SUPPLEMENTARY INFORMATION
|
|
- Cameron Lynch
- 6 years ago
- Views:
Transcription
1 doi: /nature17991 Supplementary Discussion Structural comparison with E. coli EmrE The DMT superfamily includes a wide variety of transporters with 4-10 TM segments 1. Since the subfamilies of the DMT superfamily share very low sequence similarity, their evolutional relationship was elusive. The present crystal structure of YddG provides insight into the molecular evolution of the DMT superfamily. The small multidrug resistance (SMR) family is a subfamily of the DMT superfamily, and its members form homo/hetero-dimeric transporters with 4-TM protomers 2. Previous bioinformatics analyses suggested that this SMR family is the progenitor of the other DMT proteins 3,4, and that the insertion of a new TM segment between TM1 and TM2 of the SMR transporters generated the 5-TM DMT proteins, whose duplication finally formed the 10-TM DMT proteins. However, the insertion of one TM segment in the middle of the membrane protein topology seems to be unlikely, because it requires the inversion of the other TM segments, which could change the overall protein folding topology, and thus possibly affect the function of the transporter. A comparison between the crystal structures of SnYddG and E. coli EmrE 2,5, one of the best characterized SMR transporters, provides insight into a possible evolutional relationship between the 4-TM and 10-TM DMT proteins (Extended Data Fig. 4). As shown in Extended Data Fig. 4a-c, the superimposition of the TM helices of SnYddG and the EmrE dimer (PDB ID: 2I68) revealed good structural alignment (RMSD: 2.9 Å over 127 Cα atoms). The central cavity of YddG coincides well with the tetraphenylphosphonium (TPP) binding site of EmrE, observed in the previous crystal structures 2,5. TM3, TM4, TM5, and TM1 of YddG correspond to TM2, TM3, TM4, and TM1 (TM1 of another molecule) of the EmrE dimer, respectively, while EmrE lacks the TM segments corresponding to TM2 and TM7 of YddG (Extended Data Fig. 4a-c). 1
2 This comparison suggests that the DMT superfamily transporters with the 5+5 TM topology were evolutionarily formed by i) the insertion of a new TM segment between TM1 and TM2, and ii) the swapping of the two TM1 segments of both protomers (Extended Data Fig. 4d). After the insertion of the new TM segment between TM1 and TM2, TM1 cannot be docked into its original site, since the insertion of the new TM resulted in the inversion of the insertion direction of TM1 (Extended Data Fig. 4d, middle panel). However, if the up- and down-stream loop regions of the new TM segment are long enough, TM1 can be docked into the site where the TM1 of another protomer was originally docked. This swapping of TM1 between the protomers allows the complete maintenance of the same inter-tm interactions, and thus preserves the overall integrity of the membrane protein fold, after the insertion of the new TM segment into the middle of the membrane protein fold (Extended Data Fig. 4d, middle panel). Furthermore, this insertion of the TM segment enabled the fusion of two inverted protomers (Extended Data Fig. 4d, right panel), which finally generated the enormous variety of DMT transporters with complex topologies, including YddG, from the simple inverted homodimer of the SMR transporters. Overall, the present structure of SnYddG not only exemplifies the evolutionary model of the dual-topology membrane proteins 6, but also provides insights into the molecular evolution of membrane proteins with novel topologies, generated through the insertion and swapping of TM segments. It should also be noted here that this insertion and swapping mechanism is only possible in homodimeric membrane proteins with dual topology. Evolutionary covariation analysis of YddG To predict the possible interactions between the TM helices of YddG, we performed an evolutionary covariation analysis, using the program EVcoupling 7. As the input, 59,114 sequences of the DMT protein homologs of SnYddG were used for the EVcoupling calculation 2
3 (Extended Data Fig. 7a). The results correctly predicted the interaction sites between the TM helices observed in the present crystal structure, including the interactions in the intracellular gate, which is composed of the intracellular tips of the TM6-TM7 and TM8-TM9a hairpins (Extended Data Fig. 7a,b). Furthermore, the results predicted the evolutionarily correlated sites, where no direct interactions are observed in the present outward-open crystal structure. At the extracellular entrance of the central cavity, which is formed by the extracellular tips of the TM1-TM2 and TM3-TM4a hairpins, we detected evolutionarily correlated residues with high EC scores. This result suggests that this site is evolutionarily conserved, to allow the interactions between them (Extended Data Fig. 7a,b). Interestingly, this site corresponds to the putative extracellular gate, which sequesters the central cavity from the extracellular space, in our model structure of the inward-facing state. Next, we predicted the overall structure of SnYddG by the program EVfold_membrane 8, using these EC sites. The highest ranking predicted structure was calculated using the 170 EC sites. Surprisingly, the overall folding and the TM topology of the predicted structure coincided well with those of the crystal structure (Extended Data Fig. 7c). The predicted structure is reminiscent of the occluded state, in which the intracellular and extracellular gates are both closed. Thus, the results of the evolutionary covariation analysis strongly support our model of the inward-facing state and the formation of the putative extracellular gate. Possible transport model of YddG The superimposition of the N- and C-halves provides further insights into the structural changes that occur during the transport cycle. The structural differences between the N- and C-halves mainly exist in TM1, TM3, and TM4 in the N-half, and TM6, TM8, and TM9 in the C-half, in the degrees of the bending and tilting of these TM helices (Fig. 2c). Thus, the inter-conversion of the two different conformations of these TM helices probably occurs during the structural transition between the inward- and outward-facing states. Especially, the structural 3
4 comparison of TM4 and TM9 suggests the bending of these TM segments, with the conserved intra-membrane loops between TM4a and TM4b, and between TM9a and TM9b, serving as hinges. In contrast, the other TM segments (i.e., TM2 and TM5 in the N-terminal half) superimpose well on TM7 and TM10 in the C-terminal half (Fig. 2c). This suggests that these TM segments maintain their structures during the transport cycle. TM2, TM5, TM7 and TM10 may function as a scaffold to stabilize the overall structure. This notion led us to propose a model of the structural changes occurring during the transport cycle of YddG (Fig. 4c and Supplementary Video). Starting from the outward-open state, the straightening of TM4 and TM9 occurs to form the interactions between TM4a and TM9b, which in turn lead to the movement of the extracellular half of TM3. These structural changes in the TM helices probably involve the kinks of TM3 around Gly71, Gly73, Gly74, and Gly77 (Extended Data Fig. 8a), as well as those of TM4 and TM9 around the intra-membrane loops. The Ala mutations of these Gly residues affected the transport activity, suggesting their importance in the transport mechanism (Extended Data Fig. 8a). The structural changes result in the packing of the TM3-TM4a hairpin against the extracellular sides of TM1 and TM9b, which closes the extracellular entrance of the central cavity, leading to the occluded state (Fig. 4c). Upon the structural change to the inward-open state, TM4b and TM9a move away from each other, thereby creating part of the intracellular entrance of the central cavity. Along with this structural change, the bending of TM8 around Gly217, Gly219, Pro220, and Gly222 shifts the tip of the TM8-TM9a hairpin away from TM6 and TM7 (Extended Data Fig. 8b), which opens the intracellular gate to form the inward-open structure (Fig. 4c). The Ala mutations of these Gly/Pro residues affected the transport activity, suggesting their importance in the transport mechanism (Extended Data Fig. 8b). Molecular dynamics simulations of SnYddG To support the structural change mechanism suggested by the present crystal structure, we 4
5 performed molecular dynamics (MD) simulations, based on the present crystal structure. In the equilibrium simulation without biasing forces, no large structural change was observed during 500 ns, suggesting that the outward-facing structure is stable in the lipid bilayer (Extended Data Fig. 9a). This result is also consistent with the slow transport rate of SnYddG, observed in the liposome-based assay (Fig. 1a). Next, to facilitate the structural change, we performed the 1-μs MD simulation with biasing forces. In the first 500-ns simulation, a harmonic restraint was applied between the center of the mass of the Cα atoms of TM4a and TM9b (i.e. Pro91 Ala98 and Ala246 Leu253), and the equilibrium distance of the restraint was gradually decreased from 15 Å to 9 Å, to move these two regions towards each other (Extended Data Fig. 9b). During the simulation, the TM1-TM2 hairpin and TM3 approached to each other and new interactions were formed between them, although no biased force was applied to these helices (Extended Data Fig. 9b). These interactions are quite similar to those observed in the putative extracellular gate in the inward-facing model structure (Fig. 4b; right panel). The final snapshot of the 500-ns simulation represented the occluded-like structure (Extended Data Fig. 9b), and is superimposable on the model structure produced by EVfold_membrane (Extended Data Fig. 7c), with 3.0 Å RMSD over 254 Cα atoms. In the next 500-ns simulation, a similar restraint was applied between TM4b and TM9a (i.e., Trp101 Phe108 and Val237 Ser244), and the equilibrium distance was gradually increased from 9 Å to 15 Å, to move these two regions apart from each other (Extended Data Fig. 9c). During the simulation, the TM6-TM7 hairpin and TM8 were separated from each other and the intracellular gate was opened, although no biased force was applied to these helices (Extended Data Fig. 9c). In addition, the interactions between the TM1-TM2 hairpin and TM3, as well as those between TM4a and TM9b, were stably maintained during the 500-ns simulation with no biasing forces to these regions (Extended Data Fig. 9c). The final snapshot of the simulation is similar to the model structure of the inward-open state (Extended Data Fig. 9c). Together, the results of the MD simulation support the inward-facing model structure and the structural change 5
6 mechanism of YddG. Common transport mechanisms of DMT proteins The structural similarity between EmrE and YddG suggests the transport mechanisms of EmrE and other DMT transporters. TM3 of EmrE contains the GXG motif, which is conserved among the SMR transporters, at the middle of the TM segment (Extended Data Fig. 3c). The structural superimposition indicated that this region corresponds to the intra-membrane loops in TM4 and TM9 of YddG (C and C in Extended Data Fig. 4a-c), which are probably important for the transport mechanism. Thus, TM3 of EmrE may also be kinked in a similar manner to TM4 and TM9 of YddG, and the GXG motif probably serves as a hinge that facilitates its bending motion during the transport cycle (Fig. 4c). Moreover, the structural similarity suggested that the two-helix hairpin structure of TM2 and TM3 of EmrE undergoes a similar motion to that of the TM3-TM4 hairpin of YddG (Fig. 4c). This motion opens and closes the intra- and extracellular gates, thereby providing a mechanism for alternating the access to the central cavity. In contrast, TM4 of EmrE may function as a scaffold to support the structural changes of the other TM segments, in a similar manner to TM5 and TM10 of YddG. Therefore, the symmetric inter-conversion of the two different conformations of the protomers leads to the alternating access to the substrate binding site, which finally drives drug extrusion using the proton electrochemical gradient across the membrane. These key motifs for the transport mechanism; i.e., the hinge region in the middle of TM4 and TM9 and the two-helix hairpin structures of TM3-TM4 and TM8-TM9, are also conserved in other DMT transporters 9. Therefore, it is likely that the proposed transport model is widely shared among the other DMT superfamily proteins. 6
7 References 1. Jack, D. L., Yang, N. M. & Saier, M. H. The drug/metabolite transporter superfamily. Eur. J. Biochem. 268, (2001). 2. Chen, Y.-J. et al. X-ray structure of EmrE supports dual topology model. Proc. Natl. Acad. Sci. U. S. A. 104, (2007). 3. Västermark, Å., Almén, M. S., Simmen, M. W., Fredriksson, R. & Schiöth, H. B. Functional specialization in nucleotide sugar transporters occurred through differentiation of the gene cluster EamA (DUF6) before the radiation of Viridiplantae. BMC Evol. Biol. 11, 123 (2011). 4. Bay, D. C. & Turner, R. J. Diversity and evolution of the small multidrug resistance protein family. BMC Evol. Biol. 9, 140 (2009). 5. Ubarretxena-Belandia, I., Baldwin, J. M., Schuldiner, S. & Tate, C. G. Three-dimensional structure of the bacterial multidrug transporter EmrE shows it is an asymmetric homodimer. EMBO J. 22, (2003). 6. Rapp, M., Seppälä, S., Granseth, E. & von Heijne, G. Emulating membrane protein evolution by rational design. Science 315, (2007). 7. Marks, D. S. et al. Protein 3D structure computed from evolutionary sequence variation. PLoS One 6, 2 5 (2011). 8. Hopf, T. A. et al. Three-Dimensional Structures of Membrane Proteins from Genomic Sequencing. Cell 149, (2012). 9. Martin, R. E. & Kirk, K. The malaria parasite s chloroquine resistance transporter is a member of the drug/metabolite transporter superfamily. Mol. Biol. Evol. 21, (2004). 7
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11524 Supplementary discussion Functional analysis of the sugar porter family (SP) signature motifs. As seen in Fig. 5c, single point mutation of the conserved
More informationSUPPLEMENTARY INFORMATION
doi:1.138/nature1737 Supplementary Table 1 variant Description FSEC - 2B12 a FSEC - 6A1 a K d (leucine) c Leucine uptake e K (wild-type like) K (Y18F) K (TS) K (TSY) K288A mutant, lipid facing side chain
More informationSUPPLEMENTARY INFORMATION
Supplementary Table 1: Data collection, phasing and refinement statistics ChbC/Ta 6 Br 12 Native ChbC Data collection Space group P4 3 2 1 2 P4 3 2 1 2 Cell dimensions a, c (Å) 132.75, 453.57 132.81, 452.95
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11054 Supplementary Fig. 1 Sequence alignment of Na v Rh with NaChBac, Na v Ab, and eukaryotic Na v and Ca v homologs. Secondary structural elements of Na v Rh are indicated above the
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1. MhsT and LeuT architecture.
Supplementary Figure 1 MhsT and LeuT architecture. a, Cartoon structure representation and topology diagram for MhsT in the occluded inward-facing state and b, LeuT in the occluded outward-facing state
More informationSupplementary Figure S1. Urea-mediated buffering mechanism of H. pylori. Gastric urea is funneled to a cytoplasmic urease that is presumably attached
Supplementary Figure S1. Urea-mediated buffering mechanism of H. pylori. Gastric urea is funneled to a cytoplasmic urease that is presumably attached to HpUreI. Urea hydrolysis products 2NH 3 and 1CO 2
More informationSecondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure
Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11085 Supplementary Tables: Supplementary Table 1. Summary of crystallographic and structure refinement data Structure BRIL-NOP receptor Data collection Number of crystals 23 Space group
More informationMARTINI simulation details
S1 Appendix MARTINI simulation details MARTINI simulation initialization and equilibration In this section, we describe the initialization of simulations from Main Text section Residue-based coarsegrained
More informationβ1 Structure Prediction and Validation
13 Chapter 2 β1 Structure Prediction and Validation 2.1 Overview Over several years, GPCR prediction methods in the Goddard lab have evolved to keep pace with the changing field of GPCR structure. Despite
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More informationStructure Investigation of Fam20C, a Golgi Casein Kinase
Structure Investigation of Fam20C, a Golgi Casein Kinase Sharon Grubner National Taiwan University, Dr. Jung-Hsin Lin University of California San Diego, Dr. Rommie Amaro Abstract This research project
More informationof the Guanine Nucleotide Exchange Factor FARP2
Structure, Volume 21 Supplemental Information Structural Basis for Autoinhibition of the Guanine Nucleotide Exchange Factor FARP2 Xiaojing He, Yi-Chun Kuo, Tyler J. Rosche, and Xuewu Zhang Inventory of
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12045 Supplementary Table 1 Data collection and refinement statistics. Native Pt-SAD X-ray source SSRF BL17U SPring-8 BL41XU Wavelength (Å) 0.97947 1.07171 Space group P2 1 2 1 2 1 P2
More informationTransmembrane Domains (TMDs) of ABC transporters
Transmembrane Domains (TMDs) of ABC transporters Most ABC transporters contain heterodimeric TMDs (e.g. HisMQ, MalFG) TMDs show only limited sequence homology (high diversity) High degree of conservation
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Crystallization. a, Crystallization constructs of the ET B receptor are shown, with all of the modifications to the human wild-type the ET B receptor indicated. Residues interacting
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationSupporting Information How does Darunavir prevent HIV-1 protease dimerization?
Supporting Information How does Darunavir prevent HIV- protease dimerization? Danzhi Huang and Amedeo Caflisch a Department of Biochemistry University of Zürich, Winterthurerstrasse 9 CH-7 Zürich, Switzerland
More informationBuilding a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor
Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Presented by Stephanie Lee Research Mentor: Dr. Rob Coalson Glycine Alpha 1 Receptor (GlyRa1) Member of the superfamily
More informationSupplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation
Supplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation Javier L. Baylon, Ivan L. Lenov, Stephen G. Sligar and Emad Tajkhorshid
More informationBacterial protease uses distinct thermodynamic signatures for substrate recognition
Bacterial protease uses distinct thermodynamic signatures for substrate recognition Gustavo Arruda Bezerra, Yuko Ohara-Nemoto, Irina Cornaciu, Sofiya Fedosyuk, Guillaume Hoffmann, Adam Round, José A. Márquez,
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11744 Supplementary Table 1. Crystallographic data collection and refinement statistics. Wild-type Se-Met-BcsA-B SmCl 3 -soaked EMTS-soaked Data collection Space
More informationStructure to Function. Molecular Bioinformatics, X3, 2006
Structure to Function Molecular Bioinformatics, X3, 2006 Structural GeNOMICS Structural Genomics project aims at determination of 3D structures of all proteins: - organize known proteins into families
More informationEffect of intracellular loop 3 on intrinsic dynamics of human β 2 -adrenergic receptor. Ozcan et al.
Effect of intracellular loop 3 on intrinsic dynamics of human β 2 -adrenergic receptor Ozcan et al. Ozcan et al. BMC Structural Biology 2013, 13:29 Ozcan et al. BMC Structural Biology 2013, 13:29 RESEARCH
More informationProcheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics.
Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics Iosif Vaisman Email: ivaisman@gmu.edu ----------------------------------------------------------------- Bond
More informationHomology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6
Homology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6 Hsuan-Liang Liu* and Chin-Wen Chen Department of Chemical Engineering and Graduate Institute
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationDetails of Protein Structure
Details of Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Anne Mølgaard, Kemisk Institut, Københavns Universitet Learning Objectives
More informationRex-Family Repressor/NADH Complex
Kasey Royer Michelle Lukosi Rex-Family Repressor/NADH Complex Part A The biological sensing protein that we selected is the Rex-family repressor/nadh complex. We chose this sensor because it is a calcium
More informationHidden symmetries in primary sequences of small α proteins
Hidden symmetries in primary sequences of small α proteins Ruizhen Xu, Yanzhao Huang, Mingfen Li, Hanlin Chen, and Yi Xiao * Biomolecular Physics and Modeling Group, Department of Physics, Huazhong University
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Chemical structure of LPS and LPS biogenesis in Gram-negative bacteria. a. Chemical structure of LPS. LPS molecule consists of Lipid A, core oligosaccharide and O-antigen. The polar
More informationAdvanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions
BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start
More informationMembrane Protein Pumps
Membrane Protein Pumps Learning objectives You should be able to understand & discuss: Active transport-na + /K + ATPase ABC transporters Metabolite transport by lactose permease 1. Ion pumps: ATP-driven
More informationSUPPLEMENTARY INFORMATION
Supplementary Results DNA binding property of the SRA domain was examined by an electrophoresis mobility shift assay (EMSA) using synthesized 12-bp oligonucleotide duplexes containing unmodified, hemi-methylated,
More informationThe Potassium Ion Channel: Rahmat Muhammad
The Potassium Ion Channel: 1952-1998 1998 Rahmat Muhammad Ions: Cell volume regulation Electrical impulse formation (e.g. sodium, potassium) Lipid membrane: the dielectric barrier Pro: compartmentalization
More informationT H E J O U R N A L O F G E N E R A L P H Y S I O L O G Y. jgp
S u p p l e m e n ta l m at e r i a l jgp Lee et al., http://www.jgp.org/cgi/content/full/jgp.201411219/dc1 T H E J O U R N A L O F G E N E R A L P H Y S I O L O G Y S u p p l e m e n ta l D I S C U S
More informationBasic structures of proteins
Basic structures of proteins Structural Hierarchy of Protein Primary structure Functional elements : α-helix, strands, β-sheet, loops.. - Structure, affinity, activity, specificity, stability etc. Secondary
More informationModeling and Dynamics of the Inward-Facing State of a Na + /Cl 2 Dependent Neurotransmitter Transporter Homologue
Modeling and Dynamics of the Inward-Facing State of a Na + /Cl 2 Dependent Neurotransmitter Transporter Homologue Saher Afshan Shaikh 1, Emad Tajkhorshid 1,2 * 1 Department of Biochemistry and Beckman
More informationDATE A DAtabase of TIM Barrel Enzymes
DATE A DAtabase of TIM Barrel Enzymes 2 2.1 Introduction.. 2.2 Objective and salient features of the database 2.2.1 Choice of the dataset.. 2.3 Statistical information on the database.. 2.4 Features....
More informationSupporting online material
Supporting online material Materials and Methods Target proteins All predicted ORFs in the E. coli genome (1) were downloaded from the Colibri data base (2) (http://genolist.pasteur.fr/colibri/). 737 proteins
More informationPacking of Secondary Structures
7.88 Lecture Notes - 4 7.24/7.88J/5.48J The Protein Folding and Human Disease Professor Gossard Retrieving, Viewing Protein Structures from the Protein Data Base Helix helix packing Packing of Secondary
More informationSequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
More informationCentral Dogma. modifications genome transcriptome proteome
entral Dogma DA ma protein post-translational modifications genome transcriptome proteome 83 ierarchy of Protein Structure 20 Amino Acids There are 20 n possible sequences for a protein of n residues!
More informationStructural and mechanistic insight into the substrate. binding from the conformational dynamics in apo. and substrate-bound DapE enzyme
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the Owner Societies 215 Structural and mechanistic insight into the substrate binding from the conformational
More informationSupplemental Materials for. Structural Diversity of Protein Segments Follows a Power-law Distribution
Supplemental Materials for Structural Diversity of Protein Segments Follows a Power-law Distribution Yoshito SAWADA and Shinya HONDA* National Institute of Advanced Industrial Science and Technology (AIST),
More informationSupplementary figure 1. Comparison of unbound ogm-csf and ogm-csf as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine
Supplementary figure 1. Comparison of unbound and as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine GM-CSF (slate) with bound GM-CSF in the GIF:GM-CSF complex (GIF: green,
More informationEnhancing Specificity in the Janus Kinases: A Study on the Thienopyridine. JAK2 Selective Mechanism Combined Molecular Dynamics Simulation
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2015 Supporting Information Enhancing Specificity in the Janus Kinases: A Study on the Thienopyridine
More informationAny protein that can be labelled by both procedures must be a transmembrane protein.
1. What kind of experimental evidence would indicate that a protein crosses from one side of the membrane to the other? Regions of polypeptide part exposed on the outside of the membrane can be probed
More informationStructure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27
Acta Cryst. (2014). D70, doi:10.1107/s1399004714021695 Supporting information Volume 70 (2014) Supporting information for article: Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase
More informationNature Structural and Molecular Biology: doi: /nsmb.2938
Supplementary Figure 1 Characterization of designed leucine-rich-repeat proteins. (a) Water-mediate hydrogen-bond network is frequently visible in the convex region of LRR crystal structures. Examples
More informationCks1 CDK1 CDK1 CDK1 CKS1. are ice- lobe. conserved. conserved
Cks1 d CKS1 Supplementary Figure 1 The -Cks1 crystal lattice. (a) Schematic of the - Cks1 crystal lattice. -Cks1 crystallizes in a lattice that contains c 4 copies of the t - Cks1 dimer in the crystallographic
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10955 Supplementary Figures Supplementary Figure 1. Electron-density maps and crystallographic dimer structures of the motor domain. (a f) Stereo views of the final electron-density maps
More informationMajor Types of Association of Proteins with Cell Membranes. From Alberts et al
Major Types of Association of Proteins with Cell Membranes From Alberts et al Proteins Are Polymers of Amino Acids Peptide Bond Formation Amino Acid central carbon atom to which are attached amino group
More informationHeteropolymer. Mostly in regular secondary structure
Heteropolymer - + + - Mostly in regular secondary structure 1 2 3 4 C >N trace how you go around the helix C >N C2 >N6 C1 >N5 What s the pattern? Ci>Ni+? 5 6 move around not quite 120 "#$%&'!()*(+2!3/'!4#5'!1/,#64!#6!,6!
More informationPrediction and refinement of NMR structures from sparse experimental data
Prediction and refinement of NMR structures from sparse experimental data Jeff Skolnick Director Center for the Study of Systems Biology School of Biology Georgia Institute of Technology Overview of talk
More informationPROTEIN EVOLUTION AND PROTEIN FOLDING: NON-FUNCTIONAL CONSERVED RESIDUES AND THEIR PROBABLE ROLE
PROTEIN EVOLUTION AND PROTEIN FOLDING: NON-FUNCTIONAL CONSERVED RESIDUES AND THEIR PROBABLE ROLE O.B. PTITSYN National Cancer Institute, NIH, Laboratory of Experimental & Computational Biology, Molecular
More informationSupporting information to: Time-resolved observation of protein allosteric communication. Sebastian Buchenberg, Florian Sittel and Gerhard Stock 1
Supporting information to: Time-resolved observation of protein allosteric communication Sebastian Buchenberg, Florian Sittel and Gerhard Stock Biomolecular Dynamics, Institute of Physics, Albert Ludwigs
More informationSupplementary Figure 3 a. Structural comparison between the two determined structures for the IL 23:MA12 complex. The overall RMSD between the two
Supplementary Figure 1. Biopanningg and clone enrichment of Alphabody binders against human IL 23. Positive clones in i phage ELISA with optical density (OD) 3 times higher than background are shown for
More informationSUPPLEMENTARY INFORMATION
Table of Contents Page Supplementary Table 1. Diffraction data collection statistics 2 Supplementary Table 2. Crystallographic refinement statistics 3 Supplementary Fig. 1. casic1mfc packing in the R3
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11539 Supplementary Figure 1 Schematic representation of plant (A) and mammalian (B) P 2B -ATPase domain organization. Actuator (A-), nucleotide binding (N-),
More informationMolecular Dynamics Simulations of the Mammalian Glutamate Transporter EAAT3
Molecular Dynamics Simulations of the Mammalian Glutamate Transporter EAAT3 Germano Heinzelmann, Serdar Kuyucak* School of Physics, University of Sydney, NSW, Australia Abstract Excitatory amino acid transporters
More informationMembrane proteins Porins: FadL. Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella
Membrane proteins Porins: FadL Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella INDEX 1. INTRODUCTION TO MEMBRANE PROTEINS 2. FADL: OUTER MEMBRANE TRANSPORT PROTEIN 3. MAIN FEATURES OF FADL STRUCTURE
More informationSensitive NMR Approach for Determining the Binding Mode of Tightly Binding Ligand Molecules to Protein Targets
Supporting information Sensitive NMR Approach for Determining the Binding Mode of Tightly Binding Ligand Molecules to Protein Targets Wan-Na Chen, Christoph Nitsche, Kala Bharath Pilla, Bim Graham, Thomas
More informationApo and InsP 3 -bound crystal structures of the ligand-binding domain of an InsP 3 receptor
Published as: Nat Struct Mol Biol. ; 18(10): 1172 1174. Apo and InsP 3 -bound crystal structures of the ligand-binding domain of an InsP 3 receptor Chun-Chi Lin 1,2, Kyuwon Baek 1,2, and Zhe Lu 1 1 Department
More informationSUPPLEMENTARY INFORMATION
Supplementary Table 1: Amplitudes of three current levels. Level 0 (pa) Level 1 (pa) Level 2 (pa) TrkA- TrkH WT 200 K 0.01 ± 0.01 9.5 ± 0.01 18.7 ± 0.03 200 Na * 0.001 ± 0.01 3.9 ± 0.01 12.5 ± 0.03 200
More informationGoals. Structural Analysis of the EGR Family of Transcription Factors: Templates for Predicting Protein DNA Interactions
Structural Analysis of the EGR Family of Transcription Factors: Templates for Predicting Protein DNA Interactions Jamie Duke 1,2 and Carlos Camacho 3 1 Bioengineering and Bioinformatics Summer Institute,
More informationLots of thanks for many reasons!
Lots of thanks for many reasons! Structure and function of glutamate transporters from free energy simulations Turgut Baştuğ TOBB ETU Transporter structures Transporters have larger structures, which
More informationSupplementary Figure 1 Crystal packing of ClR and electron density maps. Crystal packing of type A crystal (a) and type B crystal (b).
Supplementary Figure 1 Crystal packing of ClR and electron density maps. Crystal packing of type A crystal (a) and type B crystal (b). Crystal contacts at B-C loop are magnified and stereo view of A-weighted
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationWhat makes a good graphene-binding peptide? Adsorption of amino acids and peptides at aqueous graphene interfaces: Electronic Supplementary
Electronic Supplementary Material (ESI) for Journal of Materials Chemistry B. This journal is The Royal Society of Chemistry 21 What makes a good graphene-binding peptide? Adsorption of amino acids and
More informationMembranes 2: Transportation
Membranes 2: Transportation Steven E. Massey, Ph.D. Associate Professor Bioinformatics Department of Biology University of Puerto Rico Río Piedras Office & Lab: NCN#343B Tel: 787-764-0000 ext. 7798 E-mail:
More informationElectrochemical Potential and the Thermodynamic Basis of Solute Transport Mechanisms
Electrochemical Potential and the Thermodynamic Basis of Solute Transport Mechanisms A. Electrochemical Potential The electrochemical potential arising from the distribution of a solute A across a membrane
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11991 Supplementary Figure 1 - Refinement strategy for PIC intermediate assemblies by negative stain EM. The cryo-negative stain structure of free Pol II 1 (a) was used as initial reference
More informationSupplementary Figure 1 Schematic overview of ASTNs in neuronal migration. (a) Schematic of roles played by ASTNs 1 and 2. ASTN-1-mediated adhesions
Supplementary Figure 1 Schematic overview of ASTNs in neuronal migration. (a) Schematic of roles played by ASTNs 1 and 2. ASTN-1-mediated adhesions undergo endocytosis into clathrin-coated vesicles dependent
More informationLipid Regulated Intramolecular Conformational Dynamics of SNARE-Protein Ykt6
Supplementary Information for: Lipid Regulated Intramolecular Conformational Dynamics of SNARE-Protein Ykt6 Yawei Dai 1, 2, Markus Seeger 3, Jingwei Weng 4, Song Song 1, 2, Wenning Wang 4, Yan-Wen 1, 2,
More informationIon Translocation Across Biological Membranes. Janos K. Lanyi University of California, Irvine
Ion Translocation Across Biological Membranes Janos K. Lanyi University of California, Irvine Examples of transmembrane ion pumps Protein Cofactor, substrate, etc. MW Subunits Mitoch. cytochrome oxidase
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationSupplementary information
Supplementary information The structural basis of modularity in ECF-type ABC transporters Guus B. Erkens 1,2, Ronnie P-A. Berntsson 1,2, Faizah Fulyani 1,2, Maria Majsnerowska 1,2, Andreja Vujičić-Žagar
More informationComparison between Bacteriorhodopsin and Halorhodopsin. Halorhodopsin (HR) and Bacteriorhodopsin (BR) belong to a subfamily of
Comparison between Bacteriorhodopsin and Halorhodopsin Halorhodopsin (HR) and Bacteriorhodopsin (BR) belong to a subfamily of heptahelical membrane proteins, the archaeal rhodopsins. They are found in
More informationMulti-Scale Hierarchical Structure Prediction of Helical Transmembrane Proteins
Multi-Scale Hierarchical Structure Prediction of Helical Transmembrane Proteins Zhong Chen Dept. of Biochemistry and Molecular Biology University of Georgia, Athens, GA 30602 Email: zc@csbl.bmb.uga.edu
More informationSubstrate Binding and Formation of an Occluded State in the Leucine Transporter
1600 Biophysical Journal Volume 94 March 2008 1600 1612 Substrate Binding and Formation of an Occluded State in the Leucine Transporter Leyla Celik,* y Birgit Schiøtt, y and Emad Tajkhorshid* *Department
More informationSupporting Text 1. Comparison of GRoSS sequence alignment to HMM-HMM and GPCRDB
Structure-Based Sequence Alignment of the Transmembrane Domains of All Human GPCRs: Phylogenetic, Structural and Functional Implications, Cvicek et al. Supporting Text 1 Here we compare the GRoSS alignment
More informationEquilibrated atomic models of outward-facing P-glycoprotein and effect of ATP binding on structural dynamics (Supplementary Information)
Equilibrated atomic models of outward-facing P-glycoprotein and effect of ATP binding on structural dynamics (Supplementary Information) Lurong Pan 1 and Stephen G. Aller 2 * 1,2 Department of Pharmacology
More informationProtein Structures: Experiments and Modeling. Patrice Koehl
Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:
More informationIntroduction to the Ribosome Overview of protein synthesis on the ribosome Prof. Anders Liljas
Introduction to the Ribosome Molecular Biophysics Lund University 1 A B C D E F G H I J Genome Protein aa1 aa2 aa3 aa4 aa5 aa6 aa7 aa10 aa9 aa8 aa11 aa12 aa13 a a 14 How is a polypeptide synthesized? 2
More informationSupplementary Information
Supplementary Information Resveratrol Serves as a Protein-Substrate Interaction Stabilizer in Human SIRT1 Activation Xuben Hou,, David Rooklin, Hao Fang *,,, Yingkai Zhang Department of Medicinal Chemistry
More informationSignal Transduction Phosphorylation Protein kinases. Misfolding diseases. Protein Engineering Lysozyme variants
Signal Transduction Phosphorylation Protein kinases Misfolding diseases Protein Engineering Lysozyme variants Cells and Signals Regulation The cell must be able to respond to stimuli Cellular activities
More informationSupersecondary Structures (structural motifs)
Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric
More informationBiotechnology of Proteins. The Source of Stability in Proteins (III) Fall 2015
Biotechnology of Proteins The Source of Stability in Proteins (III) Fall 2015 Conformational Entropy of Unfolding It is The factor that makes the greatest contribution to stabilization of the unfolded
More informationMembrane Protein Channels
Membrane Protein Channels Potassium ions queuing up in the potassium channel Pumps: 1000 s -1 Channels: 1000000 s -1 Pumps & Channels The lipid bilayer of biological membranes is intrinsically impermeable
More informationSUPPLEMENTARY INFORMATION. doi: /nature07461
Figure S1 Electrophysiology. a ph-activation of. Two-electrode voltage clamp recordings of Xenopus oocytes expressing in comparison to waterinjected oocytes. Currents were recorded at 40 mv. The ph of
More informationComputer simulations of protein folding with a small number of distance restraints
Vol. 49 No. 3/2002 683 692 QUARTERLY Computer simulations of protein folding with a small number of distance restraints Andrzej Sikorski 1, Andrzej Kolinski 1,2 and Jeffrey Skolnick 2 1 Department of Chemistry,
More informationHomology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
More informationBioengineering & Bioinformatics Summer Institute, Dept. Computational Biology, University of Pittsburgh, PGH, PA
Pharmacophore Model Development for the Identification of Novel Acetylcholinesterase Inhibitors Edwin Kamau Dept Chem & Biochem Kennesa State Uni ersit Kennesa GA 30144 Dept. Chem. & Biochem. Kennesaw
More informationHomologous proteins have similar structures and structural superposition means to rotate and translate the structures so that corresponding atoms are
1 Homologous proteins have similar structures and structural superposition means to rotate and translate the structures so that corresponding atoms are as close to each other as possible. Structural similarity
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationStructure-Function Relationship of Cytoplasmic and Nuclear IkB Proteins: An In Silico Analysis
Structure-Function Relationship of Cytoplasmic and Nuclear IkB Proteins: An In Silico Analysis Balachandran Manavalan 1, Shaherin Basith 1, Yong-Min Choi 1, Gwang Lee 1,2, Sangdun Choi 1 * 1 Department
More informationTable 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2
Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More information