Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley
|
|
- Marianna Charles
- 2 years ago
- Views:
Transcription
1 Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley B.D. Mishler Feb. 14, Phylogenetic trees VI: Dating in the 21st century: clocks, & calibrations; proper use of fossils Reading assignments: Tree Thinking pp 53-58; Parham, et al Best practices for justifying fossil calibrations, Systematic Biology, 61: , 1. Introduction Molecular dating methods merge temporal information from sources outside of the primary phylogenetic data in order to provide time calibration for a phylogeny with branch lengths, corrected for rate variation. These may be strict or relaxed clock methods. There are a number of popular uses of molecular dating: Biogeography- Establishing the origin of a fauna or testing dispersal and vicariance scenarios requires having an absolute time scale. Age of a common ancestor- Correlating the origin of clades to climate or other events requires having an absolute time scale. Diversification rates- Variation of evolutionary rates within or between clades or trees (co-diversification) can use relative or absolute time scales. Population biology- Looking at the emergence and propagation of viruses and other disease pathogens, invasive species, or other population-level questions may require relative or absolute time scales. By definition the extant tips of the tree are the same age, i.e. the time that has passed from the common ancestral node is the same for all extant OTUs. However, we also know that ultrametric trees are extremely rare for real data, so the amount of character change along the branches differs across the tree most of the time. Why there is no universal molecular clock: generation time population size DNA repair efficiency metabolic rates selective pressures We are facing two different problems: making our tree ultrametic, and calibrating it. Even though some methods try to do both at once, they are still logically separate. 1
2 2. Searching for a clock What is ultrametricity? Ultrametric matrix and its tree: A non-ultrametric tree: from: A. Determining whether your data fit a clock model i. relative rate tests comparing three taxa at a time, in rooted context: ii. likelihood ratio test Testing the Molecular Clock using a likelihood ratio test (courtesy of John Huelsenbeck) Under the null hypothesis, the phylogeny is ultrametric (i.e., rooted and the branch lengths are constrained such that all of the tips can be drawn at a single time plane). Under the alternative hypothesis, each branch is allowed to vary independently. The alternative hypothesis invokes s - 2 additional parameters, where s is the number of sequences. The likelihood ratio test statistic is -2logL = 2(logL0 - logl1), where L0 and L1 are the likelihoods under the null and alternative hypotheses, respectively. The significance of the likelihood ratio test statistic can be approximated using a χ2 distribution (with s - 2 degrees of freedom) or by parametric bootstrapping. The following example shows how to perform the likelihood ratio test of the molecular clock. The data are s = 5 albumin sequences from vertebrates (a fish, frog, bird, mouse, and human). We assume the Hasegawa, Kishino, and Yano (1985) model of DNA substitution with among site rate variation described using a gamma distribution. The maximum likelihood under the null hypothesis is logl0 = The best estimate of phylogeny supports the monophyly of the mammals and amniotes. The maximum likelihood under the alternative hypothesis is logl1 = The likelihood under the alternative hypothesis is higher than under the null hypothesis because there are more free parameters in the substitution model (i.e., no constraints on branch lengths). The maximum likelihood estimate of phylogeny is consistent with the monophyly of mammals and amniotes (though the tree is unrooted). The likelihood ratio test statistic is -2logL = , which is asymptotically χ2 distributed under the null hypothesis with 3 degrees of freedom. Comparing the observed value of -2logL to a χ2 with 3 df shows that the null hypothesis can be rejected at P < So, we conclude the data are not clock-like. B. If your data don't fit a clock model (and they usually don't), try smoothing the data to get an (at least locally) approximate clock. Two common methods (implemented in r8s by Mike Sanderson: both attempt to smooth the magnitude of changes in rate between neighboring branches, to give you something intermediate between the rigid clock assumption and completely unconstrained branch lengths: i. non-parametric rate smoothing. This uses a least squares smoothing approach that penalizes rates that change too quickly from branch to neighboring branch. 2
3 ii. penalized likelihood. This is a "semi-parametric" approach that combines a ML approach with the above penalty function. The user can specify the relative weight of the penalty function and the ML component (in which parameters are being fitted as typical in ML). The parametric model has a different substitution rate for each branch. 3. Calibrating the clock Calibration involves setting the age of one or several nodes in the tree using a point estimate, mean value, or probability distribution, allowing for the estimation of the age of other, uncalibrated nodes. Some folks simply import dates from prior dating analyses or "known" rates for the same gene based on a published estimate. However, this multiplies the error and uncertainty -- it's better to come up with a calibration from an analysis. A. Three ways that have been used to estimate the age of a node: i. a fossil (see below for details) -- gives a minimum age for a node. ii. availability of necessary habitat (e.g. origin of the paramo vegetation type)-- gives a maximum age for a node (maybe). iii. geographic vicariance event (based on the vicarious distribution of sister groups in relation to well-dated geological events; obviously shouldn t be used when the biogeographic history of the group is the question being addressed) -- neither a maximum or minimum age for a node. B. How to use a fossil to date a node? Some principles: i. You never find a taxon in the fossil record, or a lineage; you find remains of an organism displaying characters. These characters need to be phylogenetically analyzed using the principles talked about earlier, in relation to other fossils and extant organisms in the group. ii. Therefore, a fossil can never be compared to a strictly molecular phylogeny (unless it has preserved molecular data!); all relevant morphological characters need to have been analyzed and incorporated in the phylogenetic reconstruction. iii. When a fossil can be placed using synapomorphies as sister to some other lineage, that other lineage (and the node connecting them) must be at least as old as the fossil. Nodes deeper must also have when fossil is placed here, it dates all the nodes with circles on them, but it doesn't date the nodes with an asterisk been in existence by that time. This is the important principle of equal age of sister groups. iv. Uncertainty: Dating of the fossil itself has a certain error rate, which is relatively symmetrical. But the uncertainty about dating of the node is highly skewed; at best the fossil gives the minimum age, but the maximum age in principle goes back to the origin of life. The richer the fossil record, the better is the chance to constrain the maximum age somewhat. C. Several sources of uncertainty with fossils: i. Phylogenetic placement is often based on overall similarity or simply taxon ID. Without a phylogenetic analysis there is no way to know the clade indicated really is a relative. We need integrated molecular-morphological analyses, and need to consider the possibility of multiple placements of the fossil. * * 3
4 ii. Determining the fossil's age. What method and how precise? Has there been a review of the dating of the fossil or strata Has the geologic scale changed? Correlated vs. direct dating iii. The number, age and placement of multiple fossils considered to be same "taxon." Problem arise with over-determined specimens, and differing taxonomic concepts D. In the best possible case you will have multiple fossils to establish hard minimum dates, i.e. the youngest possible age of the oldest known fossil, that are 1. based on real documented specimens, 2. have a confirmed identification, 3. consistently and explicitly dated using a standard geologic time scale, and 4. placed in the phylogeny with the same set of OTUs as those with molecular data. 4. Algorithmic approaches A. Autocorrelation vs. non-autocorrelated rates Autocorrelated- Descendant branches draw a rate from a distribution with a mean given by the ancestral branch. Non-autocorrelated- rates for each branch are drawn independently from an identical distribution. B. Use of prior trees or simultaneous estimation. Many dating studies estimate the tree using a time-independent method followed by the estimation of divergence dates using a molecular clock (strict or relaxed). -Independence of models and unlinking assumptions -relatively computationally easy and fast Some examples: Local clock models (PAML, QDate) clock-like within a given clade, but variable between clades. Ad hoc heuristic rate smoothing (PAML) Non-parametric rate smoothing (r8s) - simultaneously estimate unknown divergence times and smooth the rapidity of rate change along lineages Penalized likelihood (r8s) Bayesian approach and penalized likelihood both have in common that they smooth or minimize rate variation over evolutionary time by means of an autocorrelated process. 4
5 C. Simultaneous estimation of the tree, its branch lengths and time estimates (e.g. BEAST). -confidence intervals -takes into account phylogenetic uncertainty, given that there is information for estimating dates of divergence, this could be used to give better estimates of phylogeny -flexible clock models -computationally difficult -tip-dating vs. node-dating 5. Conclusions A. For many questions in evolutionary biology you don't need absolute time; relative time will do (e.g., ordering of nodes in time). So, don't go out on a limb trying to manufacture clocks unless you need them. B. If you do need to calibrate a clock, you want to have as many calibration points (preferably fossils), as local to your questions, as possible. C. The fossils need to be embedded in the phylogenetic analysis, i.e., placed by the characters they bear, as with all taxa (tip-dating). D. If you have enough calibration points, you don't need an actual molecular clock (or even a manufactured one) to answer many questions. E. As always, carefully consider what questions you want to address first, then select your approach; for every positive hypothesis, be sure you have a null hypothesis. 5
Concepts and Methods in Molecular Divergence Time Estimation
Concepts and Methods in Molecular Divergence Time Estimation 26 November 2012 Prashant P. Sharma American Museum of Natural History Overview 1. Why do we date trees? 2. The molecular clock 3. Local clocks
Reconstructing the history of lineages
Reconstructing the history of lineages Class outline Systematics Phylogenetic systematics Phylogenetic trees and maps Class outline Definitions Systematics Phylogenetic systematics/cladistics Systematics
Anatomy of a tree. clade is group of organisms with a shared ancestor. a monophyletic group shares a single common ancestor = tapirs-rhinos-horses
Anatomy of a tree outgroup: an early branching relative of the interest groups sister taxa: taxa derived from the same recent ancestor polytomy: >2 taxa emerge from a node Anatomy of a tree clade is group
Using phylogenetics to estimate species divergence times... Basics and basic issues for Bayesian inference of divergence times (plus some digression)
Using phylogenetics to estimate species divergence times... More accurately... Basics and basic issues for Bayesian inference of divergence times (plus some digression) "A comparison of the structures
UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)
- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2011 University of California, Berkeley
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2011 University of California, Berkeley B.D. Mishler Feb. 1, 2011. Qualitative character evolution (cont.) - comparing
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
Integrating Fossils into Phylogenies. Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.
IB 200B Principals of Phylogenetic Systematics Spring 2011 Integrating Fossils into Phylogenies Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
Macroevolution Part I: Phylogenies
Macroevolution Part I: Phylogenies Taxonomy Classification originated with Carolus Linnaeus in the 18 th century. Based on structural (outward and inward) similarities Hierarchal scheme, the largest most
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2012 University of California, Berkeley
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2012 University of California, Berkeley B.D. Mishler Feb. 7, 2012. Morphological data IV -- ontogeny & structure of plants The last frontier
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
Name. Ecology & Evolutionary Biology 2245/2245W Exam 2 1 March 2014
Name 1 Ecology & Evolutionary Biology 2245/2245W Exam 2 1 March 2014 1. Use the following matrix of nucleotide sequence data and the corresponding tree to answer questions a. through h. below. (16 points)
(Stevens 1991) 1. morphological characters should be assumed to be quantitative unless demonstrated otherwise
Bot 421/521 PHYLOGENETIC ANALYSIS I. Origins A. Hennig 1950 (German edition) Phylogenetic Systematics 1966 B. Zimmerman (Germany, 1930 s) C. Wagner (Michigan, 1920-2000) II. Characters and character states
How to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
Lecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2016 University of California, Berkeley. Parsimony & Likelihood [draft]
Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2016 University of California, Berkeley K.W. Will Parsimony & Likelihood [draft] 1. Hennig and Parsimony: Hennig was not concerned with parsimony
Estimating Divergence Dates from Molecular Sequences
Estimating Divergence Dates from Molecular Sequences Andrew Rambaut and Lindell Bromham Department of Zoology, University of Oxford The ability to date the time of divergence between lineages using molecular
DATING LINEAGES: MOLECULAR AND PALEONTOLOGICAL APPROACHES TO THE TEMPORAL FRAMEWORK OF CLADES
Int. J. Plant Sci. 165(4 Suppl.):S7 S21. 2004. Ó 2004 by The University of Chicago. All rights reserved. 1058-5893/2004/1650S4-0002$15.00 DATING LINEAGES: MOLECULAR AND PALEONTOLOGICAL APPROACHES TO THE
Classification and Phylogeny
Classification and Phylogeny The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2009 University of California, Berkeley
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2009 University of California, Berkeley B.D. Mishler Jan. 22, 2009. Trees I. Summary of previous lecture: Hennigian
A (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
Classification, Phylogeny yand Evolutionary History
Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize
Classification and Phylogeny
Classification and Phylogeny The diversity it of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200 Spring 2018 University of California, Berkeley
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200 Spring 2018 University of California, Berkeley D.D. Ackerly Feb. 26, 2018 Maximum Likelihood Principles, and Applications to
--Therefore, congruence among all postulated homologies provides a test of any single character in question [the central epistemological advance].
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2008 University of California, Berkeley B.D. Mishler Jan. 29, 2008. The Hennig Principle: Homology, Synapomorphy, Rooting issues The fundamental
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
Chapter 16: Reconstructing and Using Phylogenies
Chapter Review 1. Use the phylogenetic tree shown at the right to complete the following. a. Explain how many clades are indicated: Three: (1) chimpanzee/human, (2) chimpanzee/ human/gorilla, and (3)chimpanzee/human/
AP Biology. Cladistics
Cladistics Kingdom Summary Review slide Review slide Classification Old 5 Kingdom system Eukaryote Monera, Protists, Plants, Fungi, Animals New 3 Domain system reflects a greater understanding of evolution
Biologists have used many approaches to estimating the evolutionary history of organisms and using that history to construct classifications.
Phylogenetic Inference Biologists have used many approaches to estimating the evolutionary history of organisms and using that history to construct classifications. Willi Hennig developed d the techniques
Phylogeny is the evolutionary history of a group of organisms. Based on the idea that organisms are related by evolution
Bio 1M: Phylogeny and the history of life 1 Phylogeny S25.1; Bioskill 11 (2ndEd S27.1; Bioskills 3) Bioskills are in the back of your book Phylogeny is the evolutionary history of a group of organisms
How should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
GIS Applications to Museum Specimens
GIS Applications to Museum Specimens Joseph Grinnell (1877 1939) At this point I wish to emphasize what I believe will ultimately prove to be the greatest value of our museum. This value will not, however,
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
Appendix from L. J. Revell, On the Analysis of Evolutionary Change along Single Branches in a Phylogeny
008 by The University of Chicago. All rights reserved.doi: 10.1086/588078 Appendix from L. J. Revell, On the Analysis of Evolutionary Change along Single Branches in a Phylogeny (Am. Nat., vol. 17, no.
Biology 211 (2) Week 1 KEY!
Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of
Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!
Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site: http://hydrodictyon.eeb.uconn.edu/people/plewis
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
Biology 1B Evolution Lecture 2 (February 26, 2010) Natural Selection, Phylogenies
1 Natural Selection (Darwin-Wallace): There are three conditions for natural selection: 1. Variation: Individuals within a population have different characteristics/traits (or phenotypes). 2. Inheritance:
CHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
Chapter 19: Taxonomy, Systematics, and Phylogeny
Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand
Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
Lecture V Phylogeny and Systematics Dr. Kopeny
Delivered 1/30 and 2/1 Lecture V Phylogeny and Systematics Dr. Kopeny Lecture V How to Determine Evolutionary Relationships: Concepts in Phylogeny and Systematics Textbook Reading: pp 425-433, 435-437
Statistical nonmolecular phylogenetics: can molecular phylogenies illuminate morphological evolution?
Statistical nonmolecular phylogenetics: can molecular phylogenies illuminate morphological evolution? 30 July 2011. Joe Felsenstein Workshop on Molecular Evolution, MBL, Woods Hole Statistical nonmolecular
C.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them?
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Carolus Linneaus:Systema Naturae (1735) Swedish botanist &
Bio94 Discussion Activity week 3: Chapter 27 Phylogenies and the History of Life
Bio94 Discussion Activity week 3: Chapter 27 Phylogenies and the History of Life 1. Constructing a phylogenetic tree using a cladistic approach Construct a phylogenetic tree using the following table:
Evolution of Body Size in Bears. How to Build and Use a Phylogeny
Evolution of Body Size in Bears How to Build and Use a Phylogeny Lesson II Using a Phylogeny Objectives for Lesson II: 1. Overview of concepts 1. Simple ancestral state reconstruction on the bear phylogeny
Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) p.1/30
Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) Joe Felsenstein Department of Genome Sciences and Department of Biology Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) p.1/30 A non-phylogeny
PHYLOGENY & THE TREE OF LIFE
PHYLOGENY & THE TREE OF LIFE PREFACE In this powerpoint we learn how biologists distinguish and categorize the millions of species on earth. Early we looked at the process of evolution here we look at
Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
The practice of naming and classifying organisms is called taxonomy.
Chapter 18 Key Idea: Biologists use taxonomic systems to organize their knowledge of organisms. These systems attempt to provide consistent ways to name and categorize organisms. The practice of naming
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence
Lecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
1 ATGGGTCTC 2 ATGAGTCTC
We need an optimality criterion to choose a best estimate (tree) Other optimality criteria used to choose a best estimate (tree) Parsimony: begins with the assumption that the simplest hypothesis that
MOLECULAR SYSTEMATICS: A SYNTHESIS OF THE COMMON METHODS AND THE STATE OF KNOWLEDGE
CELLULAR & MOLECULAR BIOLOGY LETTERS http://www.cmbl.org.pl Received: 16 August 2009 Volume 15 (2010) pp 311-341 Final form accepted: 01 March 2010 DOI: 10.2478/s11658-010-0010-8 Published online: 19 March
The Life System and Environmental & Evolutionary Biology II
The Life System and Environmental & Evolutionary Biology II EESC V2300y / ENVB W2002y Laboratory 1 (01/28/03) Systematics and Taxonomy 1 SYNOPSIS In this lab we will give an overview of the methodology
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2011 University of California, Berkeley
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2011 University of California, Berkeley B.D. Mishler March 31, 2011. Reticulation,"Phylogeography," and Population Biology:
Chapter 26. Phylogeny and the Tree of Life. Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Pearson Education, Inc.
Chapter 26 Phylogeny and the Tree of Life Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Investigating the Tree of Life Phylogeny is the evolutionary history of a species or group of
Lab 9: Maximum Likelihood and Modeltest
Integrative Biology 200A University of California, Berkeley "PRINCIPLES OF PHYLOGENETICS" Spring 2010 Updated by Nick Matzke Lab 9: Maximum Likelihood and Modeltest In this lab we re going to use PAUP*
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2008
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2008 University of California, Berkeley B.D. Mishler March 18, 2008. Phylogenetic Trees I: Reconstruction; Models, Algorithms & Assumptions
Using Trees for Classifications. Introduction
Using Trees for Classifications The Phylogenetic Cibele Caio Principles and Practice of Phylogenetic Systematics, Spring 2009 Introduction The impusle to characterize and classify species Ancient Aristoteles
Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science
Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.
Phylogenetics Topic 1: An overview
Phylogenetics Topic 1: An overview Introduction The affinities of all beings of the same class have sometimes been represented by a great tree. I believe this simile largely speaks the truth. The green
Biology 2. Lecture Material. For. Macroevolution. Systematics
Biology 2 Macroevolution & Systematics 1 Biology 2 Lecture Material For Macroevolution & Systematics Biology 2 Macroevolution & Systematics 2 Microevolution: Biological Species: Two Patterns of Evolutionary
3 Hours 18 / 06 / 2012 EXAMS OFFICE USE ONLY University of the Witwatersrand, Johannesburg Course or topic No(s) ANAT 4000
3 Hours 18 / 06 / 2012 EXAMS OFFICE USE ONLY University of the Witwatersrand, Johannesburg Course or topic No(s) ANAT 4000 Course or topic name(s) Paper Number & title HUMAN BIOLOGY HONOURS: PAPER 1 Examination
PHYLOGENY WHAT IS EVOLUTION? 1/22/2018. Change must occur in a population via allele
PHYLOGENY EXERCISE 1 AND 2 WHAT IS EVOLUTION? The theory that all living organisms on earth are related and have a common ancestor. These organism have changed over time and are continuing to change. Changes
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2012 University of California, Berkeley
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2012 University of California, Berkeley B.D. Mishler April 12, 2012. Phylogenetic trees IX: Below the "species level;" phylogeography; dealing
Phylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
Outline. Classification of Living Things
Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics
Historical Biogeography. Historical Biogeography. Systematics
Historical Biogeography I. Definitions II. Fossils: problems with fossil record why fossils are important III. Phylogeny IV. Phenetics VI. Phylogenetic Classification Disjunctions debunked: Examples VII.
SPECIATION. REPRODUCTIVE BARRIERS PREZYGOTIC: Barriers that prevent fertilization. Habitat isolation Populations can t get together
SPECIATION Origin of new species=speciation -Process by which one species splits into two or more species, accounts for both the unity and diversity of life SPECIES BIOLOGICAL CONCEPT Population or groups
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies 1 What is phylogeny? Essay written for the course in Markov Chains 2004 Torbjörn Karfunkel Phylogeny is the evolutionary development
Organizing Life s Diversity
17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny
Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family
Review: Gene Families Gene Families part 2 03 327/727 Lecture 8 What is a Case study: ian globin genes Gene trees and how they differ from species trees Homology, orthology, and paralogy Last tuesday 1
Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
Phylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied
Phylogenetic analysis. Characters
Typical steps: Phylogenetic analysis Selection of taxa. Selection of characters. Construction of data matrix: character coding. Estimating the best-fitting tree (model) from the data matrix: phylogenetic
Inferring Speciation Times under an Episodic Molecular Clock
Syst. Biol. 56(3):453 466, 2007 Copyright c Society of Systematic Biologists ISSN: 1063-5157 print / 1076-836X online DOI: 10.1080/10635150701420643 Inferring Speciation Times under an Episodic Molecular
Phylogeny and Systematics
Chapter 25 Phylogeny and Systematics PowerPoint Lectures for Biology, Seventh Edition Neil Campbell and Jane Reece Lectures by Chris Romero Modified by Maria Morlin racing phylogeny Phylogeny: he evolutionary
Chapter 26: Phylogeny and the Tree of Life
Chapter 26: Phylogeny and the Tree of Life 1. Key Concepts Pertaining to Phylogeny 2. Determining Phylogenies 3. Evolutionary History Revealed in Genomes 1. Key Concepts Pertaining to Phylogeny PHYLOGENY
Week 8: Testing trees, Bootstraps, jackknifes, gene frequencies
Week 8: Testing trees, ootstraps, jackknifes, gene frequencies Genome 570 ebruary, 2016 Week 8: Testing trees, ootstraps, jackknifes, gene frequencies p.1/69 density e log (density) Normal distribution:
Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
arxiv: v2 [q-bio.pe] 18 Oct 2013
arxiv:131.2968 The Fossilized Birth-Death Process: arxiv:131.2968v2 [q-bio.pe] 18 Oct 213 A Coherent Model of Fossil Calibration for Divergence Time Estimation Tracy A. Heath 1,2, John P. Huelsenbeck 1,3,