Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
|
|
- Vincent Abel McCarthy
- 3 years ago
- Views:
Transcription
1 Phylogenetics: Building Phylogenetic Trees COMP Fall 2010 Luay Nakhleh, Rice University
2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should we use? Which test should we use to assess the robustness of the prediction of particular tree features?
3 Desired Properties of the Data Used in a (Species) Phylogeny Reconstruction As we discussed before, reconstructing a tree that reflects the evolutionary history of a set of species is a hard task, and great care must be taken in the choice of the data used An ideal choice is a genomic region that appears exactly once in every species and whose evolutionary history is identical to that of the species The region should have little, if any, traces of HGT The rate of change in the region should be fast enough to distinguish between closely related species, but not too fast that regions from very distantly related species cannot be reliably aligned
4 Small Ribosomal Subunit rrna The DNA sequence specifying the small ribosomal subunit rrna (called 16S RNA in prokaryotes) has been found to be one of the best genomic segments for this type of analysis, despite occurring in several copies in some genomes We ll later illustrate the reconstruction of the evolutionary history of 38 bacterial species from the Proteobacteria phylum using the 16S RNA sequence
5 Choice of a Method Many computational methods exist for phylogeny reconstruction These can be divided into two categories: distance-based methods and sequence-based methods Distance-based methods first compute pairwise distances from the sequences, and then use these distances to obtain the tree Sequence-based methods use the sequence alignment directly, and usually search the tree space using an optimality criterion that is defined on the columns of the alignment
6 Choice of a Method Examples of distance-based methods include UPGMA (unweighted pairgroup method using arithmetic averages), NJ (neighbor joining), and Fitch-Margoliash Examples of sequence-based approaches include maximum parsimony (MP), maximum likelihood (ML), and Bayesian inference
7 Properties of Methods Method distances? tree type single tree? tree score? tree test? UPGMA yes ultrametric yes no no NJ yes additive yes no no Fitch-Margoliash yes additive yes no no Minimum evolution yes additive no yes yes MP no additive no yes yes ML no additive no yes yes Bayesian no additive no yes yes
8 Choice of a Model of Evolution As we discussed before, the p-distance is usually an underestimate of the true evolutionary distance Therefore, a correction of the p-distance is necessary for phylogenetic methods Models of evolution can be used to derive such distance corrections (we ll see some of the formulas later)
9 Correlation between corrected and uncorrected distances Choice of a Model of Evolution
10 Choice of a Model of Evolution Model Base composition R=1? Identical transitio n rates? Identical transversio n rates? Reference JC 1:1:1:1 no yes yes Jukes and Cantor (1969) F81 variable no yes yes Felsenstein (1981) K2P 1:1:1:1 yes yes yes Kimura (1980) HKY85 variable yes no no Hasegawa et al. (1985) TN variable yes no yes Tamura and Nei (1993) K3P variable yes no yes Kimura (1981) SYM 1:1:1:1 yes no no Zharkikh (1994) GTR variable yes no no Rodriguez et al. (1990)
11 Choice of a Model of Evolution Choosing the evolutionary model is not a simple task One approach to choose a model is to try several of them and select the tree that best fits the data (doesn t work for methods such as NJ that don t provide a way to test goodness of fit) A way of comparing two evolutionary models has been proposed, called the hierarchical likelihood ratio test (hlrt), which can be used when one of the models is contained in the other In this method, both models must be assessed with the same tree topology Using the ML method for each evolutionary model in turn, the tree branch lengths are found that give the highest likelihood of having observed the sequences These two likelihood values can then be compared using hlrt, which is a chi-squared test based on the difference in likelihoods and the differences in numbers of parameters in the two models
12 Choice of a Model of Evolution
13 Choice of a Model of Evolution Two problems with the hlrt test are (1) the requirement that models are nested, and (2) the decision on the order of testing and significance levels to use when deciding among many models Two other tests that have been proposed are: The Akaike information criterion (AIC), which is defined as -2 ln Li + 2pi, where Li is the maximum likelihood value of the optimal tree obtained using model i in a calculation which has pi parameters (including the branch lengths as parameters) The Bayesian information criterion (BIC), which is defined as -2 ln Li + pi ln(n), where N is the size of the data set
14 Choice of a Test of Tree Features One of the most commonly used tests for the reliability of the tree topology is the bootstrap It has been shown, however, that bootstrap values may be conservative The bootstrap measures the degree of support within the data for the particular branch, given the evolutionary model and tree reconstruction method The bootstrap values give no indication of the robustness of these features to changing the model or method
15 Two Examples Phylogenetic analysis of a data set of 38 species of bacteria from the phylum Proteobacteria A gene tree for a superfamily of enzymes
16 Analysis of the Proteobacteria Data Set Data: 16S RNA sequences from all 38 species Using the AIC method, as implemented in MrAIC, the GTR +Gamma was found to be the most appropriate model Using GTR+Gamma, an unrooted ML tree was generated using the tool PHYML
17 Analysis of the Proteobacteria Data Set (A) the unrooted tree (B) the same tree rooted so that the Deltaproteobacteria and Epsilonproteobacteria diverge from the other classes first (C) the same tree rooted using the midpoint method
18 Analysis of the Proteobacteria Data Set UPGMA trees reconstructed from the same 16S RNA data set with JC correction. (A) Alignment columns that have at least one gap are ignored (B) Alignment columns are only ignored when one of the two sequences being compared has a gap
19 Analysis of the Proteobacteria Data Set The condensed tree obtained by a bootstrap analysis of the tree in (A) on the previous slide. Branches with bootstrap values below 75% have been contracted
20 Analysis of the TDP-dependent Enzyme Superfamily An example of a phylogenetic analysis of an enzyme superfamily This analysis would address two important issues: Predicting the function of an enzyme that belongs to the superfamily, by knowing only its sequence Elucidating the evolution of enzyme function within the superfamily
21 Analysis of the TDP-dependent Enzyme Superfamily The cofactor thiamine diphosphate (TDP) superfamily Some of the constituent families also use the cofactor flavin adenine dinucleotide (FAD) Unusually, in some cases, FAD does not participate in the reaction but it must still be bound for the enzyme to be active The selected data set contains enzymes from various families The evolution of the superfamily chosen in this analysis must have involved either the development or loss of an FAD-binding site (or both), possibly on more than one occasion, and a correct reconstruction of the evolutionary history would reveal this
22 Analysis of the TDP-dependent Enzyme Superfamily The NJ tree for the TDP-dependent enzyme superfamily (A) JC correction and (B) K2P correction red squares: proteins whose experimental structure is known and does not contain a bound FAD cofactor green squares: proteins known to bind FAD and use it as an active cofactor orange squares: proteins known to bind FAD but do not use in catalysis
23 Analysis of the TDP-dependent Enzyme Superfamily Analysis of the same data set using the GTR+Gamma+I model and ML
24 Analysis of the TDP-dependent Enzyme Superfamily Rooting the ML tree along the branch that separates the FADbinding and non-fad-binding proteins
Phylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction
Phylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
EVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
Week 5: Distance methods, DNA and protein models
Week 5: Distance methods, DNA and protein models Genome 570 February, 2016 Week 5: Distance methods, DNA and protein models p.1/69 A tree and the expected distances it predicts E A 0.08 0.05 0.06 0.03
Preliminaries. Download PAUP* from: Tuesday, July 19, 16
Preliminaries Download PAUP* from: http://people.sc.fsu.edu/~dswofford/paup_test 1 A model of the Boston T System 1 Idea from Paul Lewis A simpler model? 2 Why do models matter? Model-based methods including
Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki
Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
Maximum Likelihood Tree Estimation. Carrie Tribble IB Feb 2018
Maximum Likelihood Tree Estimation Carrie Tribble IB 200 9 Feb 2018 Outline 1. Tree building process under maximum likelihood 2. Key differences between maximum likelihood and parsimony 3. Some fancy extras
DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi
DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :
Estimating Phylogenies (Evolutionary Trees) II. Biol4230 Thurs, March 2, 2017 Bill Pearson Jordan 6-057
Estimating Phylogenies (Evolutionary Trees) II Biol4230 Thurs, March 2, 2017 Bill Pearson wrp@virginia.edu 4-2818 Jordan 6-057 Tree estimation strategies: Parsimony?no model, simply count minimum number
7. Tests for selection
Sequence analysis and genomics 7. Tests for selection Dr. Katja Nowick Group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute for Brain Research www. nowicklab.info
Evolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
C.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
Additive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive.
Additive distances Let T be a tree on leaf set S and let w : E R + be an edge-weighting of T, and assume T has no nodes of degree two. Let D ij = e P ij w(e), where P ij is the path in T from i to j. Then
Inferring Molecular Phylogeny
Dr. Walter Salzburger he tree of life, ustav Klimt (1907) Inferring Molecular Phylogeny Inferring Molecular Phylogeny 55 Maximum Parsimony (MP): objections long branches I!! B D long branch attraction
Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
Lab 9: Maximum Likelihood and Modeltest
Integrative Biology 200A University of California, Berkeley "PRINCIPLES OF PHYLOGENETICS" Spring 2010 Updated by Nick Matzke Lab 9: Maximum Likelihood and Modeltest In this lab we re going to use PAUP*
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT
Inferring phylogeny Constructing phylogenetic trees Tõnu Margus Contents What is phylogeny? How/why it is possible to infer it? Representing evolutionary relationships on trees What type questions questions
Molecular Evolution, course # Final Exam, May 3, 2006
Molecular Evolution, course #27615 Final Exam, May 3, 2006 This exam includes a total of 12 problems on 7 pages (including this cover page). The maximum number of points obtainable is 150, and at least
林仲彥. Dec 4,
林仲彥 cylin@iis.sinica.edu.tw Dec 4, 2009 http://eln.iis.sinica.edu.tw Coding Characters and Defining Homology Classical phylogenetic analysis by Morphology Molecular phylogenetic analysis By Bio-Molecules
Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
Letter to the Editor. Department of Biology, Arizona State University
Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona
Using models of nucleotide evolution to build phylogenetic trees
Developmental and Comparative Immunology 29 (2005) 211 227 www.elsevier.com/locate/devcompimm Using models of nucleotide evolution to build phylogenetic trees David H. Bos a, *, David Posada b a School
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço jcarrico@fm.ul.pt Charles Darwin (1809-1882) Charles Darwin s tree of life in Notebook B, 1837-1838 Ernst Haeckel (1934-1919)
Maximum Likelihood Until recently the newest method. Popularized by Joseph Felsenstein, Seattle, Washington.
Maximum Likelihood This presentation is based almost entirely on Peter G. Fosters - "The Idiot s Guide to the Zen of Likelihood in a Nutshell in Seven Days for Dummies, Unleashed. http://www.bioinf.org/molsys/data/idiots.pdf
Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis
Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila
Phylogenetic inference: from sequences to trees
W ESTFÄLISCHE W ESTFÄLISCHE W ILHELMS -U NIVERSITÄT NIVERSITÄT WILHELMS-U ÜNSTER MM ÜNSTER VOLUTIONARY FUNCTIONAL UNCTIONAL GENOMICS ENOMICS EVOLUTIONARY Bioinformatics 1 Phylogenetic inference: from sequences
Phylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
Biology 559R: Introduction to Phylogenetic Comparative Methods Topics for this week (Jan 27 & 29):
Biology 559R: Introduction to Phylogenetic Comparative Methods Topics for this week (Jan 27 & 29): Statistical estimation of models of sequence evolution Phylogenetic inference using maximum likelihood:
Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony
ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
Consensus Methods. * You are only responsible for the first two
Consensus Trees * consensus trees reconcile clades from different trees * consensus is a conservative estimate of phylogeny that emphasizes points of agreement * philosophy: agreement among data sets is
Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
Thanks to Paul Lewis and Joe Felsenstein for the use of slides
Thanks to Paul Lewis and Joe Felsenstein for the use of slides Review Hennigian logic reconstructs the tree if we know polarity of characters and there is no homoplasy UPGMA infers a tree from a distance
Bioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
Inferring phylogeny. Today s topics. Milestones of molecular evolution studies Contributions to molecular evolution
Today s topics Inferring phylogeny Introduction! Distance methods! Parsimony method!"#$%&'(!)* +,-.'/01!23454(6!7!2845*0&4'9#6!:&454(6 ;?@AB=C?DEF Overview of phylogenetic inferences Methodology Methods
Theory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
Some of these slides have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!
Some of these slides have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site: http://hydrodictyon.eeb.uconn.edu/people/plewis
Supplementary Information
Supplementary Information For the article"comparable system-level organization of Archaea and ukaryotes" by J. Podani, Z. N. Oltvai, H. Jeong, B. Tombor, A.-L. Barabási, and. Szathmáry (reference numbers
Phylogenetics: Parsimony and Likelihood. COMP Spring 2016 Luay Nakhleh, Rice University
Phylogenetics: Parsimony and Likelihood COMP 571 - Spring 2016 Luay Nakhleh, Rice University The Problem Input: Multiple alignment of a set S of sequences Output: Tree T leaf-labeled with S Assumptions
Phylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
Consistency Index (CI)
Consistency Index (CI) minimum number of changes divided by the number required on the tree. CI=1 if there is no homoplasy negatively correlated with the number of species sampled Retention Index (RI)
A (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
MOLECULAR SYSTEMATICS: A SYNTHESIS OF THE COMMON METHODS AND THE STATE OF KNOWLEDGE
CELLULAR & MOLECULAR BIOLOGY LETTERS http://www.cmbl.org.pl Received: 16 August 2009 Volume 15 (2010) pp 311-341 Final form accepted: 01 March 2010 DOI: 10.2478/s11658-010-0010-8 Published online: 19 March
Introduction to MEGA
Introduction to MEGA Download at: http://www.megasoftware.net/index.html Thomas Randall, PhD tarandal@email.unc.edu Manual at: www.megasoftware.net/mega4 Use of phylogenetic analysis software tools Bioinformatics
Lecture 4. Models of DNA and protein change. Likelihood methods
Lecture 4. Models of DNA and protein change. Likelihood methods Joe Felsenstein Department of Genome Sciences and Department of Biology Lecture 4. Models of DNA and protein change. Likelihood methods p.1/36
The Phylogenetic Handbook
The Phylogenetic Handbook A Practical Approach to DNA and Protein Phylogeny Edited by Marco Salemi University of California, Irvine and Katholieke Universiteit Leuven, Belgium and Anne-Mieke Vandamme Rega
Phylogeny Estimation and Hypothesis Testing using Maximum Likelihood
Phylogeny Estimation and Hypothesis Testing using Maximum Likelihood For: Prof. Partensky Group: Jimin zhu Rama Sharma Sravanthi Polsani Xin Gong Shlomit klopman April. 7. 2003 Table of Contents Introduction...3
How to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
Algorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,
Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
Stochastic Errors vs. Modeling Errors in Distance Based Phylogenetic Reconstructions
PLGW05 Stochastic Errors vs. Modeling Errors in Distance Based Phylogenetic Reconstructions 1 joint work with Ilan Gronau 2, Shlomo Moran 3, and Irad Yavneh 3 1 2 Dept. of Biological Statistics and Computational
Phylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
Molecular Evolution and Phylogenetic Tree Reconstruction
1 4 Molecular Evolution and Phylogenetic Tree Reconstruction 3 2 5 1 4 2 3 5 Orthology, Paralogy, Inparalogs, Outparalogs Phylogenetic Trees Nodes: species Edges: time of independent evolution Edge length
Phylogeny. November 7, 2017
Phylogeny November 7, 2017 Phylogenetics Phylon = tribe/race, genetikos = relative to birth Phylogenetics: study of evolutionary relationships among organisms, sequences, or anything in between Related
Homoplasy. Selection of models of molecular evolution. Evolutionary correction. Saturation
Homoplasy Selection of models of molecular evolution David Posada Homoplasy indicates identity not produced by descent from a common ancestor. Graduate class in Phylogenetics, Campus Agrário de Vairão,
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
Phylogenetic Assumptions
Substitution Models and the Phylogenetic Assumptions Vivek Jayaswal Lars S. Jermiin COMMONWEALTH OF AUSTRALIA Copyright htregulation WARNING This material has been reproduced and communicated to you by
Kei Takahashi and Masatoshi Nei
Efficiencies of Fast Algorithms of Phylogenetic Inference Under the Criteria of Maximum Parsimony, Minimum Evolution, and Maximum Likelihood When a Large Number of Sequences Are Used Kei Takahashi and
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
Theory of Evolution. Charles Darwin
Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
How should we go about modeling this? Model parameters? Time Substitution rate Can we observe time or subst. rate? What can we observe?
How should we go about modeling this? gorilla GAAGTCCTTGAGAAATAAACTGCACACACTGG orangutan GGACTCCTTGAGAAATAAACTGCACACACTGG Model parameters? Time Substitution rate Can we observe time or subst. rate? What
Phylogenetics: Parsimony
1 Phylogenetics: Parsimony COMP 571 Luay Nakhleh, Rice University he Problem 2 Input: Multiple alignment of a set S of sequences Output: ree leaf-labeled with S Assumptions Characters are mutually independent
Lecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
KaKs Calculator: Calculating Ka and Ks Through Model Selection and Model Averaging
Method KaKs Calculator: Calculating Ka and Ks Through Model Selection and Model Averaging Zhang Zhang 1,2,3#, Jun Li 2#, Xiao-Qian Zhao 2,3, Jun Wang 1,2,4, Gane Ka-Shu Wong 2,4,5, and Jun Yu 1,2,4 * 1
MEGA5: Molecular Evolutionary Genetics Analysis using Maximum Likelihood, Evolutionary Distance, and Maximum Parsimony Methods
MBE Advance Access published May 4, 2011 April 12, 2011 Article (Revised) MEGA5: Molecular Evolutionary Genetics Analysis using Maximum Likelihood, Evolutionary Distance, and Maximum Parsimony Methods
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
molecular evolution and phylogenetics
molecular evolution and phylogenetics Charlotte Darby Computational Genomics: Applied Comparative Genomics 2.13.18 https://www.thinglink.com/scene/762084640000311296 Internal node Root TIME Branch Leaves
Phylogenetics: Bayesian Phylogenetic Analysis. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Bayesian Phylogenetic Analysis COMP 571 - Spring 2015 Luay Nakhleh, Rice University Bayes Rule P(X = x Y = y) = P(X = x, Y = y) P(Y = y) = P(X = x)p(y = y X = x) P x P(X = x 0 )P(Y = y X
Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
Biological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor
Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms
Lecture Notes: Markov chains
Computational Genomics and Molecular Biology, Fall 5 Lecture Notes: Markov chains Dannie Durand At the beginning of the semester, we introduced two simple scoring functions for pairwise alignments: a similarity
Phylogenetics: Likelihood
1 Phylogenetics: Likelihood COMP 571 Luay Nakhleh, Rice University The Problem 2 Input: Multiple alignment of a set S of sequences Output: Tree T leaf-labeled with S Assumptions 3 Characters are mutually
08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega
BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments
Evolutionary Theory and Principles of Phylogenetics. Lucy Skrabanek ICB, WMC March 19, 2008
Evolutionary Theory and Principles of Phylogenetics Lucy Skrabanek ICB, WMC March 19, 2008 Theory of evolution Evolution: process of change over time 2 competing models Phyletic gradualism Punctuated equilibrium
FUNDAMENTALS OF MOLECULAR EVOLUTION
FUNDAMENTALS OF MOLECULAR EVOLUTION Second Edition Dan Graur TELAVIV UNIVERSITY Wen-Hsiung Li UNIVERSITY OF CHICAGO SINAUER ASSOCIATES, INC., Publishers Sunderland, Massachusetts Contents Preface xiii
Honor pledge: I have neither given nor received unauthorized aid on this test. Name :
Midterm Exam #1 MB 451 : Microbial Diversity Honor pledge: I have neither given nor received unauthorized aid on this test. Signed : Date : Name : 1. What are the three primary evolutionary branches of
Reconstruire le passé biologique modèles, méthodes, performances, limites
Reconstruire le passé biologique modèles, méthodes, performances, limites Olivier Gascuel Centre de Bioinformatique, Biostatistique et Biologie Intégrative C3BI USR 3756 Institut Pasteur & CNRS Reconstruire
Lecture 27. Phylogeny methods, part 4 (Models of DNA and protein change) p.1/26
Lecture 27. Phylogeny methods, part 4 (Models of DNA and protein change) Joe Felsenstein Department of Genome Sciences and Department of Biology Lecture 27. Phylogeny methods, part 4 (Models of DNA and
Lecture 24. Phylogeny methods, part 4 (Models of DNA and protein change) p.1/22
Lecture 24. Phylogeny methods, part 4 (Models of DNA and protein change) Joe Felsenstein Department of Genome Sciences and Department of Biology Lecture 24. Phylogeny methods, part 4 (Models of DNA and
Bootstrapping and Tree reliability. Biol4230 Tues, March 13, 2018 Bill Pearson Pinn 6-057
Bootstrapping and Tree reliability Biol4230 Tues, March 13, 2018 Bill Pearson wrp@virginia.edu 4-2818 Pinn 6-057 Rooting trees (outgroups) Bootstrapping given a set of sequences sample positions randomly,
Understanding relationship between homologous sequences
Molecular Evolution Molecular Evolution How and when were genes and proteins created? How old is a gene? How can we calculate the age of a gene? How did the gene evolve to the present form? What selective
Seuqence Analysis '17--lecture 10. Trees types of trees Newick notation UPGMA Fitch Margoliash Distance vs Parsimony
Seuqence nalysis '17--lecture 10 Trees types of trees Newick notation UPGM Fitch Margoliash istance vs Parsimony Phyogenetic trees What is a phylogenetic tree? model of evolutionary relationships -- common