Cladistics and Bioinformatics Questions 2013
|
|
- Marybeth Copeland
- 3 years ago
- Views:
Transcription
1 AP Biology Name Cladistics and Bioinformatics Questions The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species of mammals compared to that of a homologous human gene. In simpler terms, the percentage similarity between the human gene and the Chimpanzee gene is 99.7% Species Percentage Similarity Chimpanzee 99.7 Baboon 97.2 Rabbit 93.7 Rhesus Monkey 96.9 Orangutan 98.6 Draw a cladogram depicting the evolutionary relationships among all six species (including humans) according to their percentage similarity in the gene shown in the table. An outgroup is a species of organism that acts as a reference group when determining the evolutionary relationships between three or more other species of organisms. It is hypothesized to be related to the species in question but less closely than any of the other species are to each other. Outgroup species therefore share more primitive characteristics with the group in question. In a phylogenetic tree, the line for the outgroup should branch from the ancestral lineage before any of the other groups. It gives you an overall comparison between a distantly related species and those that are more closely related. 2. What probably explains the inclusion of rabbits in this research from Question 1? A. Their short generation time provides a ready source of DNA. B. They possess all of the shared derived characters as do the other species. C. They are the closest known relatives of the rhesus monkeys. D. They are the outgroup. E. They are mammals. 3. What conclusions can be drawn from the data shown in Question 1? A. Humans and other primates evolved from rabbits within the past 10 million years. B. Most of the genes of other organisms are similar to human genes. C. Among the species listed, humans shared a common ancestor most recently with chimpanzees. D. Humans evolved from chimpanzees somewhere in Africa within the last 6 million years. E. Both B and C are correct. 1
2 4. Use the following data table to construct a cladogram of the major plant groups. From this data table, you should first construct a table similar to the one in Question 5 below. This will make it easier to construct the cladogram. Organism Vascular Tissue Flowers Seeds Mosses Pine Trees Flowering Plants Ferns Total Draw a cladogram based on the first five characters (not dorsal fin ) in the table below. Place hatch marks on the tree to indicate the origin(s) of each of the five characters. 6. Notice that the character dorsal fin is included in the table, a character possessed by both the Tuna and the Dolphin. Why was the character of dorsal fin not used to construct the cladogram, even though it is a character shared by both the Tuna and the Dolphin? 2
3 Use the phylogenetic tree to the right to answer the following questions. Note: This phylogenetic tree is not a true cladogram, because it is based on the time that these organisms diverged from a common ancestor, not shared derived characters. 7. A common ancestor of species E and C would be at position number: A. 1 B. 2 C. 3 D. 4 E The two species in the tree that are most closely related to each other are: A. A and B C. C and D B. B and C D. D and E E. E and A 9. If this tree was derived from common homologies, a clade within the tree would include (choose all that apply) A. A, B, C and E C. A, B, C and D B. A, C and E D. B, C, and D E. A, B, C, D and E 10. If you were using cladistic analysis to build a phylogenetic tree of cats, which of the following would make the best outgroup? A. lion B. wolf C. tiger D. leopard E. domestic cat 11. All of the following describe a way in which Bioinformatics can be used. Which of the following describes best what you were doing in the bioinformatics assignment? A. Using gene sequences to determine the amino acid sequence of a protein B. Comparing nucleotide sequences from an organism in question to known sequences in order to make inferences about the relatedness of that organism to others (Comparative Biochemistry). C. Using gene sequences to determine the three dimensional structure of a protein. D. Analyzing gene sequences to determine which mutations cause disease. E. Use known gene sequences to produce genes for genetic engineering research. 3
4 Five new species of bacteria were discovered in Antarctic ice core samples. The nucleotide (base) sequences of rrna subunits were determined for the new species. The table below shows the number of nucleotide differences between the species. 12. Which of the following phylogenetic trees is most consistent with the data? 4
5 13. Data regarding the presence (+) or absence (-) of five derived traits in several different species are shown in the table below. Which of the following cladograms provides the simplest and most accurate representation of the data in the table? 5
Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
Investigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST
Investigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST Introduction Bioinformatics is a powerful tool which can be used to determine evolutionary relationships and
Phylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied
CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny
CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny To trace phylogeny or the evolutionary history of life, biologists use evidence from paleontology, molecular data, comparative
Organizing Life s Diversity
17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)
- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the
Classification and Phylogeny
Classification and Phylogeny The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
Classification and Phylogeny
Classification and Phylogeny The diversity it of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
Classification Chapter 18
Classification Chapter 18 The domain system Prokaryotic domains Bacteria and Archaea Eukaryotes Are in the domain Eukarya Bacteria Archaea Eukarya Earliest organisms Prokaryotes Eukoryotes Figure 15.10B
AP Biology Evolution Review Slides
AP Biology Evolution Review Slides How would one go about studying the evolution of a tetrapod limb from a fish s fin? Compare limb/fin structure of existing related species of fish to tetrapods Figure
PSI Biology Classification Classification
Classification Classification & Naming Classwork 1. What is the correct order of the current classification hierarchy, from most general to most specific? 2. Are two organisms in domain more or less closely
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
COMPARING DNA SEQUENCES TO UNDERSTAND EVOLUTIONARY RELATIONSHIPS WITH BLAST
Big Idea 1 Evolution INVESTIGATION 3 COMPARING DNA SEQUENCES TO UNDERSTAND EVOLUTIONARY RELATIONSHIPS WITH BLAST How can bioinformatics be used as a tool to determine evolutionary relationships and to
PHYLOGENY WHAT IS EVOLUTION? 1/22/2018. Change must occur in a population via allele
PHYLOGENY EXERCISE 1 AND 2 WHAT IS EVOLUTION? The theory that all living organisms on earth are related and have a common ancestor. These organism have changed over time and are continuing to change. Changes
Name: Class: Date: ID: A
Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change
Biology 211 (2) Week 1 KEY!
Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of
Concept Modern Taxonomy reflects evolutionary history.
Concept 15.4 Modern Taxonomy reflects evolutionary history. What is Taxonomy: identification, naming, and classification of species. Common Names: can cause confusion - May refer to several species (ex.
Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
PHYLOGENY AND SYSTEMATICS
AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
Thursday, January 14. Teaching Point: SWBAT. assess their knowledge to prepare for the Evolution Summative Assessment. (TOMORROW) Agenda:
Thursday, January 14 Teaching Point: SWBAT. assess their knowledge to prepare for the Evolution Summative Assessment. (TOMORROW) Agenda: 1. Show Hinsz your completed Review WS 2. Discuss answers to Review
Macroevolution Part I: Phylogenies
Macroevolution Part I: Phylogenies Taxonomy Classification originated with Carolus Linnaeus in the 18 th century. Based on structural (outward and inward) similarities Hierarchal scheme, the largest most
Chapter 19: Taxonomy, Systematics, and Phylogeny
Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand
Lecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES
USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES HOW CAN BIOINFORMATICS BE USED AS A TOOL TO DETERMINE EVOLUTIONARY RELATIONSHPS AND TO BETTER UNDERSTAND PROTEIN HERITAGE?
Lecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
CLASSIFICATION. Why Classify? 2/18/2013. History of Taxonomy Biodiversity: variety of organisms at all levels from populations to ecosystems.
Why Classify? Classification has been around ever since people paid attention to organisms. CLASSIFICATION One primeval system was based on harmful and non-harmful organisms. Life is easier when we organize
Bio 1B Lecture Outline (please print and bring along) Fall, 2007
Bio 1B Lecture Outline (please print and bring along) Fall, 2007 B.D. Mishler, Dept. of Integrative Biology 2-6810, bmishler@berkeley.edu Evolution lecture #5 -- Molecular genetics and molecular evolution
CLASSIFICATION OF LIVING THINGS. Chapter 18
CLASSIFICATION OF LIVING THINGS Chapter 18 How many species are there? About 1.8 million species have been given scientific names Nearly 2/3 of which are insects 99% of all known animal species are smaller
Lab 06 Phylogenetics, part 1
Lab 06 Phylogenetics, part 1 phylogeny is a visual representation of a hypothesis about the relationships among a set of organisms. Phylogenetics is the study of phylogenies and and their development.
METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
Organizing Life on Earth
Organizing Life on Earth Inquire: Organizing Life on Earth Overview Scientists continually obtain new information that helps to understand the evolutionary history of life on Earth. Each group of organisms
CHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
AP Biology Notes Outline Enduring Understanding 1.B. Big Idea 1: The process of evolution drives the diversity and unity of life.
AP Biology Notes Outline Enduring Understanding 1.B Big Idea 1: The process of evolution drives the diversity and unity of life. Enduring Understanding 1.B: Organisms are linked by lines of descent from
Gene Pool Genetic Drift Geographic Isolation Fitness Hardy-Weinberg Equilibrium Natural Selection
CONCEPT 1 EVOLUTION 1. Natural Selection a. Major mechanism of change over time Darwin s theory of evolution b. There is variation among phenotypes genetic mutations play a role in increasing variation
Biologists have used many approaches to estimating the evolutionary history of organisms and using that history to construct classifications.
Phylogenetic Inference Biologists have used many approaches to estimating the evolutionary history of organisms and using that history to construct classifications. Willi Hennig developed d the techniques
Chapter 16: Reconstructing and Using Phylogenies
Chapter Review 1. Use the phylogenetic tree shown at the right to complete the following. a. Explain how many clades are indicated: Three: (1) chimpanzee/human, (2) chimpanzee/ human/gorilla, and (3)chimpanzee/human/
Reconstructing the history of lineages
Reconstructing the history of lineages Class outline Systematics Phylogenetic systematics Phylogenetic trees and maps Class outline Definitions Systematics Phylogenetic systematics/cladistics Systematics
Chapter 27: Evolutionary Genetics
Chapter 27: Evolutionary Genetics Student Learning Objectives Upon completion of this chapter you should be able to: 1. Understand what the term species means to biology. 2. Recognize the various patterns
The practice of naming and classifying organisms is called taxonomy.
Chapter 18 Key Idea: Biologists use taxonomic systems to organize their knowledge of organisms. These systems attempt to provide consistent ways to name and categorize organisms. The practice of naming
History of Biological Diversity. Evolution: Darwin s travel
History of Biological Diversity Evolution: Darwin s travel Developing the Theory of Evolution The Galápagos Islands Darwin noticed that the different islands all seemed to have their own, slightly different
Phylogeny and Systematics
Chapter 25 Phylogeny and Systematics PowerPoint Lectures for Biology, Seventh Edition Neil Campbell and Jane Reece Lectures by Chris Romero Modified by Maria Morlin racing phylogeny Phylogeny: he evolutionary
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.
!! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory
BIOINFORMATICS LAB AP BIOLOGY
BIOINFORMATICS LAB AP BIOLOGY Bioinformatics is the science of collecting and analyzing complex biological data. Bioinformatics combines computer science, statistics and biology to allow scientists to
Anatomy of a tree. clade is group of organisms with a shared ancestor. a monophyletic group shares a single common ancestor = tapirs-rhinos-horses
Anatomy of a tree outgroup: an early branching relative of the interest groups sister taxa: taxa derived from the same recent ancestor polytomy: >2 taxa emerge from a node Anatomy of a tree clade is group
Phylogeny & Systematics: The Tree of Life
Phylogeny & Systematics: The Tree of Life An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics has revealed that despite appearances
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
Fig. 26.7a. Biodiversity. 1. Course Outline Outcomes Instructors Text Grading. 2. Course Syllabus. Fig. 26.7b Table
Fig. 26.7a Biodiversity 1. Course Outline Outcomes Instructors Text Grading 2. Course Syllabus Fig. 26.7b Table 26.2-1 1 Table 26.2-2 Outline: Systematics and the Phylogenetic Revolution I. Naming and
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
Outline. Classification of Living Things
Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics
CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
Biology. Slide 1 of 24. End Show. Copyright Pearson Prentice Hall
Biology 1 of 24 18-2 Modern Evolutionary Classification 2 of 24 18-2 Modern Evolutionary Classification Evolutionary Classification Evolutionary Classification Phylogeny is the study of evolutionary relationships
Phylogeny and the Tree of Life
LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 26 Phylogeny and the Tree of Life
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
Skulls & Evolution. Procedure In this lab, groups at the same table will work together.
Skulls & Evolution Objectives To illustrate trends in the evolution of humans. To demonstrate what you can learn from bones & fossils. To show the adaptations of various mammals to different habitats and
How should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
Classification, Phylogeny yand Evolutionary History
Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize
Modern Evolutionary Classification. Section 18-2 pgs
Modern Evolutionary Classification Section 18-2 pgs 451-455 Modern Evolutionary Classification In a sense, organisms determine who belongs to their species by choosing with whom they will mate. Taxonomic
In a way, organisms determine who belongs to their species by choosing with whom they will! MODERN EVOLUTIONARY CLASSIFICATION 18-2 MATE
MODERN EVOLUTIONARY CLASSIFICATION 18-2 In a way, organisms determine who belongs to their species by choosing with whom they will! MATE Taxonomic groups are invented by scientists to group organisms with
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
The Theory of Evolution
The Theory of Evolution Matthew Ferry Evolution The process by which different kinds of living organisms are thought to have developed and diversified from earlier forms during the history of the Earth.
Piecing It Together. 1) The envelope contains puzzle pieces for 5 vertebrate embryos in 3 different stages of
Piecing It Together 1) The envelope contains puzzle pieces for 5 vertebrate embryos in 3 different stages of development. Lay out the pieces so that you have matched up each animal name card with its 3
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
Big Idea #1: The process of evolution drives the diversity and unity of life
BIG IDEA! Big Idea #1: The process of evolution drives the diversity and unity of life Key Terms for this section: emigration phenotype adaptation evolution phylogenetic tree adaptive radiation fertility
"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
PHYLOGENY & THE TREE OF LIFE
PHYLOGENY & THE TREE OF LIFE PREFACE In this powerpoint we learn how biologists distinguish and categorize the millions of species on earth. Early we looked at the process of evolution here we look at
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them?
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Carolus Linneaus:Systema Naturae (1735) Swedish botanist &
AP Biology Notes Outline Enduring Understanding 1.B. Big Idea 1: The process of evolution drives the diversity and unity of life.
AP Biology Notes Outline Enduring Understanding 1.B Big Idea 1: The process of evolution drives the diversity and unity of life. Enduring Understanding 1.B: Organisms are linked by lines of descent from
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Lecture Outline Overview: Investigating the Tree of Life Evolutionary biology is about both process and pattern. o The processes of evolution are natural selection
Chapter 26. Phylogeny and the Tree of Life. Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Pearson Education, Inc.
Chapter 26 Phylogeny and the Tree of Life Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Investigating the Tree of Life Phylogeny is the evolutionary history of a species or group of
Introduction to characters and parsimony analysis
Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect
AP Biology. Cladistics
Cladistics Kingdom Summary Review slide Review slide Classification Old 5 Kingdom system Eukaryote Monera, Protists, Plants, Fungi, Animals New 3 Domain system reflects a greater understanding of evolution
Topic 7: Evolution. 1. The graph below represents the populations of two different species in an ecosystem over a period of several years.
1. The graph below represents the populations of two different species in an ecosystem over a period of several years. Which statement is a possible explanation for the changes shown? (1) Species A is
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
Biology 2. Lecture Material. For. Macroevolution. Systematics
Biology 2 Macroevolution & Systematics 1 Biology 2 Lecture Material For Macroevolution & Systematics Biology 2 Macroevolution & Systematics 2 Microevolution: Biological Species: Two Patterns of Evolutionary
CLASSIFICATION NOTES
CLASSIFICATION NOTES Classification Classification = arrangement of living things into groups according to their observed similarities. Important because it allows us to be able to study life easier Living
Chapter 17A. Table of Contents. Section 1 Categories of Biological Classification. Section 2 How Biologists Classify Organisms
Classification of Organisms Table of Contents Section 1 Categories of Biological Classification Section 1 Categories of Biological Classification Classification Section 1 Categories of Biological Classification
Chapter 15 Open Note Quiz Concepts 2 nd Period
Chapter 15 Open Note Quiz Concepts 2 nd Period 1.) Please describe the difference between a homologous structure and an analogous structure. Homologous Structure = Same bone structure, different function
The Theory of Universal Common Ancestry suggests that organisms on Earth evolved from a single common ancestor.
Common Ancestry Key Concept The Theory of Universal Common Ancestry suggests that organisms on Earth evolved from a single common ancestor. Scientists construct diagrams & charts to show how seemingly
1. Construct and use dichotomous keys to identify organisms.
OBJECTIVE SHEET SYSTEMATICS AND CLASSIFICATION 1. Construct and use dichotomous keys to identify organisms. 2. Clarify the purpose behind systematics and phylogeny. 3. Identify the structures of a phylogenetic
Chapter 7: Covalent Structure of Proteins. Voet & Voet: Pages ,
Chapter 7: Covalent Structure of Proteins Voet & Voet: Pages 163-164, 185-194 Slide 1 Structure & Function Function is best understood in terms of structure Four levels of structure that apply to proteins
The Classification of Plants and Other Organisms. Chapter 18
The Classification of Plants and Other Organisms Chapter 18 LEARNING OBJECTIVE 1 Define taxonomy Explain why the assignment of a scientific name to each species is important for biologists KEY TERMS TAXONOMY
How related are organisms?
The Evolution and Classification of Species Darwin argued for adaptive radiation in which demes spread out in a given environment and evolved How related are organisms? Taonomy the science of classifying
Evidence for Evolution
Evidence for Evolution Evolution Biological evolution is descent with modification. It is important to remember that: Humans did not evolve from chimpanzees. Humans and chimpanzees are evolutionary cousins
Evolution Review. 1. Which evolutionary concept is best illustrated by the cartoon below?
Evolution Review 1. Which evolutionary concept is best illustrated by the cartoon below? 3. The diagram below shows the evolutionary relationships between several groups of organisms. 1) production of
Mechanisms of Evolution Darwinian Evolution
Mechanisms of Evolution Darwinian Evolution Descent with modification by means of natural selection All life has descended from a common ancestor The mechanism of modification is natural selection Concept
Using Bioinformatics to Study Evolutionary Relationships Instructions
3 Using Bioinformatics to Study Evolutionary Relationships Instructions Student Researcher Background: Making and Using Multiple Sequence Alignments One of the primary tasks of genetic researchers is comparing
The Tree of Life. Phylogeny
The Tree of Life Phylogeny Phylogenetics Phylogenetic trees illustrate the evolutionary relationships among groups of organisms, or among a family of related nucleic acid or protein sequences Each branch
Since Darwin s work, every scientific test has supported Darwin s basic ideas about evolution
Guided Reading Answers Since Darwin s work, every scientific test has supported Darwin s basic ideas about evolution Biogeography Biogeography is the study of where organisms live now, and where they and
Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family
Review: Gene Families Gene Families part 2 03 327/727 Lecture 8 What is a Case study: ian globin genes Gene trees and how they differ from species trees Homology, orthology, and paralogy Last tuesday 1
I Can Statement Conversation/Assignment
I Can Statement Conversation/Assignment B- 5.5 Exemplify scientific evidence in the fields of anatomy, embryology, biochemistry, and paleontology that underlies the theory of biological evolution B- 5.6
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
Evidence of Evolution by Natural Selection. Dodo bird
Evidence of Evolution by Natural Selection Dodo bird 2007-2008 Evidence supporting evolution Fossil record transition species Anatomical record homologous & vestigial structures embryology & development
Chapter 17. Organizing Life's Diversity
Chapter 17 Organizing Life's Diversity Key Concepts: Chapter 17 1. List the 3 domains and the 6 kingdoms. 2. Our current system of classification was originally based on structures; scientists now base
Phylogeny is the evolutionary history of a group of organisms. Based on the idea that organisms are related by evolution
Bio 1M: Phylogeny and the history of life 1 Phylogeny S25.1; Bioskill 11 (2ndEd S27.1; Bioskills 3) Bioskills are in the back of your book Phylogeny is the evolutionary history of a group of organisms
Name 14 The Origin of Species Test Date Study Guide You must know: The difference between microevolution and macroevolution. The biological concept
Name _ 14 The Origin of Species Test Date Study Guide You must know: The difference between microevolution and macroevolution. The biological concept of species Prezygotic and postzygotic barriers that