.1/30
Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) Joe Felsenstein Department of Genome Sciences and Department of Biology Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) p.1/30 A non-phylogeny
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
Molecular Evolution and Phylogenetic Tree Reconstruction
1 4 Molecular Evolution and Phylogenetic Tree Reconstruction 3 2 5 1 4 2 3 5 Orthology, Paralogy, Inparalogs, Outparalogs Phylogenetic Trees Nodes: species Edges: time of independent evolution Edge length
Microbial Diversity and Assessment (II) Spring, 2007 Guangyi Wang, Ph.D. POST103B
Microbial Diversity and Assessment (II) Spring, 007 Guangyi Wang, Ph.D. POST03B guangyi@hawaii.edu http://www.soest.hawaii.edu/marinefungi/ocn403webpage.htm General introduction and overview Taxonomy [Greek
The Tree of Life. Phylogeny
The Tree of Life Phylogeny Phylogenetics Phylogenetic trees illustrate the evolutionary relationships among groups of organisms, or among a family of related nucleic acid or protein sequences Each branch
Phylogenetics: Bayesian Phylogenetic Analysis. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Bayesian Phylogenetic Analysis COMP 571 - Spring 2015 Luay Nakhleh, Rice University Bayes Rule P(X = x Y = y) = P(X = x, Y = y) P(Y = y) = P(X = x)p(y = y X = x) P x P(X = x 0 )P(Y = y X
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
(Stevens 1991) 1. morphological characters should be assumed to be quantitative unless demonstrated otherwise
Bot 421/521 PHYLOGENETIC ANALYSIS I. Origins A. Hennig 1950 (German edition) Phylogenetic Systematics 1966 B. Zimmerman (Germany, 1930 s) C. Wagner (Michigan, 1920-2000) II. Characters and character states
Estimating Evolutionary Trees. Phylogenetic Methods
Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent
Effects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
Phylogenetics: Parsimony
1 Phylogenetics: Parsimony COMP 571 Luay Nakhleh, Rice University he Problem 2 Input: Multiple alignment of a set S of sequences Output: ree leaf-labeled with S Assumptions Characters are mutually independent
Fractional Replications
Chapter 11 Fractional Replications Consider the set up of complete factorial experiment, say k. If there are four factors, then the total number of plots needed to conduct the experiment is 4 = 1. When
Organizing Life s Diversity
17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny
InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
Evolutionary Trees. Evolutionary tree. To describe the evolutionary relationship among species A 3 A 2 A 4. R.C.T. Lee and Chin Lung Lu
Evolutionary Trees R.C.T. Lee and Chin Lung Lu CS 5313 Algorithms for Molecular Biology Evolutionary Trees p.1 Evolutionary tree To describe the evolutionary relationship among species Root A 3 Bifurcating
Thanks to Paul Lewis and Joe Felsenstein for the use of slides
Thanks to Paul Lewis and Joe Felsenstein for the use of slides Review Hennigian logic reconstructs the tree if we know polarity of characters and there is no homoplasy UPGMA infers a tree from a distance
Molecular Clock. МОЛЕКУЛЯРНАЯ ЭКОЛОГИЯ, 31 марта 2017, Пятн, #5. Molecular Clock
1 Molecular Clock If rate of allele substitutions is constant for molecular variants, then this rate can be used as a molecular clock, and these predictions can be used to infer time of divergence between
CS5263 Bioinformatics. Guest Lecture Part II Phylogenetics
CS5263 Bioinformatics Guest Lecture Part II Phylogenetics Up to now we have focused on finding similarities, now we start focusing on differences (dissimilarities leading to distance measures). Identifying
CSCI1950 Z Computa4onal Methods for Biology Lecture 5
CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr
Molecular Evolution & Phylogenetics
Molecular Evolution & Phylogenetics Heuristics based on tree alterations, maximum likelihood, Bayesian methods, statistical confidence measures Jean-Baka Domelevo Entfellner Learning Objectives know basic
molecular evolution and phylogenetics
molecular evolution and phylogenetics Charlotte Darby Computational Genomics: Applied Comparative Genomics 2.13.18 https://www.thinglink.com/scene/762084640000311296 Internal node Root TIME Branch Leaves
Introduction to characters and parsimony analysis
Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect
Phylogenetics in the Age of Genomics: Prospects and Challenges
Phylogenetics in the Age of Genomics: Prospects and Challenges Antonis Rokas Department of Biological Sciences, Vanderbilt University http://as.vanderbilt.edu/rokaslab http://pubmed2wordle.appspot.com/
Is the equal branch length model a parsimony model?
Table 1: n approximation of the probability of data patterns on the tree shown in figure?? made by dropping terms that do not have the minimal exponent for p. Terms that were dropped are shown in red;
Algorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,
Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837
Bootstrap confidence levels for phylogenetic trees B. Efron, E. Halloran, and S. Holmes, 1996
Bootstrap confidence levels for phylogenetic trees B. Efron, E. Halloran, and S. Holmes, 1996 Following Confidence limits on phylogenies: an approach using the bootstrap, J. Felsenstein, 1985 1 I. Short
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
MOLECULAR EVOLUTION AND PHYLOGENETICS SERGEI L KOSAKOVSKY POND CSE/BIMM/BENG 181 MAY 27, 2011
MOLECULAR EVOLUTION AND PHYLOGENETICS If we could observe evolution: speciation, mutation, natural selection and fixation, we might see something like this: AGTAGC GGTGAC AGTAGA CGTAGA AGTAGA A G G C AGTAGA
Letter to the Editor. Department of Biology, Arizona State University
Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona
Biology 559R: Introduction to Phylogenetic Comparative Methods Topics for this week (Jan 27 & 29):
Biology 559R: Introduction to Phylogenetic Comparative Methods Topics for this week (Jan 27 & 29): Statistical estimation of models of sequence evolution Phylogenetic inference using maximum likelihood: