Supporting online material

Size: px
Start display at page:

Download "Supporting online material"

Transcription

1 Supporting online material Materials and Methods Target proteins All predicted ORFs in the E. coli genome (1) were downloaded from the Colibri data base (2) ( 737 proteins longer than 100 residues and with 2 or more transmembrane helices predicted by TMHMM (3) (v. 2.0) were retained. 23 of the corresponding genes contained restriction sites that prevented cloning into either of the three standard phoa or two gfp vectors (4) used, reducing the final collection of target proteins to 714. Cloning ORFs encoding the selected membrane proteins were amplified by PCR from the E. coli strain MG1655 (1). Three different combinations of primer-introduced restriction sites and correspondingly digested vectors were used: (i) 5 XhoI / 3 KpnI, (ii) 5 XhoI / 3 BamHI, (iii) 5 NdeI / 3 BamHI. Cloning was performed in E. coli strains MC1061 or TOP10F. The three phoa fusion vectors contain the gene of interest, followed by a short linker sequence and the region coding for the phoa gene. The gfp fusion vectors contain the gene of interest, followed by a linker sequence encoding a TEV protease site, the gfp gene (S65T, F64L + Cycle 3 mutant) and a His 8 tag at the 3 end. All genes are preceded by the same ribosome binding site and the start codon is always ATG. The vectors and enzymes used are described in detail elsewhere (4). All constructs were confirmed by sequencing from both the 5 and 3 ends. Protein expression and experimental determination of C-terminal locations PhoA and GFP assays were repeated at least 3, but in general 4 times. Constructs encoding PhoA fusions were transformed into the CC118 strain and assayed as described previously (4). Cell density and PhoA activity were measured using a SpectraMaxPlus384 (Molecular Devices, California). Constructs encoding GFP fusions were transformed into the BL21(DE3)pLysS strain and assayed as described (4, 5) with minor adaptations. Overnight cultures were back-diluted into 5 ml of LB media in 24 well growth plates. Cultures were grown at 37 C to an OD 600 of approximately , then induced with 0.4 mm IPTG, and grown for an additional 2 h. The cell pellet was resuspended in GFP resuspension buffer (50 mm Tris-HCl ph 8.0, 200 mm NaCl, 15 mm EDTA), incubated at room temperature for 2 h, and assayed for GFP fluorescence. Fluorescence was measured with an excitation wavelength of 485 nm, emission wavelength of 512 nm, and a 495 nm cutoff filter in a SpectraMaxGemini EM (Molecular Devices, California).

2 Normalization of obtained values was carried out to allow for a quantitative comparison between the GFP and PhoA measurements. The raw GFP activity value for each fusion was first divided by the cell density (OD 600 ). PhoA and GFP activities were then divided by the median activity of the active PhoA or GFP fusions (347 units for PhoA, 3924 arbitrary units for GFP). Cutoff values for C-terminal assignments were determined by the following procedure (see Fig. 1 in the main text): First, all pairs of C-terminally aligned homologues among the 573 proteins for which both PhoA and GFP clones were available were identified. Homologues were defined by proteins with a pair-wise BLAST E-value < 10-4 and for which the BLAST alignment reached to within 25 residues of the C-termini to ensure that no extra C-terminal TMHs are present in one or the other protein. To define the cutoffs, the two 45 o lines in Fig. 1 were moved symmetrically towards the main diagonal; for each location of the lines (defined by the intersections (a,0) and (0,a) with the x- and y-axis), all proteins located above the upper cutoff line were assigned as C in, and all proteins located below the lower cutoff line were assigned as C out. The a-value was reduced from its starting value a = 1.5 until a pair of C-terminally aligned homologues (as defined above) was found where one was assigned C out and the other C in ; this happened for a = 0.2 (the YdgQ-YdgL pair (6) and proteins in the SMR family were excluded), and the final cutoff value was set to a = 0.3. For proteins where only one fusion (PhoA or GFP) was available, the cutoff value was set to a = 0.75, as < 1% of the proteins for which both PhoA and GFP fusions were available would have been mis-assigned with this cutoff had only one of the two fusions been available, Fig. 1. Topology prediction Unconstrained topology predictions were done using TMHMM (3) (v. 2.0). Constrained topology predictions were done as described (7) by fixing the C-terminus of the protein to its experimentally determined location before running TMHMM ( S3 reliability scores were calculated as described (7). Functional assignments Proteins were grouped into one of nine functional categories (biogenesis (B), channel (C), transport/efflux (E) flagellar (F), lipid (L), bioenergetics/metabolism (M), signaling (S), transport/influx (T) or unknown (U)) depending on their known or predicted function. Initially, functional annotations were collected from the Colibri (2) ( and SwissProt (8) ( databases. Those proteins whose function was still unknown were then searched against the literature and were assigned to the functional categories based on published information.

3 References 1. F. R. Blattner et al., Science 277, 1453 (1997). 2. C. Medigue, A. Viari, A. Henaut, A. Danchin, Microbiol Rev 57, 623 (1993). 3. A. Krogh, B. Larsson, G. von Heijne, E. Sonnhammer, J Mol Biol 305, 567 (2001). 4. M. Rapp et al., Prot Sci 13, 937 (2004). 5. D. Drew et al., Proc Natl Acad Sci USA 99, 2690 (2002). 6. A. Sääf, M. Johansson, E. Wallin, G. von Heijne, Proc Natl Acad Sci USA 96, 8540 (1999). 7. K. Melén, A. Krogh, G. von Heijne, J Mol Biol 327, 735 (2003). 8. A. Bairoch, B. Boeckmann, Nucl Acids Res 19, 2247 (1991).

4 Figure S1. TMHMM topology prediction for YjfL before (top) and after (bottom) the C-terminus has been fixed to its experimentally determined location ( Probabilities for inside loop is in blue, for outside loop in pink, and for transmembrane helix in red. The overall reliability score (S3) is shown (K. Melén, A. Krogh, G. von Heijne, J Mol Biol 327, 735 (2003).).

5 Figure S2. Normalised PhoA and GFP activity data for dual topology candidates and pairs of homologous proteins with opposite topologies (connected by lines), c.f. Fig. 1 in the main text. The YdgQ-YdgL pair has been described earlier (A. Sääf, M. Johansson, E. Wallin, G. von Heijne (1999) Proc Natl Acad Sci USA 96, 8540).

6 Table S2. Sequence characteristics and their correlation coefficients (R) against overexpression levels (GFP/ml) and ΔOD 600. GFP/ml ΔOD 600 Sequence Length Number of TM helices Reliability score Membrane content (residues in membrane/sequence length) Length of N-tail (residues before first TM) Length of N-tail/sequence length Average hydrophobicity, GES scale (Engelman, D.M., Steitz,T.A. & Goldman, A. Annu. Rev. Biophys. Biophys. Chem : ) Minimum hydrophobicity (19 consecutive most hydrophilic residues) Max hydrophobic region (41 residues) Min hydrophobic region (41 residues) Average Codon Usage (CU) (Calculated using GenBank release 140, Nucl Acids Res :23-26) E. coli K12 CU table from Min CU over 5 codons Min CU over 10 codons Average CU of first 40 codons Average CU of first 20 codons Positive residues in N-tail Negative residues in N-tail Length of longest inside loop (The longest loop between two TMs that is predicted to be on the inside) Length of longest outside loop Length of longest inside loop/sequence length Length of longest outside loop/sequence length Average hydrophobicity of N-tail Positive residues inside (number of positive amino acids predicted to be inside) Negative residues inside Pos residues inside/length Neg residues inside/length Positive residues outside Negative residues outside Pos residues outside/length Neg residues outside/length Pos residues in longest inside loop Neg residues in longest inside loop Pos residues in longest outside loop Neg residues in longest outside loop

Tellurite resistance protein/ethidium efflux transporter/ proflavin transporter. Putative inner membrane protein: function unknown

Tellurite resistance protein/ethidium efflux transporter/ proflavin transporter. Putative inner membrane protein: function unknown Additional file 1. Table S1 and Figures S1-4 of Zhang et al. High-level production of membrane proteins in E. coli BL21(DE3) by omitting the inducer IPTG Table S1. Properties of the membrane proteins used

More information

Reliability Measures for Membrane Protein Topology Prediction Algorithms

Reliability Measures for Membrane Protein Topology Prediction Algorithms doi:10.1016/s0022-2836(03)00182-7 J. Mol. Biol. (2003) 327, 735 744 Reliability Measures for Membrane Protein Topology Prediction Algorithms Karin Melén 1, Anders Krogh 2 and Gunnar von Heijne 1 * 1 Department

More information

Public Database 의이용 (1) - SignalP (version 4.1)

Public Database 의이용 (1) - SignalP (version 4.1) Public Database 의이용 (1) - SignalP (version 4.1) 2015. 8. KIST 이철주 Secretion pathway prediction ProteinCenter (Proxeon Bioinformatics, Odense, Denmark; http://www.cbs.dtu.dk/services) SignalP (version 4.1)

More information

Secondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure

Secondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted

More information

Tiffany Samaroo MB&B 452a December 8, Take Home Final. Topic 1

Tiffany Samaroo MB&B 452a December 8, Take Home Final. Topic 1 Tiffany Samaroo MB&B 452a December 8, 2003 Take Home Final Topic 1 Prior to 1970, protein and DNA sequence alignment was limited to visual comparison. This was a very tedious process; even proteins with

More information

TMHMM2.0 User's guide

TMHMM2.0 User's guide TMHMM2.0 User's guide This program is for prediction of transmembrane helices in proteins. July 2001: TMHMM has been rated best in an independent comparison of programs for prediction of TM helices: S.

More information

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK

More information

Full-length GlpG sequence was generated by PCR from E. coli genomic DNA. (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),

Full-length GlpG sequence was generated by PCR from E. coli genomic DNA. (with two sequence variations, D51E/L52V, from the gene bank entry aac28166), Supplementary Methods Protein expression and purification Full-length GlpG sequence was generated by PCR from E. coli genomic DNA (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),

More information

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature17991 Supplementary Discussion Structural comparison with E. coli EmrE The DMT superfamily includes a wide variety of transporters with 4-10 TM segments 1. Since the subfamilies of the

More information

Genome Annotation Project Presentation

Genome Annotation Project Presentation Halogeometricum borinquense Genome Annotation Project Presentation Loci Hbor_05620 & Hbor_05470 Presented by: Mohammad Reza Najaf Tomaraei Hbor_05620 Basic Information DNA Coordinates: 527,512 528,261

More information

A novel method for predicting transmembrane segments in proteins based on a statistical analysis of the SwissProt database: the PRED-TMR algorithm

A novel method for predicting transmembrane segments in proteins based on a statistical analysis of the SwissProt database: the PRED-TMR algorithm Protein Engineering vol.12 no.5 pp.381 385, 1999 COMMUNICATION A novel method for predicting transmembrane segments in proteins based on a statistical analysis of the SwissProt database: the PRED-TMR algorithm

More information

Structure of the SPRY domain of human DDX1 helicase, a putative interaction platform within a DEAD-box protein

Structure of the SPRY domain of human DDX1 helicase, a putative interaction platform within a DEAD-box protein Supporting information Volume 71 (2015) Supporting information for article: Structure of the SPRY domain of human DDX1 helicase, a putative interaction platform within a DEAD-box protein Julian Kellner

More information

Dynamic optimisation identifies optimal programs for pathway regulation in prokaryotes. - Supplementary Information -

Dynamic optimisation identifies optimal programs for pathway regulation in prokaryotes. - Supplementary Information - Dynamic optimisation identifies optimal programs for pathway regulation in prokaryotes - Supplementary Information - Martin Bartl a, Martin Kötzing a,b, Stefan Schuster c, Pu Li a, Christoph Kaleta b a

More information

Scale in the biological world

Scale in the biological world Scale in the biological world 2 A cell seen by TEM 3 4 From living cells to atoms 5 Compartmentalisation in the cell: internal membranes and the cytosol 6 The Origin of mitochondria: The endosymbion hypothesis

More information

7.06 Cell Biology EXAM #3 April 21, 2005

7.06 Cell Biology EXAM #3 April 21, 2005 7.06 Cell Biology EXAM #3 April 21, 2005 This is an open book exam, and you are allowed access to books, a calculator, and notes but not computers or any other types of electronic devices. Please write

More information

An Introduction to Sequence Similarity ( Homology ) Searching

An Introduction to Sequence Similarity ( Homology ) Searching An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,

More information

Sequence analysis and comparison

Sequence analysis and comparison The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species

More information

Supporting Information

Supporting Information Supporting Information Mullins et al. 10.1073/pnas.0906781106 SI Text Detection of Calcium Binding by 45 Ca 2 Overlay. The 45 CaCl 2 (1 mci, 37 MBq) was obtained from NEN. The general method of 45 Ca 2

More information

Markov Models & DNA Sequence Evolution

Markov Models & DNA Sequence Evolution 7.91 / 7.36 / BE.490 Lecture #5 Mar. 9, 2004 Markov Models & DNA Sequence Evolution Chris Burge Review of Markov & HMM Models for DNA Markov Models for splice sites Hidden Markov Models - looking under

More information

lac permease of Escherichia coli: Topology and sequence elements promoting membrane insertion

lac permease of Escherichia coli: Topology and sequence elements promoting membrane insertion Proc. Natl. Acad. Sci. USA Vol. 87, pp. 4937-4941, July 1990 Genetics lac permease of Escherichia coli: Topology and sequence elements promoting membrane insertion (membrane-spanning segment/gene fusion/alkaline

More information

Improved membrane protein topology prediction by domain assignments

Improved membrane protein topology prediction by domain assignments Improved membrane protein topology prediction by domain assignments ANDREAS BERNSEL AND GUNNAR VON HEIJNE Department of Biochemistry and Biophysics, Stockholm University, SE-106 91 Stockholm, Sweden Stockholm

More information

Direct detection of antibodies in blood plasma using bioluminescent

Direct detection of antibodies in blood plasma using bioluminescent Supplementary information Direct detection of antibodies in blood plasma using bioluminescent sensor proteins and a smartphone. Remco Arts, Ilona den Hartog, Stefan Zijlema, Vito Thijssen, Stan van der

More information

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding

More information

Structure Prediction of Membrane Proteins. Introduction. Secondary Structure Prediction and Transmembrane Segments Topology Prediction

Structure Prediction of Membrane Proteins. Introduction. Secondary Structure Prediction and Transmembrane Segments Topology Prediction Review Structure Prediction of Membrane Proteins Chunlong Zhou 1, Yao Zheng 2, and Yan Zhou 1 * 1 Hangzhou Genomics Institute/James D. Watson Institute of Genome Sciences, Zhejiang University/Key Laboratory

More information

Evidence for cyclic-di-gmp-mediated signaling pathway in Bacillus subtilis by Chen Y. et al.

Evidence for cyclic-di-gmp-mediated signaling pathway in Bacillus subtilis by Chen Y. et al. Supplemental materials for Evidence for cyclic-di-gmp-mediated signaling pathway in Bacillus subtilis by Chen Y. et al. 1. Table S1. Strains used in this study 2. Table S2. Plasmids used in this study

More information

High-resolution crystal structure of ERAP1 with bound phosphinic transition-state analogue inhibitor

High-resolution crystal structure of ERAP1 with bound phosphinic transition-state analogue inhibitor High-resolution crystal structure of ERAP1 with bound phosphinic transition-state analogue inhibitor Petros Giastas 1, Margarete Neu 2, Paul Rowland 2, and Efstratios Stratikos 1 1 National Center for

More information

Multi-Scale Hierarchical Structure Prediction of Helical Transmembrane Proteins

Multi-Scale Hierarchical Structure Prediction of Helical Transmembrane Proteins Multi-Scale Hierarchical Structure Prediction of Helical Transmembrane Proteins Zhong Chen Dept. of Biochemistry and Molecular Biology University of Georgia, Athens, GA 30602 Email: zc@csbl.bmb.uga.edu

More information

Enhanced membrane protein topology prediction using a hierarchical classification method and a new scoring function

Enhanced membrane protein topology prediction using a hierarchical classification method and a new scoring function Enhanced membrane protein topology prediction using a hierarchical classification method and a new scoring function Allan Lo 1, 2, Hua-Sheng Chiu 3, Ting-Yi Sung 3, Ping-Chiang Lyu 2, and Wen-Lian Hsu

More information

SUPPLEMENTARY MATERIALS

SUPPLEMENTARY MATERIALS SUPPLEMENTARY MATERIALS Enhanced Recognition of Transmembrane Protein Domains with Prediction-based Structural Profiles Baoqiang Cao, Aleksey Porollo, Rafal Adamczak, Mark Jarrell and Jaroslaw Meller Contact:

More information

A transcription activator-like effector induction system mediated by proteolysis

A transcription activator-like effector induction system mediated by proteolysis SUPPLEMENTARY INFORMATION A transcription activator-like effector induction system mediated by proteolysis Matthew F. Copeland 1,2, Mark C. Politz 1, Charles B. Johnson 1,3, Andrew L. Markley 1, Brian

More information

Supramolecular stabilization of the acid tolerant L-arabinose isomerase from the food-grade Lactobacillus sakei

Supramolecular stabilization of the acid tolerant L-arabinose isomerase from the food-grade Lactobacillus sakei Supporting Information Supramolecular stabilization of the acid tolerant L-arabinose isomerase from the food-grade Lactobacillus sakei Said Jebors a, Yannick Tauran a, Nushin Aghajari b, Samira Boudebbouze

More information

A Machine Text-Inspired Machine Learning Approach for Identification of Transmembrane Helix Boundaries

A Machine Text-Inspired Machine Learning Approach for Identification of Transmembrane Helix Boundaries A Machine Text-Inspired Machine Learning Approach for Identification of Transmembrane Helix Boundaries Betty Yee Man Cheng 1, Jaime G. Carbonell 1, and Judith Klein-Seetharaman 1, 2 1 Language Technologies

More information

EST1 Homology Domain. 100 aa. hest1a / SMG6 PIN TPR TPR. Est1-like DBD? hest1b / SMG5. TPR-like TPR. a helical. hest1c / SMG7.

EST1 Homology Domain. 100 aa. hest1a / SMG6 PIN TPR TPR. Est1-like DBD? hest1b / SMG5. TPR-like TPR. a helical. hest1c / SMG7. hest1a / SMG6 EST1 Homology Domain 100 aa 853 695 761 780 1206 hest1 / SMG5 -like? -like 109 145 214 237 497 165 239 1016 114 207 212 381 583 hest1c / SMG7 a helical 1091 Sc 57 185 267 284 699 Figure S1:

More information

Chapter 12: Intracellular sorting

Chapter 12: Intracellular sorting Chapter 12: Intracellular sorting Principles of intracellular sorting Principles of intracellular sorting Cells have many distinct compartments (What are they? What do they do?) Specific mechanisms are

More information

Production of Recombinant Annexin V from plasmid pet12a-papi

Production of Recombinant Annexin V from plasmid pet12a-papi Tait Research Laboratory Page 1 of 5 Principle Production of Recombinant Annexin V from plasmid pet12a-papi Annexin V is expressed cytoplasmically in BL21(DE3) E. coli (Novagen) with the pet vector system

More information

Supporting Online Material for

Supporting Online Material for www.sciencemag.org/cgi/content/full/1121356/dc1 Supporting Online Material for Polar PIN Localization Directs Auxin Flow in Plants Justyna Wiśniewska, Jian Xu, Daniela Seifertová, Philip B. Brewer, Kamil

More information

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-

More information

Optimization of the heme biosynthesis pathway for the production of. 5-aminolevulinic acid in Escherichia coli

Optimization of the heme biosynthesis pathway for the production of. 5-aminolevulinic acid in Escherichia coli Supplementary Information Optimization of the heme biosynthesis pathway for the production of 5-aminolevulinic acid in Escherichia coli Junli Zhang 1,2,3, Zhen Kang 1,2,3, Jian Chen 2,3 & Guocheng Du 2,4

More information

Green uorescent protein as an indicator to monitor membrane protein overexpression in Escherichia coli

Green uorescent protein as an indicator to monitor membrane protein overexpression in Escherichia coli FEBS Letters 507 (2001) 220^224 FEBS 25374 Green uorescent protein as an indicator to monitor membrane protein overexpression in Escherichia coli David E. Drew, Gunnar von Heijne, Pa«r Nordlund, Jan-Willem

More information

Supporting Information

Supporting Information Protein-Observed Fluorine NMR is a Complementary Ligand Discovery Method to 1 H CPMG Ligand- Observed NMR. Andrew K. Urick, 1,2 Luis Pablo Calle, 3 Juan F. Espinosa, 3 Haitao Hu, 2 * William C. K. Pomerantz

More information

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1 Supplementary Figure 1 Chemical structure of LPS and LPS biogenesis in Gram-negative bacteria. a. Chemical structure of LPS. LPS molecule consists of Lipid A, core oligosaccharide and O-antigen. The polar

More information

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

1. Statement of the Problem

1. Statement of the Problem Recognizing Patterns in Protein Sequences Using Iteration-Performing Calculations in Genetic Programming John R. Koza Computer Science Department Stanford University Stanford, CA 94305-2140 USA Koza@CS.Stanford.Edu

More information

Prediction of signal peptides and signal anchors by a hidden Markov model

Prediction of signal peptides and signal anchors by a hidden Markov model In J. Glasgow et al., eds., Proc. Sixth Int. Conf. on Intelligent Systems for Molecular Biology, 122-13. AAAI Press, 1998. 1 Prediction of signal peptides and signal anchors by a hidden Markov model Henrik

More information

Lipid transfer proteins confer resistance to trichothecenes

Lipid transfer proteins confer resistance to trichothecenes Lipid transfer proteins confer resistance to trichothecenes John McLaughlin and Anwar Bin-Umer Tumer Laboratory National Fusarium Head Blight Forum December 6th, 2012 FY09-11: Identify trichothecene resistance

More information

Resonance Assignment of the RGS Domain of Human RGS10

Resonance Assignment of the RGS Domain of Human RGS10 Resonance Assignment of the RGS Domain of Human RGS10 Oleg Y. Fedorov 2, Victoria A. Higman 1, Peter Schmieder 1, Martina Leidert 1, Annette Diehl 1, Jonathan Elkins 2, Meera Soundararajan 2, Hartmut Oschkinat

More information

Introduction to protein alignments

Introduction to protein alignments Introduction to protein alignments Comparative Analysis of Proteins Experimental evidence from one or more proteins can be used to infer function of related protein(s). Gene A Gene X Protein A compare

More information

Illegitimate translation causes unexpected gene expression from on-target out-of-frame alleles

Illegitimate translation causes unexpected gene expression from on-target out-of-frame alleles Illegitimate translation causes unexpected gene expression from on-target out-of-frame alleles created by CRISPR-Cas9 Shigeru Makino, Ryutaro Fukumura, Yoichi Gondo* Mutagenesis and Genomics Team, RIKEN

More information

Supporting Information

Supporting Information Supporting Information Horner et al. 10.1073/pnas.1213857110 SI Materials and Methods Cell Washing Methodology. To determine the validity of the cellular Cd isotope compositions, a series of tests examining

More information

Topology Prediction of Helical Transmembrane Proteins: How Far Have We Reached?

Topology Prediction of Helical Transmembrane Proteins: How Far Have We Reached? 550 Current Protein and Peptide Science, 2010, 11, 550-561 Topology Prediction of Helical Transmembrane Proteins: How Far Have We Reached? Gábor E. Tusnády and István Simon* Institute of Enzymology, BRC,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary materials Figure S1 Fusion protein of Sulfolobus solfataricus SRP54 and a signal peptide. a, Expression vector for the fusion protein. The signal peptide of yeast dipeptidyl aminopeptidase

More information

chapter 5 the mammalian cell entry 1 (mce1) operon of Mycobacterium Ieprae and Mycobacterium tuberculosis

chapter 5 the mammalian cell entry 1 (mce1) operon of Mycobacterium Ieprae and Mycobacterium tuberculosis chapter 5 the mammalian cell entry 1 (mce1) operon of Mycobacterium Ieprae and Mycobacterium tuberculosis chapter 5 Harald G. Wiker, Eric Spierings, Marc A. B. Kolkman, Tom H. M. Ottenhoff, and Morten

More information

A protein oxidase catalysing disulfide bond formation is localized to the chloroplast thylakoids

A protein oxidase catalysing disulfide bond formation is localized to the chloroplast thylakoids A protein oxidase catalysing disulfide bond formation is localized to the chloroplast thylakoids Wei-Ke Feng 1, *, Liang Wang 1, *, Ying Lu 1 and Xiao-Yun Wang 1,2 1 College of Life Science, Shandong Agricultural

More information

A Gene (sleb) Encoding a Spore Cortex-Lytic Enzyme from Bacillus subtilis and Response of the Enzyme to

A Gene (sleb) Encoding a Spore Cortex-Lytic Enzyme from Bacillus subtilis and Response of the Enzyme to JOURNAL OF BACTERIOLOGY, Oct. 1996, p. 6059 6063 Vol. 178, No. 20 0021-9193/96/$04.00 0 Copyright 1996, American Society for Microbiology A Gene (sleb) Encoding a Spore Cortex-Lytic Enzyme from Bacillus

More information

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and

More information

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic

More information

Genome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting.

Genome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting. Genome Annotation Bioinformatics and Computational Biology Genome Annotation Frank Oliver Glöckner 1 Genome Analysis Roadmap Genome sequencing Assembly Gene prediction Protein targeting trna prediction

More information

Transmembrane Domains (TMDs) of ABC transporters

Transmembrane Domains (TMDs) of ABC transporters Transmembrane Domains (TMDs) of ABC transporters Most ABC transporters contain heterodimeric TMDs (e.g. HisMQ, MalFG) TMDs show only limited sequence homology (high diversity) High degree of conservation

More information

It s really this simple.

It s really this simple. Background Light harvesting complexes exist to facilitate and maximize the absorption capacity of the reaction centers (RC) as well as PSI and PSII Purple bacteria utilize these functions by having an

More information

7.06 Cell Biology EXAM #3 KEY

7.06 Cell Biology EXAM #3 KEY 7.06 Cell Biology EXAM #3 KEY May 2, 2006 This is an OPEN BOOK exam, and you are allowed access to books, a calculator, and notes BUT NOT computers or any other types of electronic devices. Please write

More information

Helical Macrofiber Formation in Bacillus subtilis: Inhibition by Penicillin G

Helical Macrofiber Formation in Bacillus subtilis: Inhibition by Penicillin G JOURNAL OF BACTERIOLOGY, June 1984, p. 1182-1187 0021-9193/84/061182-06$02.00/0 Copyright C 1984, American Society for Microbiology Vol. 158, No. 3 Helical Macrofiber Formation in Bacillus subtilis: Inhibition

More information

A hidden Markov model for predicting transmembrane helices in protein sequences

A hidden Markov model for predicting transmembrane helices in protein sequences Procedings of ISMB 6, 1998, pages 175-182 A hidden Markov model for predicting transmembrane helices in protein sequences Erik L.L. Sonnhammer National Center for Biotechnology Information Building 38A,

More information

Analysis of Escherichia coli amino acid transporters

Analysis of Escherichia coli amino acid transporters Ph.D thesis Analysis of Escherichia coli amino acid transporters Presented by Attila Szvetnik Supervisor: Dr. Miklós Kálmán Biology Ph.D School University of Szeged Bay Zoltán Foundation for Applied Research

More information

Supporting Online Material. On-Chip Dielectrophoretic Co-Assembly of Live Cells and. Particles into Responsive Biomaterials

Supporting Online Material. On-Chip Dielectrophoretic Co-Assembly of Live Cells and. Particles into Responsive Biomaterials Supporting Online Material On-Chip Dielectrophoretic Co-Assembly of Live Cells and Particles into esponsive Biomaterials Shalini Gupta, ossitza G. Alargova, Peter K. Kilpatrick and Orlin D. Velev* Description

More information

Cell-free and in vivo characterization of Lux, Las, and Rpa quorum activation systems in E. coli Supporting Information

Cell-free and in vivo characterization of Lux, Las, and Rpa quorum activation systems in E. coli Supporting Information Cell-free and in vivo characterization of Lux, Las, and Rpa quorum activation systems in E. coli Supporting Information Andrew D. Halleran 1 and Richard M. Murray 1, 2 1. Biology and Biological Engineering,

More information

09/07/16 12/07/16: 14/07/16:

09/07/16 12/07/16: 14/07/16: 09/07/16 Transformation of DH5 alpha with the InterLab transformation protocol : DNA constructions were dried, so we resuspended them into 100µL nuclease-free water. We took 5µL of the product for 25µL

More information

GFP-based pipelines for the overexpression and purification of membrane proteins. David Drew

GFP-based pipelines for the overexpression and purification of membrane proteins. David Drew GFP-based pipelines for the overexpression and purification of membrane proteins David Drew 1. Produc0on, Purifica0on, Crystalliza0on (Talk 1) GFP- based E. coli pipeline - Bacterial proteins GFP- based

More information

Supporting information for

Supporting information for Supporting information for Rewiring multi-domain protein switches: transforming a fluorescent Zn 2+ -sensor into a light-responsive Zn 2+ binding protein Stijn J.A. Aper and Maarten Merkx Laboratory of

More information

MOLECULAR CELL BIOLOGY

MOLECULAR CELL BIOLOGY 1 Lodish Berk Kaiser Krieger scott Bretscher Ploegh Matsudaira MOLECULAR CELL BIOLOGY SEVENTH EDITION CHAPTER 13 Moving Proteins into Membranes and Organelles Copyright 2013 by W. H. Freeman and Company

More information

Supplementary materials Quantitative assessment of ribosome drop-off in E. coli

Supplementary materials Quantitative assessment of ribosome drop-off in E. coli Supplementary materials Quantitative assessment of ribosome drop-off in E. coli Celine Sin, Davide Chiarugi, Angelo Valleriani 1 Downstream Analysis Supplementary Figure 1: Illustration of the core steps

More information

ydci GTC TGT TTG AAC GCG GGC GAC TGG GCG CGC AAT TAA CGG TGT GTA GGC TGG AGC TGC TTC

ydci GTC TGT TTG AAC GCG GGC GAC TGG GCG CGC AAT TAA CGG TGT GTA GGC TGG AGC TGC TTC Table S1. DNA primers used in this study. Name ydci P1ydcIkd3 Sequence GTC TGT TTG AAC GCG GGC GAC TGG GCG CGC AAT TAA CGG TGT GTA GGC TGG AGC TGC TTC Kd3ydcIp2 lacz fusion YdcIendP1 YdcItrgP2 GAC AGC

More information

BA, BSc, and MSc Degree Examinations

BA, BSc, and MSc Degree Examinations Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes

More information

Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus:

Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: m Eukaryotic mrna processing Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: Cap structure a modified guanine base is added to the 5 end. Poly-A tail

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11524 Supplementary discussion Functional analysis of the sugar porter family (SP) signature motifs. As seen in Fig. 5c, single point mutation of the conserved

More information

Arginase Assay Kit. Catalog Number KA assays Version: 05. Intended for research use only.

Arginase Assay Kit. Catalog Number KA assays Version: 05. Intended for research use only. Arginase Assay Kit Catalog Number KA1609 200 assays Version: 05 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle of the Assay...

More information

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded

More information

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this

More information

Statistical Mechanics of Integral Membrane Protein Assembly

Statistical Mechanics of Integral Membrane Protein Assembly Statistical Mechanics of Integral Membrane Protein Assembly Karim Wahba, David J. Schwab, and Robijn Bruinsma Department of Physics, University of California, Los Angeles, CA 90095, USA During the synthesis

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2014 1 HMM Lecture Notes Dannie Durand and Rose Hoberman November 6th Introduction In the last few lectures, we have focused on three problems related

More information

Encarna Pucheta-Martinez+, Nicola D Amelio+, Moreno Lelli, Jorge L. Martinez-Torrecuadrada, Marius Sudol, Giorgio Saladino* and Francesco L.

Encarna Pucheta-Martinez+, Nicola D Amelio+, Moreno Lelli, Jorge L. Martinez-Torrecuadrada, Marius Sudol, Giorgio Saladino* and Francesco L. Supplementary Information for: Changes in the folding landscape of the WW domain provide a molecular mechanism for an inherited genetic syndrome Encarna Pucheta-Martinez+, Nicola D Amelio+, Moreno Lelli,

More information

Topology of RbsC, the Membrane Component of the Escherichia coli Ribose Transporter

Topology of RbsC, the Membrane Component of the Escherichia coli Ribose Transporter JOURNAL OF BACTERIOLOGY, Sept. 2003, p. 5234 5239 Vol. 185, No. 17 0021-9193/03/$08.00 0 DOI: 10.1128/JB.185.17.5234 5239.2003 Copyright 2003, American Society for Microbiology. All Rights Reserved. Topology

More information

In-Depth Assessment of Local Sequence Alignment

In-Depth Assessment of Local Sequence Alignment 2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.

More information

Quantification of Protein Half-Lives in the Budding Yeast Proteome

Quantification of Protein Half-Lives in the Budding Yeast Proteome Supporting Methods Quantification of Protein Half-Lives in the Budding Yeast Proteome 1 Cell Growth and Cycloheximide Treatment Three parallel cultures (17 ml) of each TAP-tagged strain were grown in separate

More information

Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor

Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Presented by Stephanie Lee Research Mentor: Dr. Rob Coalson Glycine Alpha 1 Receptor (GlyRa1) Member of the superfamily

More information

Mini-Tn7 Derivative Construction and Characterization. Mini-Tn7 derivatives for

Mini-Tn7 Derivative Construction and Characterization. Mini-Tn7 derivatives for Supplemental Methods Mini-Tn7 Derivative Construction and Characterization. Mini-Tn7 derivatives for constitutive expression of fluorescent proteins in S. oneidensis were constructed as follows. The EcoRI-XbaI

More information

7.06 Problem Set

7.06 Problem Set 7.06 Problem Set 5 -- 2006 1. In the first half of the course, we encountered many examples of proteins that entered the nucleus in response to the activation of a cell-signaling pathway. One example of

More information

Supplementary materials. Crystal structure of the carboxyltransferase domain. of acetyl coenzyme A carboxylase. Department of Biological Sciences

Supplementary materials. Crystal structure of the carboxyltransferase domain. of acetyl coenzyme A carboxylase. Department of Biological Sciences Supplementary materials Crystal structure of the carboxyltransferase domain of acetyl coenzyme A carboxylase Hailong Zhang, Zhiru Yang, 1 Yang Shen, 1 Liang Tong Department of Biological Sciences Columbia

More information

Neurobiology Biomed 509 Ion Channels

Neurobiology Biomed 509 Ion Channels eurobiology Biomed 509 Ion hannels References: Luo 2.4, 2.4 2., (3.20 3.2), M 2.8 I. ores vs. carriers In order for hydrophilic ions to transit the hydrophobic membrane, they need to have a specific pathway

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11085 Supplementary Tables: Supplementary Table 1. Summary of crystallographic and structure refinement data Structure BRIL-NOP receptor Data collection Number of crystals 23 Space group

More information

Optimization of Immunoblot Protocol for Use with a Yeast Strain Containing the CDC7 Gene Tagged with myc

Optimization of Immunoblot Protocol for Use with a Yeast Strain Containing the CDC7 Gene Tagged with myc OPTIMIZATION OF IMMUNOBLOT PROTOCOL 121 Optimization of Immunoblot Protocol for Use with a Yeast Strain Containing the CDC7 Gene Tagged with myc Jacqueline Bjornton and John Wheeler Faculty Sponsor: Anne

More information

Motif Prediction in Amino Acid Interaction Networks

Motif Prediction in Amino Acid Interaction Networks Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions

More information

Eppendorf Plate Deepwell 96 and 384: RecoverMax

Eppendorf Plate Deepwell 96 and 384: RecoverMax Applications Note 145 March 2007 Eppendorf Plate Deepwell 96 and 384: RecoverMax Investigation into the impact of an optimized well design on resuspension properties, sample losses and contamination effects

More information

Supporting Information for. Initial Biochemical and Functional Evaluation of Murine Calprotectin Reveals Ca(II)-

Supporting Information for. Initial Biochemical and Functional Evaluation of Murine Calprotectin Reveals Ca(II)- Supporting Information for Initial Biochemical and Functional Evaluation of Murine Calprotectin Reveals Ca(II)- Dependence and Its Ability to Chelate Multiple Nutrient Transition Metal Ions Rose C. Hadley,

More information

Lecture 4: Transcription networks basic concepts

Lecture 4: Transcription networks basic concepts Lecture 4: Transcription networks basic concepts - Activators and repressors - Input functions; Logic input functions; Multidimensional input functions - Dynamics and response time 2.1 Introduction The

More information

Supplementary Materials: Localization and Spectroscopic Analysis of the Cu(I) Binding Site in Wheat Metallothionein Ec-1

Supplementary Materials: Localization and Spectroscopic Analysis of the Cu(I) Binding Site in Wheat Metallothionein Ec-1 S1 of S8 Supplementary Materials: Localization and Spectroscopic Analysis of the Cu(I) Binding Site in Wheat Metallothionein Ec-1 Katsiaryna Tarasava, Jens Loebus and Eva Freisinger Figure S1. Deconvoluted

More information

Mass Spectrometry and Proteomics - Lecture 5 - Matthias Trost Newcastle University

Mass Spectrometry and Proteomics - Lecture 5 - Matthias Trost Newcastle University Mass Spectrometry and Proteomics - Lecture 5 - Matthias Trost Newcastle University matthias.trost@ncl.ac.uk Previously Proteomics Sample prep 144 Lecture 5 Quantitation techniques Search Algorithms Proteomics

More information

RUBIC Buffer Screen For stable, happy proteins From purification all the way through to characterization by NMR, SAXS or Crystallography.

RUBIC Buffer Screen For stable, happy proteins From purification all the way through to characterization by NMR, SAXS or Crystallography. RUBIC Buffer Screen MD1-96 For stable, happy proteins From purification all the way through to characterization by NMR, SAXS or Crystallography. RUBIC Buffer Screen- designed at the EMBL Hamburg and optimized

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Breker et al., http://www.jcb.org/cgi/content/full/jcb.201301120/dc1 Figure S1. Single-cell proteomics of stress responses. (a) Using

More information

A SURPRISING CLARIFICATION OF THE MECHANISM OF ION-CHANNEL VOLTAGE- GATING

A SURPRISING CLARIFICATION OF THE MECHANISM OF ION-CHANNEL VOLTAGE- GATING A SURPRISING CLARIFICATION OF THE MECHANISM OF ION-CHANNEL VOLTAGE- GATING AR. PL. Ashok Palaniappan * An intense controversy has surrounded the mechanism of voltage-gating in ion channels. We interpreted

More information