Phylogenetic Tree Reconstruction
|
|
- Benedict Barber
- 3 years ago
- Views:
Transcription
1 I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye School of Informatics & Computing, IUB
2 Evolution theory Speciation Evolution of new organisms is driven by Mutations The DNA sequence can be changed due to single base changes, deletion/insertion of DNA segments, etc. Selection bias Speciation events lead to creation of different species. Speciation caused by physical separation into groups where different genetic variants become dominant Any two species share a (possibly distant) common ancestor The molecular clock hypothesis Indiana University (Michael Lynch, Jeff Palmer, Matt Hann et al) Lynch: The Origins of Genome Complexity
3 Phylogeny (phylogenetic tree) A phylogenetic tree is a graph reflecting the approximate distances between a set of objects (species, genes, proteins, families) in a hierarchical fashion taxon Aardvark Bison Chimp Dog Elephant Leaves current species; sequences in current species Internal nodes - hypothetical common ancestors Branches (Edges) length - time from one speciation to the next (branching represents speciation into two new species)
4 Phylogenetic trees (binary trees) Rooted tree 6 root time Rooted tree satisfying molecular clock hypothesis: all leaves at same distance from the root. 6 root UMPGA Unrooted tree: Note: 1-5 are called leaves, or leaf nodes. 6-8 are inferred nodes corresponding to ancestral species or molecules. Branches are also called edges. The edge lengths reflect evolutionary distances.
5 Morphological vs. molecular Classical phylogenetic analysis: morphological features: presence or absence of fins, number of legs, lengths of legs, etc. Modern biological methods allow to use molecular features Gene sequences Protein sequences Species tree and gene tree
6 From sequences to phylogenetic tree Rat QEPGGLVVPPTDA.. Rabbit QEPGGMVVPPTDA.. Gorilla QEPGGLVVPPTDA.. Cat REPGGLVVPPTEG.. There are many possible types of sequences to use (e.g. Mitochondrial vs Nuclear proteins).
7 How to choose the best tree? To decide which tree is best we can use an optimality criterion. Parsimony is one such criterion (the other criteria: Maximum likelihood, minimum evolution, bayesian) It chooses the tree which requires the fewest mutations to explain the data. The Principle of Parsimony is the general scientific principle that accepts the simplest of two explanations as preferable.
8 Principle of Parsimony Parsimony based methods look for a tree with the minimum total number of substitutions of symbols between species and their ancestor in the phylogenetic tree. 1 AAG AAA AAA AAA 1 1 GGA AGA Total #substitutions = 3 AGA AAG AAA AGA AAA AAA AAA GGA Total #substitutions = 4 The left tree is preferred over the right tree.
9 Maximum parsimony S1 CACCCCTT S2 AACCCCAT S3 CACTGCTT S4 AACTGCTA (S1,S2),(S3,S4) (S1,S3),(S2,S4) S1 C C S3 S1 C A S2 C A S2 A mutation=2 A S4 S3 C mutation=1 A S4 (S1,S2), (S3, S4) (S1,S3), (S2, S4)
10 We can EASILY get different trees (the reality check paper) Input sequences Multiple alignment programs Substitution models Phylogenetic tree reconstruction methods
11 Trees what might they mean? Species tree Species A Species B Species C Species D Gene tree Seq A Seq D Seq C Seq B
12 Lack of resolution Seq C Seq A Seq D Seq B Weak support, 40% bootstrap for bipartition (AD)(CB) (typical >80%)
13 Long branch attraction (LBA) the two longest branches join together Seq C Seq A Seq D Seq B Strong support, e.g., 100% bootstrap for (AD)(CB)
14 Species tree Gene tree Horizontal gene transfer species A species B Gene Transfer species C species D Seq A Seq D Seq C speciation gene transfer Seq B
15 Species tree Gene tree Duplication Gene duplication & loss Loss species A species B species C species D Seq A Seq B Seq C Seq D Seq B Seq C Seq D A D C B
16 gene duplication Orthologs and paralogs (important for function annotation) Seq A Seq B Seq C Seq D Seq B Seq C Seq D Orthologs: sequences diverged after a speciation event Paralogs: sequences diverged after a duplication event Xenologs: sequences diverged after a horizontal transfer Duplicated genes may have different functions!!
17 Phylogeny (phylogenetic tree) reconstruction: overview Tree topology & branch lengths Computational challenge Huge number of tree topology 3 sequences: 1 (unrooted) 4 sequences: 3 5 sequences: sequences: 2,027, sequences: 221,643,095,476,699,771,875 n sequences (unrooted & rooted)?? Most methods are heuristic Two types of methods Distance based (input: distance matrix; UPGMA & NJ) Character based (input: multiple alignment)
18 Models of evolutionary distance 1. Simplest case: Jukes-Cantor model -- equal probability of change to any nucleotide 2. Other models take into account transitions vs. transversion frequencies -- Kimura: different probabilities for transitions, transversions -- HKY: different probabilities for transitions, transversions & takes into account genomic nucleotide biases A α β α G Transition: R to R Y to Y Transversion: R to Y Y to R C β T where R = A,G Y = C,T
19 Distance based phylogeny reconstruction Phylogeny reconstruction for 3 sequences is EASY There is a single tree topology The branch lengths can be calculated as follows: To compute: branch lengths a, b and c, such that Input: D AB, D BC and D AC (pairwise distances) A B a b c C Output:
20 Fitch-Margoliash (FM) algorithm For phylogeny reconstruction with more than 3 sequences For example, given 5 sequences, A, B, C, D and E. The tree can be reconstructed as follows First choose the closest sequence pair, suppose it is D and E (based on the input pairwise distances; e.g., D DE =10) To calculate the branch lengths from D and E to their common ancestor (denoted as d and e), we combine the remaining three sequences (A, B and C) and treat them as a single composite sequence (and define and so on) -- so again we are dealing with 3 sequences, and we can easily calculate the branch lengths Then merge D and E into a cluster and treat it as a composite sequence, and update the distance table so that and so on. Repeat the above steps until no more clusters to merge
21 Distance based method: UPGMA UPGMA: Unweighted Pair Group Method with Arithmetic Mean Assume same rate evolution (molecular clock hypothesis) The length from root to each leaf is the same (ultra metric). It is similar to Fitch-Margoliash algorithm (merge two most similar sequences or clusters first); but the calculation of branch lengths is even simpler. For example, for the same example shown above with five sequences, d=e=5 (d and e are the branch lengths from sequence D and E to their common ancestor)
22 Neighbor-joining (NJ) (Seitou & Nei algorithm) Minimum evolution -- the least total branch length (distance-based) Bottom-up clustering method Does not assume same rate evolution Fast & produce reasonable trees
23 3 NJ method 3 2 X 4 2 Y X NJ looks for two sequences (clusters) to merge that minimizes: Where C 1 and C 2 are most similar to each other, while they are most dissimilar to the other clusters (far from others)
24 Comparison of FM, UPGMA and NJ methods All are hierarchical clustering methods All define the distance between two clusters as the average pairwise distance FM and NJ do not assume molecular clock ; UPGMA does and it uses a simpler way to calculate branch lengths. UPGMA and FM choose and merge the closest sequence (cluster) pair first, but NJ looks for two sequences (clusters) that are not only close to each other (as in UPGMA and FM) but also far apart from the rest
25 Parsimony based reconstruction 1. A procedure to find the minimum number of changes needed to explain the data for a given tree topology, where species are assigned to leaves. (Small Parsimony Problem) 2. A search through the space of trees. (hard problem!) (Large Parsimony Problem)
26 Small Parsimony Problem Compute the minimum number of mutations on a GIVEN tree Fitch algorithm Sankoff algorithm (subtree; DP)
27 The Fitch Algorithm Pick an arbitrary root to work towards (for unrooted tree) Work from the tips of the tree towards the root. Label each node with the intersection of the states of its child nodes. If the intersection is empty label the node with the union and add one to the cost TC +1 T +1 C C AGC +1 Cost=4 C CT C T= +1 GC +1 C T G C A Calculate Fitch score T C C C T G C A Internal node labeling T
28 Sankoff Algorithm More general than the Fitch algorithm. Assumes we have a table of costs c ab for all possible changes between states a and b (A, T, C or G for DNA) For each node i in the tree we compute S(i,a) the minimal cost given that node i is assigned state a. In particular we can compute the minimum value over a for S(root,a) which will be the cost of the tree.
29 A 0 inf inf inf G inf inf 0 inf Sankoff algorithm: DP G inf inf 0 inf S(i,G)=0 C inf 0 inf inf T inf inf inf 0 T inf inf inf 0 S(i,A) = S(i,T) = c ab A C G T A C G T Initialization: S(i,a) = 0 i labeled by a, or S(i,a) = a {A,T,C,G} Iteration: S(i,a) = min x (S(j,x)+c(a,x)) + min y (S(k,y)+c(a,y)) Termination: min a S(root,a)
30 Large Parsimony Problem The small parsimony problem to find the score of a given tree - can be solved in linear time in the size of the tree. The large parsimony problem is to find the tree with minimum score. It is known to be NP-Hard.
31 Tree search strategies Exact search possible for small n only Branch and Bound Use cleaver rules to avoid some branches of trees up to ~20 (25) taxa Local search - Heuristics Pick a good starting tree and use moves within a neighbourhood to find a better tree; e.g., nearest-neighbor interchanges (NNIs) Meta-heuristics Genetic algorithms Simulated annealing
32 Branch and bound
33 Branch and bound This branch can be safely neglected!
34 Nearest neighbor interchange
35 Probabilistic approaches to phylogeny Rank trees according to their likelihood P(data tree), or, posterior probability P(tree data) (Bayesian) Maximum likelihood methods Sampling methods
36 Calculate likelihood Felsenstein s algorithm for likelihood Initialization: i=2n-1 Recursion: Compute P(L i a) for all a as follows if i is leaf P(L i a)=1 if a is the label of the leaf, otherwise 0 else Compute P(L j a), P(L k a) for all a P(L i a)= b,c P(b a,t j )P(L j b)p(c a,t k )P(L k c) j b i a k c
37 How can one tell if a tree is Biological knowledge significant Bootstrapping: how dependent is the tree on the dataset 1. Randomly choose n objects from your dataset of n, with replacement (picking columns from the alignment at random with replacement) 2. Rebuild the tree based on the subset of the data 3. Repeat many (1,000 10,000) times 4. How often are the same children joined? Jackknifing: how dependent is the tree on the dataset 1. Randomly choose k objects from your dataset of n, without replacement 2. Rebuild the tree based on the subset of the data 3. Repeat many (1,000 10,000) times 4. How often are the same children joined?
38 Commonly used phylogeny packages 369 phylogeny packages ( and 54 free servers (as of Sep 30, 2011) Phylip (general package, protdist, NJ, parsimony, maximum likelihood, etc) PAUP (parsimony) PAML (maximum likelihood) TreePuzzle (quartet based) PhyML (maximum likelihood) MyBayes MEGA (biologist-centric)
39 What a surprise..because of their intrinsic reliance on summary statistics, distance-matrix methods are assumed to be less accurate than likelihood-based approaches. In this paper [Science, 327: , 2010], pairwise sequence comparisons are shown to be more powerful than previously hypothesized. A statistical analysis of certain distance-based techniques indicates that their data requirement for large evolutionary trees essentially matches the conjectured performance of maximum likelihood methods challenging the idea that summary statistics lead to suboptimal analyses.
40 Readings Chapter 7 (Revealing Evolutionary History) Chapter 8 (Building Phylogenetic Trees)
9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
Phylogeny: traditional and Bayesian approaches
Phylogeny: traditional and Bayesian approaches 5-Feb-2014 DEKM book Notes from Dr. B. John Holder and Lewis, Nature Reviews Genetics 4, 275-284, 2003 1 Phylogeny A graph depicting the ancestor-descendent
Evolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
EVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
Phylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction
Estimating Phylogenies (Evolutionary Trees) II. Biol4230 Thurs, March 2, 2017 Bill Pearson Jordan 6-057
Estimating Phylogenies (Evolutionary Trees) II Biol4230 Thurs, March 2, 2017 Bill Pearson wrp@virginia.edu 4-2818 Jordan 6-057 Tree estimation strategies: Parsimony?no model, simply count minimum number
Phylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
Phylogeny. November 7, 2017
Phylogeny November 7, 2017 Phylogenetics Phylon = tribe/race, genetikos = relative to birth Phylogenetics: study of evolutionary relationships among organisms, sequences, or anything in between Related
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Phylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
Bioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
A (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
Additive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive.
Additive distances Let T be a tree on leaf set S and let w : E R + be an edge-weighting of T, and assume T has no nodes of degree two. Let D ij = e P ij w(e), where P ij is the path in T from i to j. Then
Phylogeny Tree Algorithms
Phylogeny Tree lgorithms Jianlin heng, PhD School of Electrical Engineering and omputer Science University of entral Florida 2006 Free for academic use. opyright @ Jianlin heng & original sources for some
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
Phylogeny Jan 5, 2016
גנומיקה חישובית Computational Genomics Phylogeny Jan 5, 2016 Slides: Adi Akavia Nir Friedman s slides at HUJI (based on ALGMB 98) Anders Gorm Pedersen,Technical University of Denmark Sources: Joe Felsenstein
Letter to the Editor. Department of Biology, Arizona State University
Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço jcarrico@fm.ul.pt Charles Darwin (1809-1882) Charles Darwin s tree of life in Notebook B, 1837-1838 Ernst Haeckel (1934-1919)
Molecular Evolution and Phylogenetic Tree Reconstruction
1 4 Molecular Evolution and Phylogenetic Tree Reconstruction 3 2 5 1 4 2 3 5 Orthology, Paralogy, Inparalogs, Outparalogs Phylogenetic Trees Nodes: species Edges: time of independent evolution Edge length
Theory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
CS5263 Bioinformatics. Guest Lecture Part II Phylogenetics
CS5263 Bioinformatics Guest Lecture Part II Phylogenetics Up to now we have focused on finding similarities, now we start focusing on differences (dissimilarities leading to distance measures). Identifying
Lecture 10: Phylogeny
Computational Genomics Prof. Ron Shamir & Prof. Roded Sharan School of Computer Science, Tel Aviv University גנומיקה חישובית פרופ' רון שמיר ופרופ' רודד שרן ביה"ס למדעי המחשב,אוניברסיטת תל אביב Lecture
Plan: Evolutionary trees, characters. Perfect phylogeny Methods: NJ, parsimony, max likelihood, Quartet method
Phylogeny 1 Plan: Phylogeny is an important subject. We have 2.5 hours. So I will teach all the concepts via one example of a chain letter evolution. The concepts we will discuss include: Evolutionary
How to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
Phylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
Inferring phylogeny. Today s topics. Milestones of molecular evolution studies Contributions to molecular evolution
Today s topics Inferring phylogeny Introduction! Distance methods! Parsimony method!"#$%&'(!)* +,-.'/01!23454(6!7!2845*0&4'9#6!:&454(6 ;?@AB=C?DEF Overview of phylogenetic inferences Methodology Methods
Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science
Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.
DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi
DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :
CSCI1950 Z Computa4onal Methods for Biology Lecture 5
CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC
Phylogenetics: Parsimony
1 Phylogenetics: Parsimony COMP 571 Luay Nakhleh, Rice University he Problem 2 Input: Multiple alignment of a set S of sequences Output: ree leaf-labeled with S Assumptions Characters are mutually independent
Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki
Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:
molecular evolution and phylogenetics
molecular evolution and phylogenetics Charlotte Darby Computational Genomics: Applied Comparative Genomics 2.13.18 https://www.thinglink.com/scene/762084640000311296 Internal node Root TIME Branch Leaves
Molecular Evolution & Phylogenetics
Molecular Evolution & Phylogenetics Heuristics based on tree alterations, maximum likelihood, Bayesian methods, statistical confidence measures Jean-Baka Domelevo Entfellner Learning Objectives know basic
A Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
Molecular Evolution, course # Final Exam, May 3, 2006
Molecular Evolution, course #27615 Final Exam, May 3, 2006 This exam includes a total of 12 problems on 7 pages (including this cover page). The maximum number of points obtainable is 150, and at least
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
C.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
Reconstruire le passé biologique modèles, méthodes, performances, limites
Reconstruire le passé biologique modèles, méthodes, performances, limites Olivier Gascuel Centre de Bioinformatique, Biostatistique et Biologie Intégrative C3BI USR 3756 Institut Pasteur & CNRS Reconstruire
Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony
ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),
7. Tests for selection
Sequence analysis and genomics 7. Tests for selection Dr. Katja Nowick Group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute for Brain Research www. nowicklab.info
Effects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
Chapter 3: Phylogenetics
Chapter 3: Phylogenetics 3. Computing Phylogeny Prof. Yechiam Yemini (YY) Computer Science epartment Columbia niversity Overview Computing trees istance-based techniques Maximal Parsimony (MP) techniques
Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT
Inferring phylogeny Constructing phylogenetic trees Tõnu Margus Contents What is phylogeny? How/why it is possible to infer it? Representing evolutionary relationships on trees What type questions questions
Thanks to Paul Lewis and Joe Felsenstein for the use of slides
Thanks to Paul Lewis and Joe Felsenstein for the use of slides Review Hennigian logic reconstructs the tree if we know polarity of characters and there is no homoplasy UPGMA infers a tree from a distance
Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
Week 5: Distance methods, DNA and protein models
Week 5: Distance methods, DNA and protein models Genome 570 February, 2016 Week 5: Distance methods, DNA and protein models p.1/69 A tree and the expected distances it predicts E A 0.08 0.05 0.06 0.03
Inferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies
Inferring Phylogenetic Trees Distance Approaches Representing distances in rooted and unrooted trees The distance approach to phylogenies given: an n n matrix M where M ij is the distance between taxa
Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches
Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell
CHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
Seuqence Analysis '17--lecture 10. Trees types of trees Newick notation UPGMA Fitch Margoliash Distance vs Parsimony
Seuqence nalysis '17--lecture 10 Trees types of trees Newick notation UPGM Fitch Margoliash istance vs Parsimony Phyogenetic trees What is a phylogenetic tree? model of evolutionary relationships -- common
Bootstrap confidence levels for phylogenetic trees B. Efron, E. Halloran, and S. Holmes, 1996
Bootstrap confidence levels for phylogenetic trees B. Efron, E. Halloran, and S. Holmes, 1996 Following Confidence limits on phylogenies: an approach using the bootstrap, J. Felsenstein, 1985 1 I. Short
Consistency Index (CI)
Consistency Index (CI) minimum number of changes divided by the number required on the tree. CI=1 if there is no homoplasy negatively correlated with the number of species sampled Retention Index (RI)
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2009 University of California, Berkeley
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2009 University of California, Berkeley B.D. Mishler Jan. 22, 2009. Trees I. Summary of previous lecture: Hennigian
Using algebraic geometry for phylogenetic reconstruction
Using algebraic geometry for phylogenetic reconstruction Marta Casanellas i Rius (joint work with Jesús Fernández-Sánchez) Departament de Matemàtica Aplicada I Universitat Politècnica de Catalunya IMA
Reconstruction of certain phylogenetic networks from their tree-average distances
Reconstruction of certain phylogenetic networks from their tree-average distances Stephen J. Willson Department of Mathematics Iowa State University Ames, IA 50011 USA swillson@iastate.edu October 10,
Phylogeny and Molecular Evolution. Introduction
Phylogeny and Molecular Evolution Introduction 1 2/62 3/62 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir,
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
CSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary
CSCI1950 Z Computa4onal Methods for Biology Lecture 4 Ben Raphael February 2, 2009 hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary Parsimony Probabilis4c Method Input Output Sankoff s & Fitch
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1. Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1 Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003 Lecturer: Wing-Kin Sung Scribe: Ning K., Shan T., Xiang
Michael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D
7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood
Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis
Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila
HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM
I529: Machine Learning in Bioinformatics (Spring 2017) HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University, Bloomington
Phylogenetic Networks, Trees, and Clusters
Phylogenetic Networks, Trees, and Clusters Luay Nakhleh 1 and Li-San Wang 2 1 Department of Computer Science Rice University Houston, TX 77005, USA nakhleh@cs.rice.edu 2 Department of Biology University
Lecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
Algorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,
Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837
Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)
Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from
Phylogeny. Properties of Trees. Properties of Trees. Trees represent the order of branching only. Phylogeny: Taxon: a unit of classification
Multiple sequence alignment global local Evolutionary tree reconstruction Pairwise sequence alignment (global and local) Substitution matrices Gene Finding Protein structure prediction N structure prediction
Bioinformatics course
Bioinformatics course Phylogeny and Comparative genomics 10/23/13 1 Contents-phylogeny Introduction-biology, life classificationtaxonomy Phylogenetic-tree of life, tree representation Why study phylogeny?
The Phylogenetic Handbook
The Phylogenetic Handbook A Practical Approach to DNA and Protein Phylogeny Edited by Marco Salemi University of California, Irvine and Katholieke Universiteit Leuven, Belgium and Anne-Mieke Vandamme Rega
A Minimum Spanning Tree Framework for Inferring Phylogenies
A Minimum Spanning Tree Framework for Inferring Phylogenies Daniel Giannico Adkins Electrical Engineering and Computer Sciences University of California at Berkeley Technical Report No. UCB/EECS-010-157
3/1/17. Content. TWINSCAN model. Example. TWINSCAN algorithm. HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM
I529: Machine Learning in Bioinformatics (Spring 2017) Content HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University,
Phylogenetics: Bayesian Phylogenetic Analysis. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Bayesian Phylogenetic Analysis COMP 571 - Spring 2015 Luay Nakhleh, Rice University Bayes Rule P(X = x Y = y) = P(X = x, Y = y) P(Y = y) = P(X = x)p(y = y X = x) P x P(X = x 0 )P(Y = y X
Evolutionary Trees. Evolutionary tree. To describe the evolutionary relationship among species A 3 A 2 A 4. R.C.T. Lee and Chin Lung Lu
Evolutionary Trees R.C.T. Lee and Chin Lung Lu CS 5313 Algorithms for Molecular Biology Evolutionary Trees p.1 Evolutionary tree To describe the evolutionary relationship among species Root A 3 Bifurcating
Page 1. Evolutionary Trees. Why build evolutionary tree? Outline
Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny
TheDisk-Covering MethodforTree Reconstruction
TheDisk-Covering MethodforTree Reconstruction Daniel Huson PACM, Princeton University Bonn, 1998 1 Copyright (c) 2008 Daniel Huson. Permission is granted to copy, distribute and/or modify this document
How should we go about modeling this? Model parameters? Time Substitution rate Can we observe time or subst. rate? What can we observe?
How should we go about modeling this? gorilla GAAGTCCTTGAGAAATAAACTGCACACACTGG orangutan GGACTCCTTGAGAAATAAACTGCACACACTGG Model parameters? Time Substitution rate Can we observe time or subst. rate? What