THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
|
|
- Christina Blair
- 2 years ago
- Views:
Transcription
1 Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between them. Aligning sequences assigns functions to the unknown proteins, determines the evolutionary relatedness of organisms and helps in making prediction about the 3D structures. Homology is attributed to similarity due to a descent from a common ancestor, i.e. if two sequences from different organism are similar there is a possibility that both sequences are termed as Homologous. Thereby, predicting structure and function for the sequences. Types of Sequence Alignment- Based on sequence Length According to the length of sequence being compared it is of following two types 1) Global sequence Alignment In this alignment sequences are aligned along their entire length to include as many matching characters possible. TAGC-GC-GT TA-CA-CAGT 2) Local sequence Alignment In this alignment sequences are aligned to find a region of higher density or strong similarity. CGATAACGTAT --ATAAAC--- Based on Number of sequence- According to number of sequence being compared it is of following two types 1) Pairwise Sequence Alignment - This involves aligning two sequences and to get the best region of similarity. 1 KTSSGNGAEDS 11 1 KTSSGNGAEDS 11 1
2 Various methods used for pairwise alignment of nucleotide and protein sequences are: 1) Dot Plot It is graphical method for two sequences to identify the region of maximum similarity and dissimilarity, depicted by presence and absence of DOTS. 2) Dynamic Programming This method breaks a problem into small sub-problems and uses the solution of the sub-problems to compute the solution of the larger one. Some algorithms like Needleman-Wansch and Smith-Waterman are used here. 3) Heuristic Method When a single sequence is to be compared against the whole database heuristic methods like BLAST and FASTA are used. The following are certain parameters used for producing optimum alignment - a) Max target sequences It displays the result with total number of aligned sequences on a page. b) Expected Threshold It is a statistical indicator which calculates the probability that the resulting alignment are caused by random chance. The lower the E value, the more significant is the score The default value is kept 10 as 10 matches are expected to be found random by chance (Stochastic model of Karlin & Altschul, 1990). c) Query match - It gives the maximum match in a query range. This is useful for comparing many stronger matches of the query results from weaker matches of the results. d) Word size This algorithm works by using word matches between the query and the database sequences. It searches for exact word match, initiates the extension leading to the full alignment. Word size 3 is required for standard protein align. Word size 2 is required for short and nearly exact matches. e) Scoring schemes Different scoring schemes algorithms are devised to obtain an optimum alignment. Use of any substitution matrix helps in aligning possible pair of residues and also generates scores. To check the quality of pairwise sequence alignment, different PAM and BLOSUM matrices are used. BLOSUM (Block amino acid substitution matrix) This has been developed using conserved regions called BLOCKS. Of distantly related protein sequences available from the block database. Out of all BLOSUM 62 matrix is best used for detecting most protein similarities. BLOSUM 45 may be used for longer and weaker alignments. 2
3 PAM (Point Accepted Mutation) This is developed by calculating the substitution of amino acid during evolution which are naturally accepted. PAM 30 is used for sequences less than 35 in length whereas PAM 70 is used for sequences ranging from 35 to 50. f) Gap costs A gap is a space which is introduced into an alignment to compensate for insertions and deletions in one sequence relative to another. Too many gaps should be avoided in the alignment and hence a gap penalty or gap score is assign. The introduction of gap causes the deduction of gap score from the alignment score. Extension of the gap to encompass additional nucleotides or amino acid is also penalized in the scoring of an alignment. Increase in gap costs parameter results in the decreased number of gaps in the alignment. The penalty for the creation of a gap should be large enough so that gaps are introduced only where needed, and the penalty for extending a gap should take into account the likelihood that insertions and deletions occur over several residues at a time. Some used values here are existence 10, 11 and extension 1. 2) Multiple sequence Alignment - This involves the alignment of more than two (protein, DNA) sequences and assess the sequence conservation of proteins domains and protein structures. It is an extrapolation of pairwise sequence alignment which reflects alignment of similar sequences and provides a better alignment score. 3
4 Various analysis like Homology modeling for prediction of protein structure, Phylogenetic analysis, motif detection etc are based on the results of multiple sequence alignment. There are many softwares like Clustal, t-coffee, Phylip, MSA, MUSCLE used for obtaining multiple sequence alignment. Example Seq 3 - Seq 4 - Seq 5 - PQGGGGWGQ Following parameters should be considered to align multiple sequences. Protein weight matrix - Matrix is used to increase the alignment score. Eg: PAM and BLOSUM. Gap Open The penalty to open a gap. The presence of a gap is frequently given more significance than the length of the gap. By default, the gap opening penalty is 10. Gap extension The penalty to extend a gap. Extension of the gap also involves additional amino acid penalized in the scoring of an alignment. By default, gap extension penalty is Application of MSA results - Phylogenetic Analysis It is one of the major areas where multiple sequence analysis results are used to find the evolutionary relatedness between sequences. The results are displayed in form of Phylogenetic tree which has set of nodes and branches to link the nodes. Methods used for Phylogenetic analysis are: 1) UPGMA (Unweighted Pair Group Method with Arithmetic Mean) it is a simple, hierarchical clustering, tree making method which uses distance matrix to find the relatedness between sequences. 2) NJ (Neighbor Joining) - It is a method that is related to the clustering method. The method is especially suited for datasets comprising lineages with largely varying rates of evolution. In this method, a special case of the star decomposition is seen File format view: 4
5 PHYLIP - PHYLogeny Inference Package. It s a format for Joe Felsenstein s phylogenetic applications, having 8 letter maximum lengths for the sequence ID. Claudogram - In a cladgram, the external taxa line up neatly in a row Their branch lengths are not proportional to the number of evolutionary changes and thus no Phylogenetic time analysis can be done only the relative ordering of the taxa can be analyzed. Phylogram In a phylogram, the branch lengths represent the amount of evolutionary divergence. Such trees are said to be scaled. Pearson/ FASTA Text based format to represent amino acids in single letter code. It also has sequence names followed by comments. Jalview Java alignment editor. It is a visualization tool for alignment algorithms and other database search results. 5
Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)
Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline
Sequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University
Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of
5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT
5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:
3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT
3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode
08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega
BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments
CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018
CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of
Single alignment: Substitution Matrix. 16 march 2017
Single alignment: Substitution Matrix 16 march 2017 BLOSUM Matrix BLOSUM Matrix [2] (Blocks Amino Acid Substitution Matrices ) It is based on the amino acids substitutions observed in ~2000 conserved block
Phylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
Quantifying sequence similarity
Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity
CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)
CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology
Sequence analysis and Genomics
Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute
In-Depth Assessment of Local Sequence Alignment
2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.
Collected Works of Charles Dickens
Collected Works of Charles Dickens A Random Dickens Quote If there were no bad people, there would be no good lawyers. Original Sentence It was a dark and stormy night; the night was dark except at sunny
Sequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013
Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation
InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
Biochemistry 324 Bioinformatics. Pairwise sequence alignment
Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene
"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
Basic Local Alignment Search Tool
Basic Local Alignment Search Tool Alignments used to uncover homologies between sequences combined with phylogenetic studies o can determine orthologous and paralogous relationships Local Alignment uses
Sequence Alignment Techniques and Their Uses
Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this
Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment
Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand
Alignment & BLAST. By: Hadi Mozafari KUMS
Alignment & BLAST By: Hadi Mozafari KUMS SIMILARITY - ALIGNMENT Comparison of primary DNA or protein sequences to other primary or secondary sequences Expecting that the function of the similar sequence
Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment
Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value
Large-Scale Genomic Surveys
Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction
Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
Tools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Multiple sequence alignment
Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple
An Introduction to Sequence Similarity ( Homology ) Searching
An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr
Scoring Matrices. Shifra Ben-Dor Irit Orr
Scoring Matrices Shifra Ben-Dor Irit Orr Scoring matrices Sequence alignment and database searching programs compare sequences to each other as a series of characters. All algorithms (programs) for comparison
BIOINFORMATICS: An Introduction
BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
Chapter 5. Proteomics and the analysis of protein sequence Ⅱ
Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
Pairwise & Multiple sequence alignments
Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived
Week 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
Using Bioinformatics to Study Evolutionary Relationships Instructions
3 Using Bioinformatics to Study Evolutionary Relationships Instructions Student Researcher Background: Making and Using Multiple Sequence Alignments One of the primary tasks of genetic researchers is comparing
Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment
Sequence Analysis 17: lecture 5 Substitution matrices Multiple sequence alignment Substitution matrices Used to score aligned positions, usually of amino acids. Expressed as the log-likelihood ratio of
Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre
Bioinformatics Scoring Matrices David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Learning Objectives To explain the requirement
Homology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
Copyright 2000 N. AYDIN. All rights reserved. 1
Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment
Phylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
Similarity or Identity? When are molecules similar?
Similarity or Identity? When are molecules similar? Mapping Identity A -> A T -> T G -> G C -> C or Leu -> Leu Pro -> Pro Arg -> Arg Phe -> Phe etc If we map similarity using identity, how similar are
Effects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
Ch. 9 Multiple Sequence Alignment (MSA)
Ch. 9 Multiple Sequence Alignment (MSA) - gather seqs. to make MSA - doing MSA with ClustalW - doing MSA with Tcoffee - comparing seqs. that cannot align Introduction - from pairwise alignment to MSA -
Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis
Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis Kumud Joseph Kujur, Sumit Pal Singh, O.P. Vyas, Ruchir Bhatia, Varun Singh* Indian Institute of Information
Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches
Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell
Sequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University
Sequence Alignment: Scoring Schemes COMP 571 Luay Nakhleh, Rice University Scoring Schemes Recall that an alignment score is aimed at providing a scale to measure the degree of similarity (or difference)
Bioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
Sequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
Computational Biology
Computational Biology Lecture 6 31 October 2004 1 Overview Scoring matrices (Thanks to Shannon McWeeney) BLAST algorithm Start sequence alignment 2 1 What is a homologous sequence? A homologous sequence,
IMPLEMENTING HIERARCHICAL CLUSTERING METHOD FOR MULTIPLE SEQUENCE ALIGNMENT AND PHYLOGENETIC TREE CONSTRUCTION
IMPLEMENTING HIERARCHICAL CLUSTERING METHOD FOR MULTIPLE SEQUENCE ALIGNMENT AND PHYLOGENETIC TREE CONSTRUCTION Harmandeep Singh 1, Er. Rajbir Singh Associate Prof. 2, Navjot Kaur 3 1 Lala Lajpat Rai Institute
Motivating the need for optimal sequence alignments...
1 Motivating the need for optimal sequence alignments... 2 3 Note that this actually combines two objectives of optimal sequence alignments: (i) use the score of the alignment o infer homology; (ii) use
Practical considerations of working with sequencing data
Practical considerations of working with sequencing data File Types Fastq ->aligner -> reference(genome) coordinates Coordinate files SAM/BAM most complete, contains all of the info in fastq and more!
Grouping of amino acids and recognition of protein structurally conserved regions by reduced alphabets of amino acids
Science in China Series C: Life Sciences 2007 Science in China Press Springer-Verlag Grouping of amino acids and recognition of protein structurally conserved regions by reduced alphabets of amino acids
Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
Comparing whole genomes
BioNumerics Tutorial: Comparing whole genomes 1 Aim The Chromosome Comparison window in BioNumerics has been designed for large-scale comparison of sequences of unlimited length. In this tutorial you will
Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)
Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
Tools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2013 Week3: Blast Algorithm, theory and practice Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and Systems Biology
Introduction to Bioinformatics
Introduction to Bioinformatics Jianlin Cheng, PhD Department of Computer Science Informatics Institute 2011 Topics Introduction Biological Sequence Alignment and Database Search Analysis of gene expression
Theory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Sequence Analysis and Databases 2: Sequences and Multiple Alignments
1 Sequence Analysis and Databases 2: Sequences and Multiple Alignments Jose María González-Izarzugaza Martínez CNIO Spanish National Cancer Research Centre (jmgonzalez@cnio.es) 2 Sequence Comparisons:
First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences
First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences 140.638 where do sequences come from? DNA is not hard to extract (getting DNA from a
Similarity searching summary (2)
Similarity searching / sequence alignment summary Biol4230 Thurs, February 22, 2016 Bill Pearson wrp@virginia.edu 4-2818 Pinn 6-057 What have we covered? Homology excess similiarity but no excess similarity
Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
Phylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
Sequence Analysis '17- lecture 8. Multiple sequence alignment
Sequence Analysis '17- lecture 8 Multiple sequence alignment Ex5 explanation How many random database search scores have e-values 10? (Answer: 10!) Why? e-value of x = m*p(s x), where m is the database
Thanks to Paul Lewis, Jeff Thorne, and Joe Felsenstein for the use of slides
hanks to Paul Lewis, Jeff horne, and Joe Felsenstein for the use of slides Hennigian logic reconstructs the tree if we know polarity of characters and there is no homoplasy UPM infers a tree from a distance
Tiffany Samaroo MB&B 452a December 8, Take Home Final. Topic 1
Tiffany Samaroo MB&B 452a December 8, 2003 Take Home Final Topic 1 Prior to 1970, protein and DNA sequence alignment was limited to visual comparison. This was a very tedious process; even proteins with
Pairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55
Pairwise Alignment Guan-Shieng Huang shieng@ncnu.edu.tw Dept. of CSIE, NCNU Pairwise Alignment p.1/55 Approach 1. Problem definition 2. Computational method (algorithms) 3. Complexity and performance Pairwise
Pairwise sequence alignments
Pairwise sequence alignments Volker Flegel VI, October 2003 Page 1 Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs VI, October
Moreover, the circular logic
Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT
G4120: Introduction to Computational Biology
ICB Fall 2003 G4120: Introduction to Computational Biology Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology Copyright 2003 Oliver Jovanovic, All Rights Reserved. Bioinformatics and
Alignment principles and homology searching using (PSI-)BLAST. Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU)
Alignment principles and homology searching using (PSI-)BLAST Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU) http://ibivu.cs.vu.nl Bioinformatics Nothing in Biology makes sense except in
Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science
Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.
Phylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
Introduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple
Pairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel )
Pairwise sequence alignments Vassilios Ioannidis (From Volker Flegel ) Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs Importance
Substitution matrices
Introduction to Bioinformatics Substitution matrices Jacques van Helden Jacques.van-Helden@univ-amu.fr Université d Aix-Marseille, France Lab. Technological Advances for Genomics and Clinics (TAGC, INSERM
Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models
Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm Alignment scoring schemes and theory: substitution matrices and gap models 1 Local sequence alignments Local sequence alignments are necessary
EVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
Phylogenetic Tree Generation using Different Scoring Methods
International Journal of Computer Applications (975 8887) Phylogenetic Tree Generation using Different Scoring Methods Rajbir Singh Associate Prof. & Head Department of IT LLRIET, Moga Sinapreet Kaur Student
Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:
Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:50 5001 5 Multiple Sequence Alignment The first part of this exposition is based on the following sources, which are recommended reading:
Introduction to Bioinformatics Introduction to Bioinformatics
Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
Michael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D
7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood
Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
Sequencing alignment Ameer Effat M. Elfarash
Sequencing alignment Ameer Effat M. Elfarash Dept. of Genetics Fac. of Agriculture, Assiut Univ. aelfarash@aun.edu.eg Why perform a multiple sequence alignment? MSAs are at the heart of comparative genomics
Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT
Inferring phylogeny Constructing phylogenetic trees Tõnu Margus Contents What is phylogeny? How/why it is possible to infer it? Representing evolutionary relationships on trees What type questions questions
How to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation