DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi
|
|
- Jeffery Nash
- 2 years ago
- Views:
Transcription
1 DNA Phylogeny Signals and Systems in Biology Kushal EE, IIT Delhi
2 Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics : Methods to determine phylogeny
3 Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics : Methods to determine phylogeny
4 Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics : Methods to determine phylogeny
5 Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics : Methods to determine phylogeny
6 Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics : Methods to determine phylogeny
7 Tree showing evolutionary relationships between various species Taxa joined if they are believed to have a common ancestor
8 Phylogenetic Tree : Rooted and Unrooted
9 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
10 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
11 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
12 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
13 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
14 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
15 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
16 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
17 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
18 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
19 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
20 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
21 Methods of Phylogenetic Analysis Morphological Analysis Average body size Lengths or sizes of specific physical features Certain kinds of behaviour Comparison of RNA sequences : 18S ribosomal RNA Computational Analysis Compute distance matrix Alignment based and Alignment-Free Methods Generate phylogenetic tree based on this matrix Neighbor joining Fitch-Margoliash method Using independent information Maximum Parsimony
22 Neighbor Joining (NJ)
23 Maximum Parsimony Number of evolutionary events necessary to explain the observed differences Every evolutionary event has an associated cost Locate a tree with the minimum cost Not every event is equally likely NP-hard problem!! Heuristic search methods for the cheapest tree
24 Maximum Parsimony Number of evolutionary events necessary to explain the observed differences Every evolutionary event has an associated cost Locate a tree with the minimum cost Not every event is equally likely NP-hard problem!! Heuristic search methods for the cheapest tree
25 Maximum Parsimony Number of evolutionary events necessary to explain the observed differences Every evolutionary event has an associated cost Locate a tree with the minimum cost Not every event is equally likely NP-hard problem!! Heuristic search methods for the cheapest tree
26 Maximum Parsimony Number of evolutionary events necessary to explain the observed differences Every evolutionary event has an associated cost Locate a tree with the minimum cost Not every event is equally likely NP-hard problem!! Heuristic search methods for the cheapest tree
27 Maximum Parsimony Number of evolutionary events necessary to explain the observed differences Every evolutionary event has an associated cost Locate a tree with the minimum cost Not every event is equally likely NP-hard problem!! Heuristic search methods for the cheapest tree
28 Maximum Parsimony Number of evolutionary events necessary to explain the observed differences Every evolutionary event has an associated cost Locate a tree with the minimum cost Not every event is equally likely NP-hard problem!! Heuristic search methods for the cheapest tree
29 Maximum Parsimony Number of evolutionary events necessary to explain the observed differences Every evolutionary event has an associated cost Locate a tree with the minimum cost Not every event is equally likely NP-hard problem!! Heuristic search methods for the cheapest tree
30 Genetic Distance X,Y : Two populations for which L loci have been sampled X u,y u : Frequency of uth allele at the lth location Nei s method : D a = l u X u Y u ln ( l u X 2 u )( l u Y 2 u ) ( Cavalli-Sforza chord measure : D CH = 2 2 π L l ) X u Y u u
31 Genetic Distance X,Y : Two populations for which L loci have been sampled X u,y u : Frequency of uth allele at the lth location Nei s method : D a = l u X u Y u ln ( l u X 2 u )( l u Y 2 u ) Cavalli-Sforza chord measure : ( D CH = 2 2 π L l ) X u Y u u
32 Genetic Distance X,Y : Two populations for which L loci have been sampled X u,y u : Frequency of uth allele at the lth location Nei s method : D a = l u X u Y u ln ( l u X 2 u )( l u Y 2 u ) ( Cavalli-Sforza chord measure : D CH = 2 2 π L l ) X u Y u u
33 Genetic Distance : Information ( ) K (x) K x y d (x,y) = 1 K (xy) K ( ) : Kolmogorov Complexity d (x,y) satisfies triangle inequality d (x,y) d (y,x) : non-trivial proof M. Li et. al., Bioinformatics 2001
34 Genetic Distance : Information ( ) K (x) K x y d (x,y) = 1 K (xy) K ( ) : Kolmogorov Complexity d (x,y) satisfies triangle inequality d (x,y) d (y,x) : non-trivial proof M. Li et. al., Bioinformatics 2001
35 Genetic Distance : Information ( ) K (x) K x y d (x,y) = 1 K (xy) K ( ) : Kolmogorov Complexity d (x,y) satisfies triangle inequality d (x,y) d (y,x) : non-trivial proof M. Li et. al., Bioinformatics 2001
36 Genetic Distance : Correlation Based I (k) = p (k) p (k) (i,j) (i,j) log 4 p (i)p (j) i,j S S = {A,T,G,C} M. Dehnert et. al., J. Computational Biology 2005
Phylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
Algorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,
Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837
Phylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
Consistency Index (CI)
Consistency Index (CI) minimum number of changes divided by the number required on the tree. CI=1 if there is no homoplasy negatively correlated with the number of species sampled Retention Index (RI)
Phylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
Phylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
Theory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
EVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
Theory of Evolution. Charles Darwin
Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
Phylogenetic Analysis and Intraspeci c Variation : Performance of Parsimony, Likelihood, and Distance Methods
Syst. Biol. 47(2): 228± 23, 1998 Phylogenetic Analysis and Intraspeci c Variation : Performance of Parsimony, Likelihood, and Distance Methods JOHN J. WIENS1 AND MARIA R. SERVEDIO2 1Section of Amphibians
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.
!! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory
"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony
ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction
9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1. Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1 Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003 Lecturer: Wing-Kin Sung Scribe: Ning K., Shan T., Xiang
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
Evolutionary Trees. Evolutionary tree. To describe the evolutionary relationship among species A 3 A 2 A 4. R.C.T. Lee and Chin Lung Lu
Evolutionary Trees R.C.T. Lee and Chin Lung Lu CS 5313 Algorithms for Molecular Biology Evolutionary Trees p.1 Evolutionary tree To describe the evolutionary relationship among species Root A 3 Bifurcating
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
Phylogenetic inference: from sequences to trees
W ESTFÄLISCHE W ESTFÄLISCHE W ILHELMS -U NIVERSITÄT NIVERSITÄT WILHELMS-U ÜNSTER MM ÜNSTER VOLUTIONARY FUNCTIONAL UNCTIONAL GENOMICS ENOMICS EVOLUTIONARY Bioinformatics 1 Phylogenetic inference: from sequences
Introduction to characters and parsimony analysis
Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect
Estimating Phylogenies (Evolutionary Trees) II. Biol4230 Thurs, March 2, 2017 Bill Pearson Jordan 6-057
Estimating Phylogenies (Evolutionary Trees) II Biol4230 Thurs, March 2, 2017 Bill Pearson wrp@virginia.edu 4-2818 Jordan 6-057 Tree estimation strategies: Parsimony?no model, simply count minimum number
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
Phylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
Lecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches
Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Effects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
Phylogeny Tree Algorithms
Phylogeny Tree lgorithms Jianlin heng, PhD School of Electrical Engineering and omputer Science University of entral Florida 2006 Free for academic use. opyright @ Jianlin heng & original sources for some
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
Outline. Classification of Living Things
Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics
CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS. Masatoshi Nei"
MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS Masatoshi Nei" Abstract: Phylogenetic trees: Recent advances in statistical methods for phylogenetic reconstruction and genetic diversity analysis were
Phylogeny: traditional and Bayesian approaches
Phylogeny: traditional and Bayesian approaches 5-Feb-2014 DEKM book Notes from Dr. B. John Holder and Lewis, Nature Reviews Genetics 4, 275-284, 2003 1 Phylogeny A graph depicting the ancestor-descendent
AN ALTERNATING LEAST SQUARES APPROACH TO INFERRING PHYLOGENIES FROM PAIRWISE DISTANCES
Syst. Biol. 46(l):11-lll / 1997 AN ALTERNATING LEAST SQUARES APPROACH TO INFERRING PHYLOGENIES FROM PAIRWISE DISTANCES JOSEPH FELSENSTEIN Department of Genetics, University of Washington, Box 35736, Seattle,
Biological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor
Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
Chapter 19: Taxonomy, Systematics, and Phylogeny
Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand
Plan: Evolutionary trees, characters. Perfect phylogeny Methods: NJ, parsimony, max likelihood, Quartet method
Phylogeny 1 Plan: Phylogeny is an important subject. We have 2.5 hours. So I will teach all the concepts via one example of a chain letter evolution. The concepts we will discuss include: Evolutionary
The practice of naming and classifying organisms is called taxonomy.
Chapter 18 Key Idea: Biologists use taxonomic systems to organize their knowledge of organisms. These systems attempt to provide consistent ways to name and categorize organisms. The practice of naming
Building Phylogenetic Trees UPGMA & NJ
uilding Phylogenetic Trees UPGM & NJ UPGM UPGM Unweighted Pair-Group Method with rithmetic mean Unweighted = all pairwise distances contribute equally. Pair-Group = groups are combined in pairs. rithmetic
Taxonomy. Content. How to determine & classify a species. Phylogeny and evolution
Taxonomy Content Why Taxonomy? How to determine & classify a species Domains versus Kingdoms Phylogeny and evolution Why Taxonomy? Classification Arrangement in groups or taxa (taxon = group) Nomenclature
Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
Seuqence Analysis '17--lecture 10. Trees types of trees Newick notation UPGMA Fitch Margoliash Distance vs Parsimony
Seuqence nalysis '17--lecture 10 Trees types of trees Newick notation UPGM Fitch Margoliash istance vs Parsimony Phyogenetic trees What is a phylogenetic tree? model of evolutionary relationships -- common
Lecture 1 Hardy-Weinberg equilibrium and key forces affecting gene frequency
Lecture 1 Hardy-Weinberg equilibrium and key forces affecting gene frequency Bruce Walsh lecture notes Introduction to Quantitative Genetics SISG, Seattle 16 18 July 2018 1 Outline Genetics of complex
Introduction to Bioinformatics Introduction to Bioinformatics
Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence
Week 5: Distance methods, DNA and protein models
Week 5: Distance methods, DNA and protein models Genome 570 February, 2016 Week 5: Distance methods, DNA and protein models p.1/69 A tree and the expected distances it predicts E A 0.08 0.05 0.06 0.03
ON THE UNIQUENESS OF BALANCED MINIMUM EVOLUTION
ON THE UNIQUENESS OF LNE MINIMUM EVOLUTION RON KLEINMN ecember 3, 20 bstract. Minimum evolution is a class of parsimonious distance-based phylogenetic reconstruction methods. One noteworthy example is
Phylogenetics: Parsimony
1 Phylogenetics: Parsimony COMP 571 Luay Nakhleh, Rice University he Problem 2 Input: Multiple alignment of a set S of sequences Output: ree leaf-labeled with S Assumptions Characters are mutually independent
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
(Stevens 1991) 1. morphological characters should be assumed to be quantitative unless demonstrated otherwise
Bot 421/521 PHYLOGENETIC ANALYSIS I. Origins A. Hennig 1950 (German edition) Phylogenetic Systematics 1966 B. Zimmerman (Germany, 1930 s) C. Wagner (Michigan, 1920-2000) II. Characters and character states
Inferring phylogeny. Today s topics. Milestones of molecular evolution studies Contributions to molecular evolution
Today s topics Inferring phylogeny Introduction! Distance methods! Parsimony method!"#$%&'(!)* +,-.'/01!23454(6!7!2845*0&4'9#6!:&454(6 ;?@AB=C?DEF Overview of phylogenetic inferences Methodology Methods
Historical Biogeography. Historical Biogeography. Systematics
Historical Biogeography I. Definitions II. Fossils: problems with fossil record why fossils are important III. Phylogeny IV. Phenetics VI. Phylogenetic Classification Disjunctions debunked: Examples VII.
A fuzzy weighted least squares approach to construct phylogenetic network among subfamilies of grass species
Journal of Applied Mathematics & Bioinformatics, vol.3, no.2, 2013, 137-158 ISSN: 1792-6602 (print), 1792-6939 (online) Scienpress Ltd, 2013 A fuzzy weighted least squares approach to construct phylogenetic
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr
Page 1. Evolutionary Trees. Why build evolutionary tree? Outline
Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny
CSCI1950 Z Computa4onal Methods for Biology Lecture 5
CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC
SPECIATION. REPRODUCTIVE BARRIERS PREZYGOTIC: Barriers that prevent fertilization. Habitat isolation Populations can t get together
SPECIATION Origin of new species=speciation -Process by which one species splits into two or more species, accounts for both the unity and diversity of life SPECIES BIOLOGICAL CONCEPT Population or groups
InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
Processes of Evolution
15 Processes of Evolution Forces of Evolution Concept 15.4 Selection Can Be Stabilizing, Directional, or Disruptive Natural selection can act on quantitative traits in three ways: Stabilizing selection
Lecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega
BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
Molecular evidence for multiple origins of Insectivora and for a new order of endemic African insectivore mammals
Project Report Molecular evidence for multiple origins of Insectivora and for a new order of endemic African insectivore mammals By Shubhra Gupta CBS 598 Phylogenetic Biology and Analysis Life Science
A Fitness Distance Correlation Measure for Evolutionary Trees
A Fitness Distance Correlation Measure for Evolutionary Trees Hyun Jung Park 1, and Tiffani L. Williams 2 1 Department of Computer Science, Rice University hp6@cs.rice.edu 2 Department of Computer Science
Bioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço jcarrico@fm.ul.pt Charles Darwin (1809-1882) Charles Darwin s tree of life in Notebook B, 1837-1838 Ernst Haeckel (1934-1919)
CS 394C Algorithms for Computational Biology. Tandy Warnow Spring 2012
CS 394C Algorithms for Computational Biology Tandy Warnow Spring 2012 Biology: 21st Century Science! When the human genome was sequenced seven years ago, scientists knew that most of the major scientific
How to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
Chapter 19 Organizing Information About Species: Taxonomy and Cladistics
Chapter 19 Organizing Information About Species: Taxonomy and Cladistics An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics
Comparative Bioinformatics Midterm II Fall 2004
Comparative Bioinformatics Midterm II Fall 2004 Objective Answer, part I: For each of the following, select the single best answer or completion of the phrase. (3 points each) 1. Deinococcus radiodurans
Evolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
Phylogenetic Networks, Trees, and Clusters
Phylogenetic Networks, Trees, and Clusters Luay Nakhleh 1 and Li-San Wang 2 1 Department of Computer Science Rice University Houston, TX 77005, USA nakhleh@cs.rice.edu 2 Department of Biology University
Evolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
A (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
Additive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive.
Additive distances Let T be a tree on leaf set S and let w : E R + be an edge-weighting of T, and assume T has no nodes of degree two. Let D ij = e P ij w(e), where P ij is the path in T from i to j. Then
Zhongyi Xiao. Correlation. In probability theory and statistics, correlation indicates the
Character Correlation Zhongyi Xiao Correlation In probability theory and statistics, correlation indicates the strength and direction of a linear relationship between two random variables. In general statistical
Letter to the Editor. Department of Biology, Arizona State University
Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
Tree Building Activity
Tree Building Activity Introduction In this activity, you will construct phylogenetic trees using a phenotypic similarity (cartoon microbe pictures) and genotypic similarity (real microbe sequences). For
THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them?
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Carolus Linneaus:Systema Naturae (1735) Swedish botanist &
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
Estimating Evolutionary Trees. Phylogenetic Methods
Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent
Module 13: Molecular Phylogenetics
Module 13: Molecular Phylogenetics http://evolution.gs.washington.edu/sisg/2013/ MTH Thanks to Paul Lewis, Joe Felsenstein, Peter Beerli, Derrick Zwickl, and Joe Bielawski for slides Wednesday July 17:
The Phylogenetic Handbook
The Phylogenetic Handbook A Practical Approach to DNA and Protein Phylogeny Edited by Marco Salemi University of California, Irvine and Katholieke Universiteit Leuven, Belgium and Anne-Mieke Vandamme Rega
Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying