Genome Annotation Project Presentation
|
|
|
- Esmond Malone
- 6 years ago
- Views:
Transcription
1 Halogeometricum borinquense Genome Annotation Project Presentation Loci Hbor_05620 & Hbor_05470 Presented by: Mohammad Reza Najaf Tomaraei
2 Hbor_05620 Basic Information DNA Coordinates: 527, ,261 Reverse ORF
3 Hbor_05620 Basic Information DNA Nucleotide Sequence: ATGGCTTCTGACGTGTCCTCCCAAACCAGCGACCTTCCCGCACCCGTTCGGG CGTTCGGGAGCGTTGCTCTCGTCGTCGTCCTCGTCCTCCTCTGTGCCAGCATC TTCGTCTCCTTCGGGACAGCCATCTTCCGAACGGTCGGTATCGACCGCGGGA GCGCGCTTTACATCGCCCTGCGGAGTGGGTCACAGTTCGTTGGCTTCGGCGT CGCCGCCGTCGGCTACCTCACTGTGACTGACCAGTGGGAGTTAGTGTACCGC CGCGTGCCGTCGCTGCGCGATCTGAAGTGGATCACCGCCGGGTTCGGCGTCC TCCTCGTCCTCTATCTGGCCATCAACGTCGGCCTCACCGCGTTGGGAATCGAC AGCGGTGACAGCGCAGTTGCCGCGACAGCGGAGGGCCAGCCTGTGCTGTTG CTGTACTACATCCCGGTGACGCTGCTCCTCGTCGCACCGACGGAGGAACTGG TGTTCCGTGGGGTCGTGCAGGGACTGTTCCGGCGTGAGTACGGCGTCCCGTT CGCTATCGCGGGGTCGAGTCTGACGTTCGCATCGATCCACGCCACCTCCTTTA CCGGTGAGGGGGCGGTCGTCTCGCTCATCGTCGTCCTGATTCTCGGCGGCGT TCTCGGCATCGTCTACGAGAAAAGCGAGAGCCTAGTCGTCCCCGTCGTCGCG CACGGGCTCTACAACACCGTCCAGTTCGCCGCCACCTACGCGATGGCGGTTG GACTTGTAGGGTCAGTGTGA Sequence Length: 750 bases
4 Hbor_05620 Basic Information Amino acid / Protein Sequence: MASDVSSQTSDLPAPVRAFGSVALVVVLVLLCASIFVSFGTAIFRT VGIDRGSALYIALRSGSQFVGFGVAAVGYLTVTDQWELVYRRVPSL RDLKWITAGFGVLLVLYLAINVGLTALGIDSGDSAVAATAEGQPVLL LYYIPVTLLLVAPTEELVFRGVVQGLFRREYGVPFAIAGSSLTFASIH ATSFTGEGAVVSLIVVLILGGVLGIVYEKSESLVVPVVAHGLYNTVQ FAATYAMAVGLVGSV Sequence Length: 249 amino acids
5 Hbor_05620 Sequence-based Similarity Data Standard Protein BLAST Top hit: Gene product name: metal-dependent membrane protease Organism: Halosarcina pallida (low-salt archaeon) Alignment length: 249 Score: 276 bits E-value: 2e-89 (2 x ) Second hit: Gene product name: CAAX amino terminal protease family protein Organism: Haloferax denitrificans (high-salt archaeon) Alignment length: 245 Score: 200 bits E-value: 1e-59 (1 x )
6 Hbor_05620 Sequence-based Similarity Data Conserved Domain Database Search (CDD) Top hit: COG number: pfam02517 COG name: Abi (CAAX protease self-immunity) E-value: 2.33e-15 (2.33 x ) Second hit: COG number: COG1266 COG name: COG1266 (Predicted metal-dependent membrane protease) E-value: 2.73e-11 (2.73 x )
7 Hbor_05620 Sequence-based Similarity Data Sequence Logo (T-Coffee & WebLogo)
8 Hbor_05620 Sequence-based Similarity Data Sequence Logo (T-Coffee & WebLogo)
9 Hbor_05620 Cellular Localization Data Gram Stain According to Montalvo-Rodriguez et al. (1998), who first isolated H. borinquense and carried out gram-staining, this archaeon has a negative gram stain (pink), which means that its structure is similar to the following diagram (of a gramnegative bacteria):
10 Hbor_05620 Cellular Localization Data Transmembrane Helices Hidden Markov Model There were 7 (magic number) transmembrane helices predicted by TMHMM. POSSIBLE N-terminus signal sequence. Transmembrane topology graph:
11 Hbor_05620 Cellular Localization Data SignalP Predicted that since the discrimination score was not high enough, it is NOT a signal peptide. However, there were some notable score spikes in the signal peptide graph:
12 Hbor_05620 Cellular Localization Data LipoP Best prediction: Transmembrane helix. No plots made.
13 Hbor_05620 Cellular Localization Data PSORTb Strongly predicted the subcellular localization of this protein to be in the Cytoplasmic Membrane, with a score of 9.99 (all other scores were zero).
14 Hbor_05620 Cellular Localization Data Phobius Phobius probability graph (with a flat-line signal peptide probability of 0):
15 Hbor_05620 Cellular Localization Data Hypothesis This integral protein is located in (through) the cytoplasmic membrane of the cell, with faces at both the inner and outer sides of the membrane.
16 Hbor_05620 START Codon / Alternative ORF No Shine-Dalgarno regions present within 8-13 base pairs upstream of the current START codon.
17 Hbor_05620 Annotation (Conclusion) This gene most probably codes for a metaldependent membrane-bound peptidase (intermembrane metalloprotease), which is involved with the release of certain transcription factors. According to Wolfe (2009), similar intermembrane proteases are also found in bacteria and archaea, which play an essential role in the proteolysis (hydrolysis of proteins into smaller polypeptides) of membrane-bound transcription factors needed for controlling expression of certain genes.
18 Hbor_05620 Annotation (Conclusion) The spike observed in Signal-P could be the region where the protein has a binding site for the activating metal ion ligand (highly likely to be zinc). Once activated, this enzyme probably performs proteolysis (making cleavages) on the protein in its active site, and eventually releases the necessary transcription factors.
19 Hbor_05620 Annotation (Conclusion) Source: LookForDiagnosis.com
20 Hbor_05470 Basic Information DNA Coordinates: 510, ,576 Reverse ORF
21 Hbor_05470 Basic Information DNA Nucleotide Sequence: GTGACCGACTCGTACACCGTCTTGGTCGTCGGCACGTTGCCATCCCGGTTCCATACCGAG CGATTCGAGGCGGCGTTCGACGACGCAACGCTCAGGTGGGTCGAACAACCCGAGGGAAATT CGACCGTCTTCGAGGCCACAGACTGTATCCTCGCCACCATGGAAGTCGTCTCGTCGGGGGA TTTCGATCCTGAGGCCGCCGCTGTCCCCGTTTTGCTGATCGGTGACAGAGAGGACAGTATC GCAGAAATCGCACTCTCGACGGATGTCGTAGACTATCTCGCCGTCCGGGGAGTGGATGCGG AGGCGACGTGGTTAGCCAACCGGATGGAGGCGGCCGCTGACTCCTATCGGACGGACAAAA AGCGGGCGCAACTCGACAGACAACAGCGAGCGCTTTCAGATCTCGGCGCGTTCGCGCTCTC CGGGCCGGCGCGAGAGGAAGTGTTCGCCGAAACCGTCGAAATCGTTACCGAAACGCTCGAT GCCGGGCGGGCCGCTCTCCTCCAGTCGCGCCCTGAACACGGTGACCTGTCGATTGTCGCC GCCAAAGGCTGGCCGCAAGTCTACGTCGGCGGCGTCGCCGTCGGACTCGACTCCGGGCCG GGACGGGCACTCACGAACCGAGAGCCAGTCGTCGAAAACGACCTGT [... too long...] GGACGACGACGAACACCTCTATGAGGTCCAGCCGGCGGACACGACGCCGTTCGAGACAGT GTACGCTGGACGTGGCAGACTCCGCGAGATGGTGGCCGAAAACGGCGTCTGTACAGTGTC GCTGACGATTCCTTCGGATGTAAGCGTGCGGTCGGTCGTGGACGCATTCGCCGCAACGTAC TCCCGGACGACGCTCGCTGCTCGTCGAACGCTCACGGAACCGACCGACTCGGTCGGGAGTT TCCGAGCGCGCCTCGACGAAGTGTGGACCGAACGACAGCGAGAAGCAATCTCGGCCGCAC TCCACGGAGGACTGTACGACTGGCCGCGCAAGACATCCGTCTCGACGCTCTCGGAAGCGTT CGATGTCTCCTCGCCGACCTTTCAGTACCACCTCCGAGCCGCAGAGCGCAAACTGATCGAA CTCATTTTAGACTGA Sequence Length: 3210 bases
22 Hbor_05470 Basic Information Amino acid / Protein Sequence: MTDSYTVLVVGTLPSRFHTERFEAAFDDATLRWVEQPEGNSTVFEATDCILATMEVVSS GDFDPEAAAVPVLLIGDREDSIAEIALSTDVVDYLAVRGVDAEATWLANRMEAAADSYRT DKKRAQLDRQQRALSDLGAFALSGPAREEVFAETVEIVTETLDAGRAALLQSRPEHGDLS IVAAKGWPQVYVGGVAVGLDSGPGRALTNREPVVENDLSSETTELTAHLDAGSELSVVV GGGTEPWGVLTVHSSESGAFDETDARFTENVAALIAAVIERETLRTTLEEMFSRMDQGLI GLDNDWRVTYMNPEAERLLDTAASEVVGTNYWDLFDSDAVKPFRERYEKAVKTGEKVS FESYFPPHDRWYEVEAYPSQAGLSVYFADITDRTEREMELLRYERMVEAADDGVYALDS DQHIVQVNQAFAEMFSREQESLIGMHTTELIDEDTAAESALIQAEAARTGEPKRMEFKAEL PDGTEVWIETHFSAIVDEETDQFVGTVGVARDVTERRHRERSLTMLHERTREMAQADNA DAVVTRTIEGCHSLFDPCRAAFFDYDATTRTLERHPQSDEVDRGRYQSDGVNRDAPVES ENDPCWVAFTEERMVRVEEGTTVQFVPVGQYGVLAVERLSGATIRETDAEMLGLLAATM GELLGSVETKQALRSRDQQLEQQNERLTQLNRINRTVREVTRSVVHATTTEEATARACE RLVEAEPYQFAWLCEAPEEANSDDRVVPMTTTGVEDSYAARLTEAAQTSPFPELLSRVA STGRRAVVNDVLDDPAWEPHRRDALAQGFRSIAVVPAGNDRLLVVHGTRPDTFAGEDG DVLVELGETLGAVIDRLGRTQPILDERQTEVELEIRDDQHFLVRLSTATGETATVTGVVPT AEGDYRTFVRTAAPKNAVRDALPPGTLARELTDEDDDEHLYEVQPADTTPFETVYAGRG RLREMVAENGVCTVSLTIPSDVSVRSVVDAFAATYSRTTLAARRTLTEPTDSVGSFRARL DEVWTERQREAISAALHGGLYDWPRKTSVSTLSEAFDVSSPTFQYHLRAAERKLIELILD Sequence Length: 1069 amino acids
23 Hbor_05470 Sequence-based Similarity Data Standard Protein BLAST Top hit: Gene product name: pas domain s-box (sensor) Organism: Halosarcina pallida (low-salt archaeon) Alignment length: 1067 Score: 1453 bits E-value: 0 (high quality match) Second hit: Gene product name: light and oxygen sensing histidine kinase (typically transmembrane, signal transduction) Organism: Haloferax prahovense (high-salt archaeon) Alignment length: 1073 Score: 546 bits E-value: 3e-172 (3 x )
24 Hbor_05470 Sequence-based Similarity Data Conserved Domain Database Search (CDD) Top hit: COG number: cd00130 COG name: PAS E-value: 2.33e-12 (2.33 x ) Function: Ligand-binding sensors for light and oxygen in signal transduction (signal sensor) Second hit: COG number: cd00130 COG name: PAS E-value: 3.20e-10 (3.20 x )
25 Hbor_05470 Sequence-based Similarity Data Conserved Domain Database Search (CDD)
26 Hbor_05470 Sequence-based Similarity Data Conserved Domain Database Search (CDD) Other mentionable specific hits: HTH_10 (Helix-turn-Helix DNA-binding protein) E-value: 2.99e-16 (2.99 x ) Function: Metal-regulated repressor GAF (GAF Domain) - pfam01590 E-value: 1.11e-10 (1.11 x ) Function: Light-binding receptor, protein-protein (binding) interactions, autoinhibition/enzyme activation FhlA (GAF Domain) E-value: 2.62e-08 (2.62 x 10-8 ) Function: Signal transduction mechanism
27 Hbor_05470 Sequence-based Similarity Data Sequence Logo (T-Coffee & WebLogo)
28 Hbor_05470 Sequence-based Similarity Data Sequence Logo (T-Coffee & WebLogo)
29 Hbor_05470 Sequence-based Similarity Data Sequence Logo (T-Coffee & WebLogo)
30 Hbor_05470 Cellular Localization Data Gram Stain Gram-negative (as explained earlier)
31 Hbor_05470 Cellular Localization Data Transmembrane Helices Hidden Markov Model There were NO (0) transmembrane helices predicted by TMHMM. Transmembrane topology graph:
32 Hbor_05470 Cellular Localization Data SignalP Predicted that since the discrimination score was not high enough, it is NOT a signal peptide. However, there were some notable score spikes in the signal peptide graph:
33 Hbor_05470 Cellular Localization Data LipoP Best prediction: No reliable prediction (rejected negative score of ). No plots made.
34 Hbor_05470 Cellular Localization Data PSORTb Made an ambiguous unknown prediction, with the following scores: Cytoplasmic Score: 2.50 Cytoplasmic Membrane Score: 2.50 (not helix) Cell Wall Score: 2.50 Extracellular Score: 2.50
35 Hbor_05470 Cellular Localization Data Phobius Phobius probability graph (with an almost flatline signal peptide probability):
36 Hbor_05470 Cellular Localization Data Hypothesis While it is challenging to come up with a concise and specific prediction due to the giant size of this gene and the equivocal results of cellular localization data, I speculate that this protein domain is located in cytoplasmic (DNAbinding), membranous (signal transduction), and extracellular (sensory) regions of the cell. However, it does NOT have transmembrane helices.
37 Hbor_05470 START Codon / Alternative ORF No Shine-Dalgarno regions present within 8-13 base pairs upstream of the current START codon.
38 Hbor_05470 Annotation (Conclusion) This gene most probably codes for a relatively enormous PAS protein domain with an S-box (sensory box). Further research showed that PAS S-box protein domains are part of many signaling proteins, which act as their signal-sensing regions. The mechanism of the S-box domain is linked to its widely-distributed prosthetic groups, which can detect associated cofactors such as: Heme (in oxygen sensors) FAD (in redox potential sensors) Chromophores (in photoactive sensors)
39 Hbor_05470 Annotation (Conclusion) Furthermore, proteins which contain the PAS S-box domain often contain other regulatory domains such as: Response regulator or sensor histidine kinase domains (signal transduction) Phytochromes (photoreception) Also, since a closely-related (but lower) BLAST-P hit predicted the gene product to be a bacterio-opsin activator-like protein, and because we have evidence of a HTH (helix-turn-helix) motif in our sequence, it is possible that the signal transduction pathway of this gene is linked to a DNA-binding region which plays a major role in regulating transcription.
40 Hbor_05470 Annotation (Conclusion) Overall, this relatively large PAS S-box protein domain is possibly involved in a signal transduction pathway that begins with its S-box sensing certain stimuli such as light and oxygen, transducing the signal all the way to a region where specific DNA-binding transcription regulators cause changes that ultimately allow expression of some required genes, thus resulting in translation of the necessary proteins.
41 Hbor_05470 Annotation (Conclusion) Source: Wikipedia
42 References a/eat.aspx protease 7.full
Meiothermus ruber Genome Analysis Project
Augustana College Augustana Digital Commons Meiothermus ruber Genome Analysis Project Biology 2018 Predicted ortholog pairs between E. coli and M. ruber are b3456 and mrub_2379, b3457 and mrub_2378, b3456
Meiothermus ruber Genome Analysis Project
Augustana College Augustana Digital Commons Meiothermus ruber Genome Analysis Project Biology 2018 Examination of Orthologous Genes (Mrub_2518 and b3728, Mrub_2519 and b3727, Mrub_2520 and b3726, Mrub_2521
Yeast ORFan Gene Project: Module 5 Guide
Cellular Localization Data (Part 1) The tools described below will help you predict where your gene s product is most likely to be found in the cell, based on its sequence patterns. Each tool adds an additional
Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
Reading Assignments. A. Genes and the Synthesis of Polypeptides. Lecture Series 7 From DNA to Protein: Genotype to Phenotype
Lecture Series 7 From DNA to Protein: Genotype to Phenotype Reading Assignments Read Chapter 7 From DNA to Protein A. Genes and the Synthesis of Polypeptides Genes are made up of DNA and are expressed
Regulation and signaling. Overview. Control of gene expression. Cells need to regulate the amounts of different proteins they express, depending on
Regulation and signaling Overview Cells need to regulate the amounts of different proteins they express, depending on cell development (skin vs liver cell) cell stage environmental conditions (food, temperature,
Translation Part 2 of Protein Synthesis
Translation Part 2 of Protein Synthesis IN: How is transcription like making a jello mold? (be specific) What process does this diagram represent? A. Mutation B. Replication C.Transcription D.Translation
Riboflavin Metabolism: A study to see if Mrub_1256 is Orthologous to E. coli b0415, and if Mrub_1254 is Orthologous to E.
Augustana College Augustana Digital Commons Meiothermus ruber Genome Analysis Project Biology Winter 2-2016 Riboflavin Metabolism: A study to see if Mrub_1256 is Orthologous to E. coli b0415, and if Mrub_1254
S1 Gene ontology (GO) analysis of the network alignment results
1 Supplementary Material for Effective comparative analysis of protein-protein interaction networks by measuring the steady-state network flow using a Markov model Hyundoo Jeong 1, Xiaoning Qian 1 and
Translation and Operons
Translation and Operons You Should Be Able To 1. Describe the three stages translation. including the movement of trna molecules through the ribosome. 2. Compare and contrast the roles of three different
Biology 112 Practice Midterm Questions
Biology 112 Practice Midterm Questions 1. Identify which statement is true or false I. Bacterial cell walls prevent osmotic lysis II. All bacterial cell walls contain an LPS layer III. In a Gram stain,
-max_target_seqs: maximum number of targets to report
Review of exercise 1 tblastn -num_threads 2 -db contig -query DH10B.fasta -out blastout.xls -evalue 1e-10 -outfmt "6 qseqid sseqid qstart qend sstart send length nident pident evalue" Other options: -max_target_seqs:
Genome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting.
Genome Annotation Bioinformatics and Computational Biology Genome Annotation Frank Oliver Glöckner 1 Genome Analysis Roadmap Genome sequencing Assembly Gene prediction Protein targeting trna prediction
Activation of a receptor. Assembly of the complex
Activation of a receptor ligand inactive, monomeric active, dimeric When activated by growth factor binding, the growth factor receptor tyrosine kinase phosphorylates the neighboring receptor. Assembly
Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus:
m Eukaryotic mrna processing Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: Cap structure a modified guanine base is added to the 5 end. Poly-A tail
MOLECULAR CELL BIOLOGY
1 Lodish Berk Kaiser Krieger scott Bretscher Ploegh Matsudaira MOLECULAR CELL BIOLOGY SEVENTH EDITION CHAPTER 13 Moving Proteins into Membranes and Organelles Copyright 2013 by W. H. Freeman and Company
Patrick: An Introduction to Medicinal Chemistry 5e Chapter 04
01) Which of the following statements is not true about receptors? a. Most receptors are proteins situated inside the cell. b. Receptors contain a hollow or cleft on their surface which is known as a binding
CSCE555 Bioinformatics. Protein Function Annotation
CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The
Chapter 12: Intracellular sorting
Chapter 12: Intracellular sorting Principles of intracellular sorting Principles of intracellular sorting Cells have many distinct compartments (What are they? What do they do?) Specific mechanisms are
BME 5742 Biosystems Modeling and Control
BME 5742 Biosystems Modeling and Control Lecture 24 Unregulated Gene Expression Model Dr. Zvi Roth (FAU) 1 The genetic material inside a cell, encoded in its DNA, governs the response of a cell to various
Introduction to Bioinformatics
CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics
Improved Prediction of Signal Peptides: SignalP 3.0
doi:10.1016/j.jmb.2004.05.028 J. Mol. Biol. (2004) 340, 783 795 Improved Prediction of Signal Peptides: SignalP 3.0 Jannick Dyrløv Bendtsen 1, Henrik Nielsen 1, Gunnar von Heijne 2 and Søren Brunak 1 *
Gene regulation II Biochemistry 302. February 27, 2006
Gene regulation II Biochemistry 302 February 27, 2006 Molecular basis of inhibition of RNAP by Lac repressor 35 promoter site 10 promoter site CRP/DNA complex 60 Lewis, M. et al. (1996) Science 271:1247
Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.
Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein
Advanced Higher Biology. Unit 1- Cells and Proteins 2c) Membrane Proteins
Advanced Higher Biology Unit 1- Cells and Proteins 2c) Membrane Proteins Membrane Structure Phospholipid bilayer Transmembrane protein Integral protein Movement of Molecules Across Membranes Phospholipid
Molecular Biology, Genetic Engineering & Biotechnology Operons ???
1 Description of Module Subject Name?? Paper Name Module Name/Title XV- 04: 2 OPERONS OBJECTIVES To understand how gene is expressed and regulated in prokaryotic cell To understand the regulation of Lactose
Public Database 의이용 (1) - SignalP (version 4.1)
Public Database 의이용 (1) - SignalP (version 4.1) 2015. 8. KIST 이철주 Secretion pathway prediction ProteinCenter (Proxeon Bioinformatics, Odense, Denmark; http://www.cbs.dtu.dk/services) SignalP (version 4.1)
Computational Biology: Basics & Interesting Problems
Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information
CHAPTER 3. Cell Structure and Genetic Control. Chapter 3 Outline
CHAPTER 3 Cell Structure and Genetic Control Chapter 3 Outline Plasma Membrane Cytoplasm and Its Organelles Cell Nucleus and Gene Expression Protein Synthesis and Secretion DNA Synthesis and Cell Division
Supporting online material
Supporting online material Materials and Methods Target proteins All predicted ORFs in the E. coli genome (1) were downloaded from the Colibri data base (2) (http://genolist.pasteur.fr/colibri/). 737 proteins
Gene regulation II Biochemistry 302. Bob Kelm February 28, 2005
Gene regulation II Biochemistry 302 Bob Kelm February 28, 2005 Catabolic operons: Regulation by multiple signals targeting different TFs Catabolite repression: Activity of lac operon is restricted when
Name Period The Control of Gene Expression in Prokaryotes Notes
Bacterial DNA contains genes that encode for many different proteins (enzymes) so that many processes have the ability to occur -not all processes are carried out at any one time -what allows expression
Scale in the biological world
Scale in the biological world 2 A cell seen by TEM 3 4 From living cells to atoms 5 Compartmentalisation in the cell: internal membranes and the cytosol 6 The Origin of mitochondria: The endosymbion hypothesis
Biochemistry Prokaryotic translation
1 Description of Module Subject Name Paper Name Module Name/Title Dr. Vijaya Khader Dr. MC Varadaraj 2 1. Objectives 2. Understand the concept of genetic code 3. Understand the concept of wobble hypothesis
2 The Proteome. The Proteome 15
The Proteome 15 2 The Proteome 2.1. The Proteome and the Genome Each of our cells contains all the information necessary to make a complete human being. However, not all the genes are expressed in all
CISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein
Multiple Choice Review- Eukaryotic Gene Expression
Multiple Choice Review- Eukaryotic Gene Expression 1. Which of the following is the Central Dogma of cell biology? a. DNA Nucleic Acid Protein Amino Acid b. Prokaryote Bacteria - Eukaryote c. Atom Molecule
PROTEIN SUBCELLULAR LOCALIZATION PREDICTION BASED ON COMPARTMENT-SPECIFIC BIOLOGICAL FEATURES
3251 PROTEIN SUBCELLULAR LOCALIZATION PREDICTION BASED ON COMPARTMENT-SPECIFIC BIOLOGICAL FEATURES Chia-Yu Su 1,2, Allan Lo 1,3, Hua-Sheng Chiu 4, Ting-Yi Sung 4, Wen-Lian Hsu 4,* 1 Bioinformatics Program,
Protein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1
Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2
Topology. 1 Introduction. 2 Chromosomes Topology & Counts. 3 Genome size. 4 Replichores and gene orientation. 5 Chirochores.
Topology 1 Introduction 2 3 Genome size 4 Replichores and gene orientation 5 Chirochores 6 G+C content 7 Codon usage 27 marc.bailly-bechet@univ-lyon1.fr The big picture Eukaryota Bacteria Many linear chromosomes
-14. -Abdulrahman Al-Hanbali. -Shahd Alqudah. -Dr Ma mon Ahram. 1 P a g e
-14 -Abdulrahman Al-Hanbali -Shahd Alqudah -Dr Ma mon Ahram 1 P a g e In this lecture we will talk about the last stage in the synthesis of proteins from DNA which is translation. Translation is the process
GENE REGULATION AND PROBLEMS OF DEVELOPMENT
GENE REGULATION AND PROBLEMS OF DEVELOPMENT By Surinder Kaur DIET Ropar Surinder_1998@ yahoo.in Mob No 9988530775 GENE REGULATION Gene is a segment of DNA that codes for a unit of function (polypeptide,
Supplemental Materials
JOURNAL OF MICROBIOLOGY & BIOLOGY EDUCATION, May 2013, p. 107-109 DOI: http://dx.doi.org/10.1128/jmbe.v14i1.496 Supplemental Materials for Engaging Students in a Bioinformatics Activity to Introduce Gene
The Eukaryotic Genome and Its Expression. The Eukaryotic Genome and Its Expression. A. The Eukaryotic Genome. Lecture Series 11
The Eukaryotic Genome and Its Expression Lecture Series 11 The Eukaryotic Genome and Its Expression A. The Eukaryotic Genome B. Repetitive Sequences (rem: teleomeres) C. The Structures of Protein-Coding
GO ID GO term Number of members GO: translation 225 GO: nucleosome 50 GO: calcium ion binding 76 GO: structural
GO ID GO term Number of members GO:0006412 translation 225 GO:0000786 nucleosome 50 GO:0005509 calcium ion binding 76 GO:0003735 structural constituent of ribosome 170 GO:0019861 flagellum 23 GO:0005840
3.B.1 Gene Regulation. Gene regulation results in differential gene expression, leading to cell specialization.
3.B.1 Gene Regulation Gene regulation results in differential gene expression, leading to cell specialization. We will focus on gene regulation in prokaryotes first. Gene regulation accounts for some of
Topic 4 - #14 The Lactose Operon
Topic 4 - #14 The Lactose Operon The Lactose Operon The lactose operon is an operon which is responsible for the transport and metabolism of the sugar lactose in E. coli. - Lactose is one of many organic
RNA & PROTEIN SYNTHESIS. Making Proteins Using Directions From DNA
RNA & PROTEIN SYNTHESIS Making Proteins Using Directions From DNA RNA & Protein Synthesis v Nitrogenous bases in DNA contain information that directs protein synthesis v DNA remains in nucleus v in order
Supplementary Information
Supplementary Information Supplementary Figure 1. Schematic pipeline for single-cell genome assembly, cleaning and annotation. a. The assembly process was optimized to account for multiple cells putatively
Hybrid Quorum sensing in Vibrio harveyi- two component signalling
Hybrid Quorum sensing in Vibrio harveyi- two component signalling Dr. M. Vijayalakshmi School of Chemical and Biotechnology SASTRA University Joint Initiative of IITs and IISc Funded by MHRD Page 1 of
Amino Acid Structures from Klug & Cummings. Bioinformatics (Lec 12)
Amino Acid Structures from Klug & Cummings 2/17/05 1 Amino Acid Structures from Klug & Cummings 2/17/05 2 Amino Acid Structures from Klug & Cummings 2/17/05 3 Amino Acid Structures from Klug & Cummings
Big Idea 3: Living systems store, retrieve, transmit and respond to information essential to life processes. Tuesday, December 27, 16
Big Idea 3: Living systems store, retrieve, transmit and respond to information essential to life processes. Enduring understanding 3.B: Expression of genetic information involves cellular and molecular
We have: We will: Assembled six genomes Made predictions of most likely gene locations. Add a layers of biological meaning to the sequences
Recap We have: Assembled six genomes Made predictions of most likely gene locations We will: Add a layers of biological meaning to the sequences Start with Biology This will motivate the choices we make
Any protein that can be labelled by both procedures must be a transmembrane protein.
1. What kind of experimental evidence would indicate that a protein crosses from one side of the membrane to the other? Regions of polypeptide part exposed on the outside of the membrane can be probed
Molecular Biology (9)
Molecular Biology (9) Translation Mamoun Ahram, PhD Second semester, 2017-2018 1 Resources This lecture Cooper, Ch. 8 (297-319) 2 General information Protein synthesis involves interactions between three
REGULATION OF GENE EXPRESSION. Bacterial Genetics Lac and Trp Operon
REGULATION OF GENE EXPRESSION Bacterial Genetics Lac and Trp Operon Levels of Metabolic Control The amount of cellular products can be controlled by regulating: Enzyme activity: alters protein function
32 Gene regulation, continued Lecture Outline 11/21/05
32 Gene regulation, continued Lecture Outline 11/21/05 Review the operon concept Repressible operons (e.g. trp) Inducible operons (e.g. lac) Positive regulation of lac () Practice applying the operon concept
Cellular Transport. 1. Transport to and across the membrane 1a. Transport of small molecules and ions 1b. Transport of proteins
Transport Processes Cellular Transport 1. Transport to and across the membrane 1a. Transport of small molecules and ions 1b. Transport of proteins 2. Vesicular transport 3. Transport through the nuclear
L3.1: Circuits: Introduction to Transcription Networks. Cellular Design Principles Prof. Jenna Rickus
L3.1: Circuits: Introduction to Transcription Networks Cellular Design Principles Prof. Jenna Rickus In this lecture Cognitive problem of the Cell Introduce transcription networks Key processing network
Sequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
Visual pigments. Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2019
Visual pigments Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2019 References Webvision: The Organization of the Retina and Visual System (http://www.ncbi.nlm.nih.gov/books/nbk11522/#a 127) The
Host-Pathogen Interaction. PN Sharma Department of Plant Pathology CSK HPKV, Palampur
Host-Pathogen Interaction PN Sharma Department of Plant Pathology CSK HPKV, Palampur-176062 PATHOGEN DEFENCE IN PLANTS A BIOLOGICAL AND MOLECULAR VIEW Two types of plant resistance response to potential
REVIEW 1: BIOCHEMISTRY UNIT. A. Top 10 If you learned anything from this unit, you should have learned:
Period Date REVIEW 1: BIOCHEMISTRY UNIT A. Top 10 If you learned anything from this unit, you should have learned: 1. All living matter made up of CHONPS 2. Bonds a. covalent bonds are strong b. hydrogen
Supplementary Table 3. Membrane/Signaling/Neural Genes of the DmSP. FBgn CG5265 acetyltransferase amino acid metabolism
Supplementary Table 3 Membrane/Signaling/Neural Genes of the DmSP FlyBase ID Gene Name Molecular function summary Membrane Biological process summary FBgn0038486 CG5265 acetyltransferase amino acid metabolism
Old FINAL EXAM BIO409/509 NAME. Please number your answers and write them on the attached, lined paper.
Old FINAL EXAM BIO409/509 NAME Please number your answers and write them on the attached, lined paper. Gene expression can be regulated at several steps. Describe one example for each of the following:
AP Biology Gene Regulation and Development Review
AP Biology Gene Regulation and Development Review 1. What does the regulatory gene code for? 2. Is the repressor by default active/inactive? 3. What changes the repressor activity? 4. What does repressor
Lecture 18 June 2 nd, Gene Expression Regulation Mutations
Lecture 18 June 2 nd, 2016 Gene Expression Regulation Mutations From Gene to Protein Central Dogma Replication DNA RNA PROTEIN Transcription Translation RNA Viruses: genome is RNA Reverse Transcriptase
Structure to Function. Molecular Bioinformatics, X3, 2006
Structure to Function Molecular Bioinformatics, X3, 2006 Structural GeNOMICS Structural Genomics project aims at determination of 3D structures of all proteins: - organize known proteins into families
What is the central dogma of biology?
Bellringer What is the central dogma of biology? A. RNA DNA Protein B. DNA Protein Gene C. DNA Gene RNA D. DNA RNA Protein Review of DNA processes Replication (7.1) Transcription(7.2) Translation(7.3)
RANK. Alternative names. Discovery. Structure. William J. Boyle* SUMMARY BACKGROUND
RANK William J. Boyle* Department of Cell Biology, Amgen, Inc., One Amgen Center Drive, Thousand Oaks, CA 91320-1799, USA * corresponding author tel: 805-447-4304, fax: 805-447-1982, e-mail: bboyle@amgen.com
1. In most cases, genes code for and it is that
Name Chapter 10 Reading Guide From DNA to Protein: Gene Expression Concept 10.1 Genetics Shows That Genes Code for Proteins 1. In most cases, genes code for and it is that determine. 2. Describe what Garrod
Gene Control Mechanisms at Transcription and Translation Levels
Gene Control Mechanisms at Transcription and Translation Levels Dr. M. Vijayalakshmi School of Chemical and Biotechnology SASTRA University Joint Initiative of IITs and IISc Funded by MHRD Page 1 of 9
Meiothermus ruber Genome Analysis Project
Augustana College Augustana Digital Commons Meiothermus ruber Genome Analysis Project Biology 2017 Annotation of Genes Involved with Biosynthetic Production of Peptidoglycan within Meiothermus ruber involving
Comparative RNA-seq analysis of transcriptome dynamics during petal development in Rosa chinensis
Title Comparative RNA-seq analysis of transcriptome dynamics during petal development in Rosa chinensis Author list Yu Han 1, Huihua Wan 1, Tangren Cheng 1, Jia Wang 1, Weiru Yang 1, Huitang Pan 1* & Qixiang
In-Silico Approach for Hypothetical Protein Function Prediction
In-Silico Approach for Hypothetical Protein Function Prediction Shabanam Khatoon Department of Computer Science, Faculty of Natural Sciences Jamia Millia Islamia, New Delhi Suraiya Jabin Department of
Bahnson Biochemistry Cume, April 8, 2006 The Structural Biology of Signal Transduction
Name page 1 of 6 Bahnson Biochemistry Cume, April 8, 2006 The Structural Biology of Signal Transduction Part I. The ion Ca 2+ can function as a 2 nd messenger. Pick a specific signal transduction pathway
Structure of mitochondria
Structure of mitochondria Subcompartments of mitochondria Outer membrane (OM) Inner membrane (IM) Matrix Intermembrane space (IMS) Cristae membrane Inner boundary membrane Cristae compartment Molecular
Name: SBI 4U. Gene Expression Quiz. Overall Expectation:
Gene Expression Quiz Overall Expectation: - Demonstrate an understanding of concepts related to molecular genetics, and how genetic modification is applied in industry and agriculture Specific Expectation(s):
Regulation of Gene Expression at the level of Transcription
Regulation of Gene Expression at the level of Transcription (examples are mostly bacterial) Diarmaid Hughes ICM/Microbiology VT2009 Regulation of Gene Expression at the level of Transcription (examples
Supplementary Information 16
Supplementary Information 16 Cellular Component % of Genes 50 45 40 35 30 25 20 15 10 5 0 human mouse extracellular other membranes plasma membrane cytosol cytoskeleton mitochondrion ER/Golgi translational
E. coli b4226 (ppa) and Mrub_0258 are orthologs; E. coli b2501 (ppk) and Mrub_1198 are orthologs. Brandon Wills
E. coli b4226 (ppa) and Mrub_0258 are orthologs; E. coli b2501 (ppk) and Mrub_1198 are orthologs Brandon Wills ppa gene inorganic pyrophosphatase Structure/Function: 175 amino acids 1 single domain Cytoplasm
FUNCTION ANNOTATION PRELIMINARY RESULTS
FUNCTION ANNOTATION PRELIMINARY RESULTS FACTION I KAI YUAN KALYANI PATANKAR KIERA BERGER CAMILA MEDRANO HUBERT PAN JUNKE WANG YANXI CHEN AJAY RAMAKRISHNAN MRUNAL DEHANKAR OVERVIEW Introduction Previous
Motif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
Biological Process Term Enrichment
Biological Process Term Enrichment cellular protein localization cellular macromolecule localization intracellular protein transport intracellular transport generation of precursor metabolites and energy
Chapter 17. From Gene to Protein. Biology Kevin Dees
Chapter 17 From Gene to Protein DNA The information molecule Sequences of bases is a code DNA organized in to chromosomes Chromosomes are organized into genes What do the genes actually say??? Reflecting
Regulation of Gene Expression
Chapter 18 Regulation of Gene Expression Edited by Shawn Lester PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley
Welcome to Class 21!
Welcome to Class 21! Introductory Biochemistry! Lecture 21: Outline and Objectives l Regulation of Gene Expression in Prokaryotes! l transcriptional regulation! l principles! l lac operon! l trp attenuation!
Genome Annotation. Qi Sun Bioinformatics Facility Cornell University
Genome Annotation Qi Sun Bioinformatics Facility Cornell University Some basic bioinformatics tools BLAST PSI-BLAST - Position-Specific Scoring Matrix HMM - Hidden Markov Model NCBI BLAST How does BLAST
Signal Transduction Phosphorylation Protein kinases. Misfolding diseases. Protein Engineering Lysozyme variants
Signal Transduction Phosphorylation Protein kinases Misfolding diseases Protein Engineering Lysozyme variants Cells and Signals Regulation The cell must be able to respond to stimuli Cellular activities
Receptors and Ion Channels
Receptors and Ion Channels Laurie Kellaway Senior Lecturer Department of Human Biology Laurie@curie.uct.ac.za Tel. +27 +21 4066 271 What are the two types of Neurotransmitter receptors Ionotropic receptors
Signal Transduction. Dr. Chaidir, Apt
Signal Transduction Dr. Chaidir, Apt Background Complex unicellular organisms existed on Earth for approximately 2.5 billion years before the first multicellular organisms appeared.this long period for
In Genomes, Two Types of Genes
In Genomes, Two Types of Genes Protein-coding: [Start codon] [codon 1] [codon 2] [ ] [Stop codon] + DNA codons translated to amino acids to form a protein Non-coding RNAs (NcRNAs) No consistent patterns
Gene regulation I Biochemistry 302. Bob Kelm February 25, 2005
Gene regulation I Biochemistry 302 Bob Kelm February 25, 2005 Principles of gene regulation (cellular versus molecular level) Extracellular signals Chemical (e.g. hormones, growth factors) Environmental
Review. Membrane proteins. Membrane transport
Quiz 1 For problem set 11 Q1, you need the equation for the average lateral distance transversed (s) of a molecule in the membrane with respect to the diffusion constant (D) and time (t). s = (4 D t) 1/2
Initiation of translation in eukaryotic cells:connecting the head and tail
Initiation of translation in eukaryotic cells:connecting the head and tail GCCRCCAUGG 1: Multiple initiation factors with distinct biochemical roles (linking, tethering, recruiting, and scanning) 2: 5
Chapter 12. Genes: Expression and Regulation
Chapter 12 Genes: Expression and Regulation 1 DNA Transcription or RNA Synthesis produces three types of RNA trna carries amino acids during protein synthesis rrna component of ribosomes mrna directs protein
MOLECULAR DRUG TARGETS
MOLECULAR DRUG TARGETS LEARNING OUTCOMES At the end of this session student shall be able to: List different types of druggable targets Describe forces involved in drug-receptor interactions Describe theories
Videos. Bozeman, transcription and translation: https://youtu.be/h3b9arupxzg Crashcourse: Transcription and Translation - https://youtu.
Translation Translation Videos Bozeman, transcription and translation: https://youtu.be/h3b9arupxzg Crashcourse: Transcription and Translation - https://youtu.be/itsb2sqr-r0 Translation Translation The
Chapter 16 Lecture. Concepts Of Genetics. Tenth Edition. Regulation of Gene Expression in Prokaryotes
Chapter 16 Lecture Concepts Of Genetics Tenth Edition Regulation of Gene Expression in Prokaryotes Chapter Contents 16.1 Prokaryotes Regulate Gene Expression in Response to Environmental Conditions 16.2