Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço
|
|
- Lora Henderson
- 2 years ago
- Views:
Transcription
1 Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço
2 Charles Darwin ( ) Charles Darwin s tree of life in Notebook B,
3 Ernst Haeckel ( ) German biologist, naturalist, philosopher, physician, professor, and artist
4
5
6
7
8
9 Many trees how to choose one? How to construct the tree? How to interpret the tree?
10 The Natural History of Middle-Earth
11 Sequoia sempervirens, Muir Woods National Monument
12 Molecular Phylogenetics PHYLOGENETICS phylé/phylon Tribe /Clan /Race genetikós Origin /Source /Birth
13 Bacteria : asexual reproduction Generation 0 Bacteria Genetic Material: One circular chromossome Plasmids (optional) Transposons/Insertion Sequences Phages Generation 1 Generation 2 Reproduction by Binary fission
14 Bacteria : asexual reproduction Mutation.ATGGGCGGCTACTTTAC.ATGGGCGTCTACTTTAC
15 Bacteria : asexual reproduction Indel (Insertion / Deletion).ATGGGCGGCTACTTTAC.ATGGGCG_CTACTTTTAC
16 Bacteria : asexual reproduction Recombination + =.ATGGG ACGCTCC TTTACTTCCG.ATGGG CGTCTAC TTTATCCGTA.ATGGG ACGCTCC TTTATCCGTA
17 Phylogeny recombination
18 Sexual reproduction Mendelian tree
19 What is represented by a phylogenetic tree? We start with individuals with some genotypic and phenotypic characteristics. Individuals Pedigree
20 What is represented by a phylogenetic tree? The zooming out from individuals and pedigree will let us see the the bigger picture of the whole population Individuals Population
21 What is represented by a phylogenetic tree? Populations can be isolated for some period of time, but on evolutionary timescales, migration of individuals occur among different populations. The gene flow between populations has the effect of joining the different populations into a Species Population Species
22 What is represented by a phylogenetic tree? During long times, lineages tend to split: Migration to new and isolated region - Founder effect A contiguous range can be split by geological or climatic events - Vicariance That will lead to isolation of the lineages of a species, due to barriers to genetic flow and eventually could lead to speciation. Time Phylogeny Species
23 Concepts in Phylogeny Terminal / Taxa / Leaves / external node bacteria birds marsupials Homo branch Root Node / internal node
24 Concepts in Phylogeny bacteria birds marsupials Homo Monophylectic group = Clade A Clade contains an ancestral lineage and all the descendants of that ancestor. Can be separated from the root with one single cut.
25 Concepts in Phylogeny Unrooted vs Rooted Trees C A B A C A B C B A C B B C A
26 Concepts in Phylogeny Unrooted Trees compare features of a group of organisms (example: 16S RNA in bacteria).it illustrates their relatedness without making assumptions about ancestry. Rooted trees usually use an outlier individual or species (outgroup) to root the tree. That allows for each node with descendants to represent the inferred most recent common ancestor of the descendants, and the edge lengths in some trees may be interpreted as time estimates.
27 Concepts in Phylogeny The information on patterns of evolutionary descent is the same regardless of the lengths of branches. If the branch length has some meaning it is usually represented. These trees depict equivalent relationships despite being different in style.
28 Molecular Phylogenetics trna Vs Aminoacids Isoleucine Serine Arginine Glutamic acid AUC UCA AGG GAA - Methionine- AUC UCA AUG GAA Mutation AUC UCA AGA GAA Arginine -Serine- - AUC UCG AGG GAA AUC UCA AGG AAA AUC UCA GGG GAA AUC UCA GGA GAA Lysine Glycine Glycine
29 Concepts in Phylogeny E D C B A A E D C B A B D E C All these trees are the same
30 Concepts in Phylogeny E D C B A E D C B A Bifurcating trees Multifurcating trees
31 Concepts in Phylogeny A Synapomorphy or Synapomorphic character are used to derive clade definition or confirmation A Homoplasy is a trait shared by two or more organisms but not present in the common ancestor. Can occur due to convergent evolution or due to horizontal gene transfer
32 Molecular Phylogenetics Analysis of hereditary molecular differences, mainly in DNA/RNA or Protein sequences, in order to infer the evolutionary relationships of a group of organisms
33 DNA vs Protein What to choose for an analysis? It will be dependent on the level of evolutionary relationship being investigated. When analyzing closely related individuals, DNA will be more informative. When analyzing deeper evolutionary relationships, Proteins change more slowly and therefore can reveal long term relationships
34 Sequence-based phylogenetic analysis 1) Select a sequence of interest: Whole gene, region of a gene (coding or non-coding), regulatory region of a gene, transposable elements or even a whole genome 2) Identify homologs: Search or acquire data that are homologous to the sequence of interest 3) Align the sequences: Align all the homologous regions to generate a sequence data matrix 4) Calculate the phylogeny based on the alignment
35 1) Selecting a sequence of interest It will depend on the study to be performed Any kind of sequence (coding vs non coding) can be compared Can be more than one sequence i.e. different loci (genes or part of genes) There are always issues that can hinder the choice, and no single type of sequence is perfect for all purposes. The decision should be made based on objective criteria, that could be a convenience one (easier /cheaper to clone or to sequence)
36 1) Selecting a sequence of interest Example: Use of small subunit ribossomal RNA (ss-rrna) 16S for studies of microbial evolution: Highly conserved between species: one set of primers can be used to amplify the gene from most of bacteria or archaea species Can be used to study ancient evolution(ex: archaea vs. bacteria) and more recent evolution (ex: Escherichia vs. Salmonella) Limitation : unrelated thermophiles converge on high G+C content in rrna, which lead to problems in accuracy of inferred phylogenies Limitation: different rates of evolution of rrna between species, which are different from coding genes Limitation: can t discriminate well within some genera or species
37 2) Identifying Homologs Homologous DNA Sequences (homologs): assumed to have a shared ancestry Orthologs : Result of a speciation event Paralogs: Result of a gene duplication. Example: hemoglobin genes A, A2,B and F Xenologs: Result from horizontal gene transfer Ohnologs : paralogs that originated by a process of whole genome duplication
38 2)Identifying Homologs Obtaining the Homologous sequences: Sequencing : experimental generation of data Two weeks in the lab can save you two hours in the library Database searching: online databases are available with deposited DNA, RNA and protein sequences Query target sequence to database Search typically by BLAST algorithm Matches are given a score and cut-off are set to eliminate weak matches
39 2) Identifying Homologs Database searches problems: A decision must be made among the matches as to which are true homologs and which are not. Similarity of sequence is not proof of homology! When searching large databases with short sequences, you can get some matches by chance alone. The sequence similarity could be due parallel or convergent evolution (homoplasy). Conservative approach: set a high similarity threshold to decide if they are homologs. Homology is always an inference
40 3) Sequence alignment Multiple Sequence Alignment is performed on the sequences. Remember that an alignment also represent an hypothesis! OTU= Operational Taxonomic Unit Each specific residue (amino acid or nucleotide base) will correspond to different states of a homologous trait This means that is inferred that the residues in one column have derived from a common residue in an ancestral sequence (Positional homology)
41 4) Creating the phylogeny From the alignment, for most methods, an evolutionary distance is calculated. Those distances take into account the redundancy of the genetic code, properties of amino acids, etc, and not only the percentage of identity between sequences They aim to correct the difference between a true evolutionary distance and the calculated difference in residues This is due to the fact that we sample a finite number of traits, and the finite number of possible character states found in DNA and Protein sequence
42 Models of DNA Evolution Jukes and Cantor (1969). (JC69) Simplest model of DNA evolution Assumptions: all substitutions are independent all sequence positions are equally subject to change Equal mutation rate among the four types of nucleotides no insertions or deletions have occurred Max p of 0.75! Proportion of different sites, between two sequences
43 Models of DNA Evolution Kimura (1980). (K80) (Kimura 2-parameter model Distinguishes between transitions (more frequent) and transversions Assumptions: All the bases are equally frequent p - Proportion of sites that show transitions q proportion of sites that show transversions
44 Models of DNA Evolution Some of the other available models (in order of increasing complexity): Felsenstein (1981). (F81) Extends JC69 by allowing the base frequencies to vary Hasegawa, Kishino and Yano (HKY85) Combines K80 and F81. Also known as F84 since Felsenstein also produced an equivalent model in 1984 Tamura (1992). (T92) Extends K80 with accounting for G+C-content bias (ex: Drosophila mitochondrial DNA) Tamura and Nei (1993). (TN93) distinguishes between two types of transition (rate A<->G rate C<->T
45 Models of DNA Evolution Limitations to Jukes Cantor and Kimura-2 parameter (and others) : Assume base composition or amino acid composition is uniform and stationary over time. When this is not the case, these methods can produce distance matrices that lead to incorrect tree inference. Other correction methods are available in those cases.
46 Sequence-based phylogenetic analysis 1) Select a sequence of interest: Whole gene, region of a gene (coding or non-coding), regulatory region of a gene, transposable elements or even a whole genome 2) Identify homologs: Search or acquire data that are homologous to the sequence of interest 3) Align the sequences: Align all the homologous regions to generate a sequence data matrix 4) Correct the distance using models of DNA evolution 5) Calculate the phylogeny based on the alignment
47 Algorithms for tree construction Based on the distance matrix: Hierarchical clustering methods: UPGMA, Single Linkage and Complete linkage Neighbor-joining Fitch-Margoliash method Maximum Parsimony methods Based on rules (Graphic Matroids) goeburst Maximum Likelihood methods Bayesian inference methods
48 Hierarchical clustering
49 Cluster analysis Cluster: a collection/partition of data objects (taxa) in a dataset
50 How many groups? Cluster analysis: partitioning of a dataset into clusters. Objects in the same cluster should be more similar to each other than objects from different clusters Unsupervised classification (no a priori definition of classes /clusters
51 How many groups? Four steps: 1) Choosing the characters to be measured 2) Choosing Similarity /Distance Metric (among cases/individuals/taxa) 3) Inter group distance/linkage calculation : UPGMA /Single Linkage/Complete Linkage / 4) Cutting the dendrogram at certain levels to define clusters
52 Hierarchical clustering: WPGMA Weighted Pair Group Method with Arithmetic Mean Sokal and Michener
53 Hierarchical clustering: WPGMA
54 Defining Clusters in a Dendrogram F D E B A C Clusters: F, DE, B, AC Clusters: F, DE, BAC Clusters: F, DEBAC Which is the correct cut-off: Several methods have been developed based on distances of branches to the cut Aditional data or prior knowledge can help the decision
55 Hierarchical clustering: WPGMA Assume this tree: Where the distance between taxa can be represented in the following distance matrix: A B C D E F A B 5 C 4 7 D E F Cycle 1: Shortest distance is d(ac)=4 Join AC in subtree: 2 A C Branch length = d(ac)/2 =2
56 Hierarchical clustering: WPGMA AC B 6 AC B D E F D 7 10 E F d((ac)b)=(d(ab)+d(cb))/2 = (5+7)/2=6 d((ac)d)=(d(ad)+d(cd))/2 = (7+7)/2=7 d((ac)e)=(d(ae)+d(ce))/2 = (6+6)/2=6 d((ac)f)=(d(af)+d(cf))/2 = (8+8)/2=8 Cycle 2: Shortest distance is d(de)=5 Join AC in subtree: Branch length = d(de)/2 =2.5 A 2 C D 2.5E AC B 6 AC B DE F DE F Cycle 3: d((de)b)=(d(db)+d(eb))/2 = (10+9)/2=9.5 d((de)f)=(d(df)+d(ef))/2 = (9+8)/2=8.5 d((de)(ac))=(d(d(ac))+d(e(ac))/2 = (7+6)/2=6.5 Shortest distance is d((ac)b)=6 Branch length = d((ac)b)/2= A C B D 2.5E
57 Hierarchical clustering: WPGMA ACB DE F ACB DE 8 F Cycle 4: Shortest distance is d((acb)(de))=8 Branch length = d((acb)(de))/2=4 d((acb)(f))=(d((ac)f)+d(bf))/2 = (8+11)/2=9.5 d((acb)(de))=(d((ac)(de))+d(b(de))/2 = ( )/2= A C B D 2.5E ACBDE F ACBDE F 9 Cycle 5: Shortest distance is d((acbde)f)=9 d((acbde)f)=(d((acb)f)+d((de)f)/2 = ( )/2=9 Branch length = d((acbde)f))/2= A C B D 2.5E 4.5 F
58 Hierarchical clustering: WPGMA A 1 2 C 3 B 1.5 D 2.5E 4.5 F Root assigned at mid-point The resulting UPGMA tree differs in branch order
59 Hierarchical clustering Advantages of hierarchical clustering methods: Speed (O (n 2 )) Limitations of UPGMA/WPGMA/Single Linkage/Complete Linkage: Assumption that the rates of evolutionary change are uniform in different evolutionary branches ( same molecular clock in different branches). Assumes an Ultrameric Tree, i.e., any 3 taxa {A,B,C}, D AC max(d AB,D BC )
60 Hierarchical clustering: Single and Complete Linkage Give two groups g1 and g2 Complete linkage The distance between groups is the distance between the farthest pair Pulls groups farther apart Single linkage The distance between groups is the distance between the closest pair Pulls groups closer together
61 UPGMA/Single Linkage /Complete Linkage Complete Linkage W/UPGMA Single Linkage Group average centroid
62 WPGMA vs UPGMA WPGMA UPGMA
63 See you tomorrow... Or next on the TP
"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
Phylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
How to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki
Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:
A (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
Phylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
Evolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
CHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
Intraspecific gene genealogies: trees grafting into networks
Intraspecific gene genealogies: trees grafting into networks by David Posada & Keith A. Crandall Kessy Abarenkov Tartu, 2004 Article describes: Population genetics principles Intraspecific genetic variation
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
Phylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
Phylogeny. November 7, 2017
Phylogeny November 7, 2017 Phylogenetics Phylon = tribe/race, genetikos = relative to birth Phylogenetics: study of evolutionary relationships among organisms, sequences, or anything in between Related
Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction
EVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
Biology 211 (2) Week 1 KEY!
Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of
Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
How should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
Lecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
Lecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Processes of Evolution
15 Processes of Evolution Forces of Evolution Concept 15.4 Selection Can Be Stabilizing, Directional, or Disruptive Natural selection can act on quantitative traits in three ways: Stabilizing selection
C.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT
Inferring phylogeny Constructing phylogenetic trees Tõnu Margus Contents What is phylogeny? How/why it is possible to infer it? Representing evolutionary relationships on trees What type questions questions
Cladistics and Bioinformatics Questions 2013
AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species
UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)
- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the
Chapter 26: Phylogeny and the Tree of Life
Chapter 26: Phylogeny and the Tree of Life 1. Key Concepts Pertaining to Phylogeny 2. Determining Phylogenies 3. Evolutionary History Revealed in Genomes 1. Key Concepts Pertaining to Phylogeny PHYLOGENY
Theory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
Anatomy of a tree. clade is group of organisms with a shared ancestor. a monophyletic group shares a single common ancestor = tapirs-rhinos-horses
Anatomy of a tree outgroup: an early branching relative of the interest groups sister taxa: taxa derived from the same recent ancestor polytomy: >2 taxa emerge from a node Anatomy of a tree clade is group
A Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
PHYLOGENY & THE TREE OF LIFE
PHYLOGENY & THE TREE OF LIFE PREFACE In this powerpoint we learn how biologists distinguish and categorize the millions of species on earth. Early we looked at the process of evolution here we look at
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them?
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Carolus Linneaus:Systema Naturae (1735) Swedish botanist &
Letter to the Editor. Department of Biology, Arizona State University
Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona
Homework Assignment, Evolutionary Systems Biology, Spring Homework Part I: Phylogenetics:
Homework Assignment, Evolutionary Systems Biology, Spring 2009. Homework Part I: Phylogenetics: Introduction. The objective of this assignment is to understand the basics of phylogenetic relationships
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Macroevolution Part I: Phylogenies
Macroevolution Part I: Phylogenies Taxonomy Classification originated with Carolus Linnaeus in the 18 th century. Based on structural (outward and inward) similarities Hierarchal scheme, the largest most
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
CS5263 Bioinformatics. Guest Lecture Part II Phylogenetics
CS5263 Bioinformatics Guest Lecture Part II Phylogenetics Up to now we have focused on finding similarities, now we start focusing on differences (dissimilarities leading to distance measures). Identifying
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Introduction to Bioinformatics Introduction to Bioinformatics
Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
Chapter 27: Evolutionary Genetics
Chapter 27: Evolutionary Genetics Student Learning Objectives Upon completion of this chapter you should be able to: 1. Understand what the term species means to biology. 2. Recognize the various patterns
Chapter 19: Taxonomy, Systematics, and Phylogeny
Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand
Introduction to characters and parsimony analysis
Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect
Bio 1B Lecture Outline (please print and bring along) Fall, 2007
Bio 1B Lecture Outline (please print and bring along) Fall, 2007 B.D. Mishler, Dept. of Integrative Biology 2-6810, bmishler@berkeley.edu Evolution lecture #5 -- Molecular genetics and molecular evolution
Evolutionary Analysis of Viral Genomes
University of Oxford, Department of Zoology Evolutionary Biology Group Department of Zoology University of Oxford South Parks Road Oxford OX1 3PS, U.K. Fax: +44 1865 271249 Evolutionary Analysis of Viral
Phylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
Microbial Taxonomy and the Evolution of Diversity
19 Microbial Taxonomy and the Evolution of Diversity Copyright McGraw-Hill Global Education Holdings, LLC. Permission required for reproduction or display. 1 Taxonomy Introduction to Microbial Taxonomy
Classification, Phylogeny yand Evolutionary History
Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize
Phylogeny and the Tree of Life
LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 26 Phylogeny and the Tree of Life
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
Classification and Phylogeny
Classification and Phylogeny The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
Consensus Methods. * You are only responsible for the first two
Consensus Trees * consensus trees reconcile clades from different trees * consensus is a conservative estimate of phylogeny that emphasizes points of agreement * philosophy: agreement among data sets is
Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony
ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),
Estimating Phylogenies (Evolutionary Trees) II. Biol4230 Thurs, March 2, 2017 Bill Pearson Jordan 6-057
Estimating Phylogenies (Evolutionary Trees) II Biol4230 Thurs, March 2, 2017 Bill Pearson wrp@virginia.edu 4-2818 Jordan 6-057 Tree estimation strategies: Parsimony?no model, simply count minimum number
Classification and Phylogeny
Classification and Phylogeny The diversity it of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
How Molecules Evolve. Advantages of Molecular Data for Tree Building. Advantages of Molecular Data for Tree Building
How Molecules Evolve Guest Lecture: Principles and Methods of Systematic Biology 11 November 2013 Chris Simon Approaching phylogenetics from the point of view of the data Understanding how sequences evolve
1 ATGGGTCTC 2 ATGAGTCTC
We need an optimality criterion to choose a best estimate (tree) Other optimality criteria used to choose a best estimate (tree) Parsimony: begins with the assumption that the simplest hypothesis that
Chapter 16: Reconstructing and Using Phylogenies
Chapter Review 1. Use the phylogenetic tree shown at the right to complete the following. a. Explain how many clades are indicated: Three: (1) chimpanzee/human, (2) chimpanzee/ human/gorilla, and (3)chimpanzee/human/
METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
BIOLOGY 432 Midterm I - 30 April PART I. Multiple choice questions (3 points each, 42 points total). Single best answer.
BIOLOGY 432 Midterm I - 30 April 2012 Name PART I. Multiple choice questions (3 points each, 42 points total). Single best answer. 1. Over time even the most highly conserved gene sequence will fix mutations.
GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.
!! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory
Algorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,
Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837
Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)
Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from
A. Incorrect! In the binomial naming convention the Kingdom is not part of the name.
Microbiology Problem Drill 08: Classification of Microorganisms No. 1 of 10 1. In the binomial system of naming which term is always written in lowercase? (A) Kingdom (B) Domain (C) Genus (D) Specific
Inferring phylogeny. Today s topics. Milestones of molecular evolution studies Contributions to molecular evolution
Today s topics Inferring phylogeny Introduction! Distance methods! Parsimony method!"#$%&'(!)* +,-.'/01!23454(6!7!2845*0&4'9#6!:&454(6 ;?@AB=C?DEF Overview of phylogenetic inferences Methodology Methods
Molecular Evolution & Phylogenetics Traits, phylogenies, evolutionary models and divergence time between sequences
Molecular Evolution & Phylogenetics Traits, phylogenies, evolutionary models and divergence time between sequences Basic Bioinformatics Workshop, ILRI Addis Ababa, 12 December 2017 1 Learning Objectives
Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science
Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.
Bioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
Reconstructing the history of lineages
Reconstructing the history of lineages Class outline Systematics Phylogenetic systematics Phylogenetic trees and maps Class outline Definitions Systematics Phylogenetic systematics/cladistics Systematics
Evolutionary Theory and Principles of Phylogenetics. Lucy Skrabanek ICB, WMC March 19, 2008
Evolutionary Theory and Principles of Phylogenetics Lucy Skrabanek ICB, WMC March 19, 2008 Theory of evolution Evolution: process of change over time 2 competing models Phyletic gradualism Punctuated equilibrium
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence
Lecture 27. Phylogeny methods, part 4 (Models of DNA and protein change) p.1/26
Lecture 27. Phylogeny methods, part 4 (Models of DNA and protein change) Joe Felsenstein Department of Genome Sciences and Department of Biology Lecture 27. Phylogeny methods, part 4 (Models of DNA and
Microbial Diversity and Assessment (II) Spring, 2007 Guangyi Wang, Ph.D. POST103B
Microbial Diversity and Assessment (II) Spring, 007 Guangyi Wang, Ph.D. POST03B guangyi@hawaii.edu http://www.soest.hawaii.edu/marinefungi/ocn403webpage.htm General introduction and overview Taxonomy [Greek
Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot