Plan: Evolutionary trees, characters. Perfect phylogeny Methods: NJ, parsimony, max likelihood, Quartet method
|
|
- Ella Sparks
- 2 years ago
- Views:
Transcription
1 Phylogeny 1
2 Plan: Phylogeny is an important subject. We have 2.5 hours. So I will teach all the concepts via one example of a chain letter evolution. The concepts we will discuss include: Evolutionary trees, characters. Perfect phylogeny Methods: NJ, parsimony, max likelihood, Quartet method 2
3 In 1997, on a Hong Kong mountain, the story begins Charles H. Bennett Ming Li Lion Rock 3
4 Chain letters old style Charles Bennett collected 33 copies of chain letters that were apparently from the same origin during How does it work? Make 20 copies and send to your friends. Yes some good things will happen No some bad things will happen. 4
5 A sample letter: 5
6 Chain letters old style These letters are different but appear to have the same origin. We were interested in reconstructing the evolutionary history of these chain letters. Because these chain letters are readable, they provide a perfect tool for classroom teaching of phylogeny methods and test for such methods. Scientific American: Jun C. Bennett, M. Li, B. Ma: Chain Letters & Evolutionary Histories 6
7 A faded-out letter reveals evolutionary path: ((copy)*mutate)* 7
8 Why bother with chain letters? Like a virus, it has reached billions of people, literally. Like a gene, they are about 2000 characters; It even resembles some subtle phenomenon in biological evolution! 8
9 Coevolution Life wife His her 9
10 Using a collection of over 600 dated paper chain letters, we have identified types and variations that appear and disappear over the years. Unexpectedly, it was discovered that, repeatedly, a single letter bearing some new innovation will propagate so abundantly and rapidly that within just a few years its descendants replace all similarly motivated letters in our collection. CHAIN LETTER EVOLUTION by Daniel W. VanArsdale 10
11 Methods for constructing phylogeny Parsimony Method: Find a tree topology so that the total number of mutations on the edges is the smallest. Perfect Phylogeny. Maximum Likelihood. Distance Based Method UPGMA Neighbour Joining Quartet Method Whole Genome Phylogeny. (Solving Chain Letter) 11
12 Methods for constructing phylogeny Parsimony Method: Find a tree topology so that the total number of mutations on the edges is the smallest. Perfect Phylogeny. Maximum Likelihood. Distance Based Method UPGMA Neighbour Joining Quartet Method Whole Genome Phylogeny. 12
13 Basis A taxon is is a group of one (or more) populations of organism(s), which a taxonomist adjudges to be a unit. E.g. human, primate, mammal A taxon can be assigned a rank, usually (but not necessarily) when it is given a formal name. The hierarchy of biological classification's eight major taxonomic ranks 13
14 Basics A character is a feature in the species. Vertebrate / invertebrate Has hooves / does not. A DNA mutation. The title is Trust in lord or With love all things are possible. An evolutionary tree is a rooted and leaf-labeled binary tree. 14
15 The form we ll have: More details Input: An n x m matrix of aligned characters. (n taxa, m characters) In the case of a multiple alignment, these are columns with no gaps. 15
16 Example: Suppose we have four taxa: W: AAAA X: AGGA Y: ATGA Z: TTAT 3 trees on 4 taxa: W Y X Z W X Y Z Which is most parsimonious? W Z X Y 16
17 Parsimony example ATAA ATGA AAAA TTAT AGGA ATGA W Z X Y In this case, we need 5 mutations. The other 2 require 6. So the most parsimonious tree joins W and Z on one side and X and Y on the other. Where is the root of the tree? 17
18 Ancestor Reconstruction For a given topology, how to construct the ancestors? First observation: We can solve each column separately. So we can just solve for 1-character strings. Algorithm by Sankoff: tree-based dynamic programming. 18
19 Tree DP, details For every node u of the tree and letter a of the alphabet Σ, let D[u, a] = min # of mutations in T u if u s label is a. Let r be the root. We want min x D[r,x]. For a leaf node v, if the character at leaf v is a, then D[v,a] = 0, and D(v, b) = 1 for all other letters b. For an internal node u, with children v and w, suppose we know all of the values of D[v, *] and D[w,*]. How to compute D[u,*]? 19
20 Tree DP details (end) v If we put letter a at node u, the cost of the left half of the tree is the minimum of Case 1. D[v,a] Case min b a D[v,b] The same argument holds for the right half. So D[u,a] = min (D[v,a], 1 + min b a D[v,b]) + min (D[w,a], 1 + min b a D[w,b]). Time complexity? u w 20
21 Total runtime We can ignore b a and minimize on all b without changing the value. Note: min b D[v,b] only needs to be computed once, not once every letter a for min b a D[v,b]. If the tree is binary, and the size of the alphabet is σ, this algorithm takes O(nσ) time, since it s just O(σ) time at each node What if mutations have a cost, so going from a b costs f(a,b)? (Assume always non-negative ) That s easy: D[u,a] = min b (f(b,a) + D[v,b]) + min b (f(b,a) + D(w,b)). Same argument as before, but now it takes O(σ 2 n) time. 21
22 Parsimony Parsimony Method: Find a tree topology so that the total number of mutations on the edges is the smallest. NP-hard. Algorithm: For each possible tree topology, uses DP to compute cost. Output the best tree. Suppose there are f (n) trees on n taxa. Total runtime: O(nmσf (n)). Unfortunately, f (n) is huge: it s 1*3* *(2n-5). (Roughly n!2 n or so) Parsimony is NP hard. 22
23 Methods for constructing phylogeny Parsimony Method: Find a tree topology so that the total number of mutations on the edges is the smallest. Perfect Phylogeny. Maximum Likelihood. Distance Based Method UPGMA Neighbour Joining Quartet Method Whole Genome Phylogeny. 23
24 Perfect Phylogeny A perfect phylogeny is such that for every character (every column), all species with the same state of that character is a connected component on the tree. AC AT AT YES C T AT AT GT T YES T T G C T?? NO T C 24
25 Algorithm for Binary Case Start with a set of all taxa. Find a character and split the set into two. Recursion until each set has only one taxonomy. a d e 25
26 Perfect Phylogeny Theorem: If there is a perfect phylogeny for the input, and there are constant number of states for the characters, then a perfect phylogeny can be computed in polynomial time. r states, n taxa, m characters: O(2 2r nm 2 ). 26
27 Important Fact Perfect phylogeny is the best you can get for parsimony. If a column has k different states, then it only contributes cost k-1 in a perfect phylogeny tree. 27
28 Practical Algorithms for Parsimony Two practical techniques: Branch-and-bound and local search. These are two common techniques for many NPhard problems. So remember the idea. Just like dynamic programming can be used in many problems too. 28
29 Branch-and-bound approach Idea by example: We exhaustively search all the trees by adding one taxon a time. Suppose we are working on 7 taxa (A G), and we already know this tree exists: Then if a new tree structure on only A E that requires at least 28 mutations for those 5 taxa, adding F and G anywhere is a waste of time, since things only get worse. This allows us to avoid looking at all trees. 4 (Total cost: 25) 29
30 Local improvement method Start with one reasonably decent tree. Create a graph on trees, where two trees are adjacent if a simple local change from one turns it into the other. (Examples: pull one taxon out of one tree and paste it into all possible other places. Or unroot one subtree and place it anywhere on what remains.) Keep doing this until no improvement can be achieved. This is not guaranteed to converge to a global optimum, just a local one. But it is used often. 30
31 Methods for constructing phylogeny Parsimony Method: Find a tree topology so that the total number of mutations on the edges is the smallest. Perfect Phylogeny. Maximum Likelihood. Distance Based Method UPGMA Neighbour Joining Quartet Method Whole Genome Phylogeny. 31
32 Maximum Likelihood T A A A 0.2 T Pr(Labels Tree) =0.2*(1-0.1)*0.2*(1-0.1) = Given a multiple sequence alignment, maximum likelihood method asks for a tree topology, with edge weights, such that the likelihood is maximized. NP-hard. T T T A 0.2 A Pr(Labels Tree) =(1-0.2)*0.1*(1-0.2)*(1-0.1) =
33 More Notes about Maximum Likelihood Multiplying likelihoods of all positions (bases or amino acids) is needed to estimate edge length. Instead of a uniform evolutionary rate for the whole length of the sequence, different sites may have different evolutionary rates. More elaborated models are needed. Instead of using the most probable ancestor sequences, may use sum of all possible ancestor sequences. Need to enumerate all possible tree topologies to find the best one. Very time consuming. 33
34 Distance Based Methods First compute the distances between pairs of taxa. So we have a nxn distance matrix d(i,j). We want to compute a tree with n leaves, with edge weights. T(i,j) is the distance of two leaves on the tree. We want to minimize 2 d(i,j) T ( i, j) This is also NP-hard. 34
35 Methods for constructing phylogeny Parsimony Method: Find a tree topology so that the total number of mutations on the edges is the smallest. Perfect Phylogeny. Maximum Likelihood. Distance Based Method UPGMA Neighbour Joining Quartet Method Whole Genome Phylogeny. 35
36 UPGMA Unweighted Pair Group Method with Arithmetic mean. A heuristic method with no performance guarantee. At each time, it finds i,j with the minimum distance. Merge the two taxa i,j into a new one u. Update the distance matrix. For any k, let: d(u,k) = (d(i,k)+d(j,k))/2. Recursion. 36
37 Neighbor Joining Saitou N, Nei M. The neighbor-joining method: a new method for reconstructing phylogenetic trees. Mol Biol Evol Jul;4(4): Neighbor Joining uses a similar idea as UPGMA. But it uses a more sophisticated formula to determine the two neighbors to be joined. Find the minimum Q(i,j), merge i,j to a new node u. Update d(k,u) = (d(k,i)+d(k,j)-d(i,j))/2. Recursion on the remaining r-1 nodes. More details can be found in Durbin s book. 37
38 Neighbor Joining Idea i k j 38
39 Methods for constructing phylogeny Parsimony Method: Find a tree topology so that the total number of mutations on the edges is the smallest. Perfect Phylogeny. Maximum Likelihood. Distance Based Method UPGMA Neighbour Joining Quartet Method Whole Genome Phylogeny. 39
40 Quartet Methods For each group of four species, construct a tree of 4 (quartet), using your most favorite method, say maximum likelihood. Then find a tree that is most consistent with all the quartets. The problem is NP-hard (to find the tree with least error). There is a PTAS to do this (T. Jiang, P. Kearney, and M. Li. Orchestrating quartets: approximation and data (FOCS'98)) 40
41 Methods for constructing phylogeny Parsimony Method: Find a tree topology so that the total number of mutations on the edges is the smallest. Perfect Phylogeny. Maximum Likelihood. Distance Based Method UPGMA Neighbour Joining Quartet Method Whole Genome Phylogeny 41
42 Challenges in Phylogeny of Chain Letter Parsimony or maximum likelihood: How do we know what is a character a feature to look at? In case of a chain letters? In case of whole genome phylogeny? Distance based: What distance to use? A universal solution -- information distance. 42
43 Information Distance Let x and y be two strings. P be the shortest program that takes x as input and computes y. The length of this shortest program defines K(y x). K is called the Kolmogorov Complexity. The information distance between x and y is defined as d(x,y) = max { K(x y), K(y x)} / max{k(x),k(y)}. Kolmogorov complexity is incomputable, but we can use compression in practice. 43
44 Eutherian Orders: It has been a disputed issue which of the two groups of placental mammals are closer: Primates, Ferungulates, Rodents. Mammal Metatheria Eutheria Platypus Wallaroo Opossum 44
45 Who is our closer relative? Or Rodents Ferungulates Primates Rodents Primates Ferungulates 45
46 Eutherian Orders: It has been a disputed issue which of the two groups of placental mammals are closer: Primates, Ferungulates, Rodents. In mtdna, 6 proteins say primates closer to ferungulates; 6 proteins say primates closer to rodents. Hasegawa s group concatenated 12 mtdna proteins from: rat, house mouse, grey seal, harbor seal, cat, white rhino, horse, finback whale, blue whale, cow, gibbon, gorilla, human, chimpanzee, pygmy chimpanzee, orangutan, sumatran orangutan, with opossum, wallaroo, platypus as out group, 1998, using max likelihood method in MOLPHY. 46
47 Eutherian Orders... Li et al. used complete mtdna genome of exactly the same species. By using a DNA compression program to approximate the Kolmogorov complexity, information distance d(x,y) can be computed. They computed d(x,y) for each pair of species, and used Neighbor Joining in Molphy package (and their own hypercleaning). They constructed exactly the same tree. Confirming Primates and Ferungulates are closer than Rodents. 47
48 Evolutionary Tree of Mammals: 48
49 Reconstructing History of Chain Letters For each pair of chain letters (x, y) we computed d(x,y), hence a distance matrix. A DNA compression program is used to compute the information distance. Using Neighbor Joining / Quartet phylogeny programs to construct their evolutionary history based on the d(x,y) distance matrix. The resulting tree is an almost perfect phylogeny: distinct features are all grouped together. 49
50 Phylogeny of 33 Chain Letters Confirmed by VanArsdale s study, answers an open question 50
51 A universal method Summary I did not know the characters they are only inferred after the tree. I did not have an evolutionary model. Phylogenetic methods: Parsimony Max likelihood UPGMA NJ Quartet (Whole genome phylogeny) 51
Phylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
Evolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
Theory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
Phylogeny: traditional and Bayesian approaches
Phylogeny: traditional and Bayesian approaches 5-Feb-2014 DEKM book Notes from Dr. B. John Holder and Lewis, Nature Reviews Genetics 4, 275-284, 2003 1 Phylogeny A graph depicting the ancestor-descendent
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
EVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
CSCI1950 Z Computa4onal Methods for Biology Lecture 5
CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC
"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
Phylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
Let S be a set of n species. A phylogeny is a rooted tree with n leaves, each of which is uniquely
JOURNAL OF COMPUTATIONAL BIOLOGY Volume 8, Number 1, 2001 Mary Ann Liebert, Inc. Pp. 69 78 Perfect Phylogenetic Networks with Recombination LUSHENG WANG, 1 KAIZHONG ZHANG, 2 and LOUXIN ZHANG 3 ABSTRACT
Theory of Evolution. Charles Darwin
Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1. Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1 Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003 Lecturer: Wing-Kin Sung Scribe: Ning K., Shan T., Xiang
Phylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science
Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.
A Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
Evolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
Phylogenetic inference: from sequences to trees
W ESTFÄLISCHE W ESTFÄLISCHE W ILHELMS -U NIVERSITÄT NIVERSITÄT WILHELMS-U ÜNSTER MM ÜNSTER VOLUTIONARY FUNCTIONAL UNCTIONAL GENOMICS ENOMICS EVOLUTIONARY Bioinformatics 1 Phylogenetic inference: from sequences
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
Page 1. Evolutionary Trees. Why build evolutionary tree? Outline
Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny
Inferring phylogeny. Today s topics. Milestones of molecular evolution studies Contributions to molecular evolution
Today s topics Inferring phylogeny Introduction! Distance methods! Parsimony method!"#$%&'(!)* +,-.'/01!23454(6!7!2845*0&4'9#6!:&454(6 ;?@AB=C?DEF Overview of phylogenetic inferences Methodology Methods
MOLECULAR EVOLUTION AND PHYLOGENETICS SERGEI L KOSAKOVSKY POND CSE/BIMM/BENG 181 MAY 27, 2011
MOLECULAR EVOLUTION AND PHYLOGENETICS If we could observe evolution: speciation, mutation, natural selection and fixation, we might see something like this: AGTAGC GGTGAC AGTAGA CGTAGA AGTAGA A G G C AGTAGA
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
Lecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
Phylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
Biological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor
Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms
part 4: phenomenological load and biological inference. phenomenological load review types of models. Gαβ = 8π Tαβ. Newton.
2017-07-29 part 4: and biological inference review types of models phenomenological Newton F= Gm1m2 r2 mechanistic Einstein Gαβ = 8π Tαβ 1 molecular evolution is process and pattern process pattern MutSel
Evolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies Anatomical features were the dominant
DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi
DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :
Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT
Inferring phylogeny Constructing phylogenetic trees Tõnu Margus Contents What is phylogeny? How/why it is possible to infer it? Representing evolutionary relationships on trees What type questions questions
Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
Bioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
Phylogeny Tree Algorithms
Phylogeny Tree lgorithms Jianlin heng, PhD School of Electrical Engineering and omputer Science University of entral Florida 2006 Free for academic use. opyright @ Jianlin heng & original sources for some
CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny
CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny To trace phylogeny or the evolutionary history of life, biologists use evidence from paleontology, molecular data, comparative
Lecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
Reading for Lecture 13 Release v10
Reading for Lecture 13 Release v10 Christopher Lee November 15, 2011 Contents 1 Evolutionary Trees i 1.1 Evolution as a Markov Process...................................... ii 1.2 Rooted vs. Unrooted Trees........................................
A (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
CSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary
CSCI1950 Z Computa4onal Methods for Biology Lecture 4 Ben Raphael February 2, 2009 hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary Parsimony Probabilis4c Method Input Output Sankoff s & Fitch
Molecular evidence for multiple origins of Insectivora and for a new order of endemic African insectivore mammals
Project Report Molecular evidence for multiple origins of Insectivora and for a new order of endemic African insectivore mammals By Shubhra Gupta CBS 598 Phylogenetic Biology and Analysis Life Science
X X (2) X Pr(X = x θ) (3)
Notes for 848 lecture 6: A ML basis for compatibility and parsimony Notation θ Θ (1) Θ is the space of all possible trees (and model parameters) θ is a point in the parameter space = a particular tree
Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
Phylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
TheDisk-Covering MethodforTree Reconstruction
TheDisk-Covering MethodforTree Reconstruction Daniel Huson PACM, Princeton University Bonn, 1998 1 Copyright (c) 2008 Daniel Huson. Permission is granted to copy, distribute and/or modify this document
C.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
Introduction to Bioinformatics Introduction to Bioinformatics
Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence
Phylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied
Application of new distance matrix to phylogenetic tree construction
Application of new distance matrix to phylogenetic tree construction P.V.Lakshmi Computer Science & Engg Dept GITAM Institute of Technology GITAM University Andhra Pradesh India Allam Appa Rao Jawaharlal
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Inferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies
Inferring Phylogenetic Trees Distance Approaches Representing distances in rooted and unrooted trees The distance approach to phylogenies given: an n n matrix M where M ij is the distance between taxa
Concepts and Methods in Molecular Divergence Time Estimation
Concepts and Methods in Molecular Divergence Time Estimation 26 November 2012 Prashant P. Sharma American Museum of Natural History Overview 1. Why do we date trees? 2. The molecular clock 3. Local clocks
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Effects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
Estimating Evolutionary Trees. Phylogenetic Methods
Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies 1 What is phylogeny? Essay written for the course in Markov Chains 2004 Torbjörn Karfunkel Phylogeny is the evolutionary development
A PARSIMONY APPROACH TO ANALYSIS OF HUMAN SEGMENTAL DUPLICATIONS
A PARSIMONY APPROACH TO ANALYSIS OF HUMAN SEGMENTAL DUPLICATIONS CRYSTAL L. KAHN and BENJAMIN J. RAPHAEL Box 1910, Brown University Department of Computer Science & Center for Computational Molecular Biology
Mul$ple Sequence Alignment Methods. Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu
Mul$ple Sequence Alignment Methods Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu Species Tree Orangutan Gorilla Chimpanzee Human From the Tree of the Life
THE THREE-STATE PERFECT PHYLOGENY PROBLEM REDUCES TO 2-SAT
COMMUNICATIONS IN INFORMATION AND SYSTEMS c 2009 International Press Vol. 9, No. 4, pp. 295-302, 2009 001 THE THREE-STATE PERFECT PHYLOGENY PROBLEM REDUCES TO 2-SAT DAN GUSFIELD AND YUFENG WU Abstract.
Phylogeny. Properties of Trees. Properties of Trees. Trees represent the order of branching only. Phylogeny: Taxon: a unit of classification
Multiple sequence alignment global local Evolutionary tree reconstruction Pairwise sequence alignment (global and local) Substitution matrices Gene Finding Protein structure prediction N structure prediction
Constructing Evolutionary Trees
Constructing Evolutionary Trees 0-0 HIV Evolutionary Tree SIVs (monkeys)! HIV (human)! human infection! human HIV/M human HIV/M chimpanzee SIV chimpanzee SIV human HIV/N human HIV/N chimpanzee SIV chimpanzee
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
Molecular Evolution, course # Final Exam, May 3, 2006
Molecular Evolution, course #27615 Final Exam, May 3, 2006 This exam includes a total of 12 problems on 7 pages (including this cover page). The maximum number of points obtainable is 150, and at least
Estimating Phylogenies (Evolutionary Trees) II. Biol4230 Thurs, March 2, 2017 Bill Pearson Jordan 6-057
Estimating Phylogenies (Evolutionary Trees) II Biol4230 Thurs, March 2, 2017 Bill Pearson wrp@virginia.edu 4-2818 Jordan 6-057 Tree estimation strategies: Parsimony?no model, simply count minimum number
Letter to the Editor. Department of Biology, Arizona State University
Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona
PHYLOGENY AND SYSTEMATICS
AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study
Phylogeny of Mixture Models
Phylogeny of Mixture Models Daniel Štefankovič Department of Computer Science University of Rochester joint work with Eric Vigoda College of Computing Georgia Institute of Technology Outline Introduction
Phylogenetic Networks, Trees, and Clusters
Phylogenetic Networks, Trees, and Clusters Luay Nakhleh 1 and Li-San Wang 2 1 Department of Computer Science Rice University Houston, TX 77005, USA nakhleh@cs.rice.edu 2 Department of Biology University
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
Investigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST
Investigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST Introduction Bioinformatics is a powerful tool which can be used to determine evolutionary relationships and
O 3 O 4 O 5. q 3. q 4. Transition
Hidden Markov Models Hidden Markov models (HMM) were developed in the early part of the 1970 s and at that time mostly applied in the area of computerized speech recognition. They are first described in
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
CLASSIFICATION OF LIVING THINGS. Chapter 18
CLASSIFICATION OF LIVING THINGS Chapter 18 How many species are there? About 1.8 million species have been given scientific names Nearly 2/3 of which are insects 99% of all known animal species are smaller
SUPPLEMENTARY INFORMATION
Supplementary information S3 (box) Methods Methods Genome weighting The currently available collection of archaeal and bacterial genomes has a highly biased distribution of isolates across taxa. For example,
Week 6: Restriction sites, RAPDs, microsatellites, likelihood, hidden Markov models
Week 6: Restriction sites, RAPDs, microsatellites, likelihood, hidden Markov models Genome 570 February, 2012 Week 6: Restriction sites, RAPDs, microsatellites, likelihood, hidden Markov models p.1/63
A Statistical Test of Phylogenies Estimated from Sequence Data
A Statistical Test of Phylogenies Estimated from Sequence Data Wen-Hsiung Li Center for Demographic and Population Genetics, University of Texas A simple approach to testing the significance of the branching
Gel Electrophoresis. 10/28/0310/21/2003 CAP/CGS 5991 Lecture 10Lecture 9 1
Gel Electrophoresis Used to measure the lengths of DNA fragments. When voltage is applied to DNA, different size fragments migrate to different distances (smaller ones travel farther). 10/28/0310/21/2003
Additive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive.
Additive distances Let T be a tree on leaf set S and let w : E R + be an edge-weighting of T, and assume T has no nodes of degree two. Let D ij = e P ij w(e), where P ij is the path in T from i to j. Then
CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes: