A novel laminin β gene BmLanB1-w regulates wing-specific cell adhesion in silkworm, Bombyx mori
|
|
|
- Allyson Neal
- 5 years ago
- Views:
Transcription
1 Supplementary information A novel laminin β gene BmLanB1-w regulates wing-specific cell adhesion in silkworm, Bombyx mori Xiaoling Tong*, Songzhen He *, Jun Chen, Hai Hu, Zhonghuai Xiang, Cheng Lu and Fangyin Dai State Key Laboratory of Silkworm Genome Biology, Key Laboratory for Sericulture Functional Genomics and Biotechnology of Agricultural Ministry, Southwest University, Chongqing, , China *These authors contributed equally to this work. Corresponding authors: State Key Laboratory of Silkworm Genome Biology, Key Laboratory for Sericulture Functional Genomics and Biotechnology of Agricultural Ministry, Southwest University, No. 1 Tiansheng Rd., Beibei District, Chongqing, , China. fydai@swu.edu.cn; lucheng@swu.edu.cn 2 Supplementary Figures 2 Supplementary Tables
2 Supplementary Figure legends Figure S1 - Numbers of laminins in various species. We identified laminin genes in Caenorhabditis elegans, Bombyx mori, Plutella xylostella, Heliconius melpomene, Danaus plexippus, Tribolium castaneum, and Apis mellifera. Numbers of laminins in Homo sapiens, Mus musculus, and are listed based on previous studies 8, 26. Note that the numbers of laminins are different among the four lepidopterans. An extra α chain is present in P. xylostella and an additional β chain is observed in silkworm. Figure S2 - Phylogenetic analysis of laminin β in various species. Maximum likelihood tree was constructed based on the amino acid sequences of laminin β. Two distinct orthologous groups are observed in the tree representing insects and vertebrates, respectively. Abbreviations, Bm: Bombyx mori, Dm:, Am: Apis mellifera, Aa: Aedes aegypti, Tc: Tribolium castaneum, Hs: Homo sapiens, Dr: Danio rerio, Ce: Caenorhabditis elegans. Accession NO.s: HsLanβ1 (NP_ ), HsLanβ2 (NP_ ), HsLanβ3 (NP_ ), HsLanβ4 (NP_ ), DrLanβ1a (NP_ ), DrLanβ1b (NP_ ), DrLanβ2 (NP_ ), DrLanβ2I (XP_ ), DrLanβ3 (XP_ ), DrLanβ4 (NP_ ), AmLanB1 (XP_ ), TcLanB1 (XP_ ), DmLanB1 (NP_ ), AaLanB1 (XP_ ), CeLanB1 (NP_ ).
3 Figure S1.
4 Figure S2.
5 Table S1 The primers used in this work. Object Name Sequence (5 3 ) Linkage analysis S2213-F GCCTTTATTAACGGATGCGGG S2213-R S1309-F S1309-R S1311-F S1311-R M1-F M1-R M2-F M2-R M F M R AATGAGCGATTTAGTGGGCAA TTACAACTTTGAGATGCGATTTT GCAGATTTAATCGGCGTTCCC ACTACCCGTAGTTGTAATTTGATCTTTT ACGTGTTTGGTTTGCTCGCT CTCTAGCAAGAGCGGTGGTT ACTCTGCCTTACCTTCTTCGT CTCTGAAGACATTCCGCTAA TACGACAATGACGCAAGG GTGCTGGCGTTGTGATTAG CCACTTCCTGGGCTGACT primers for cloning 5'RACE-GSP GTATCGGTAGGTCCGCCAGGTTTTT 5'RACE-nestGSP 3'RACE-GSP 3'RACE-nestGSP P1 -F P1 -R P2 -F P2 -R P3-F P3-R P4-F P4-R GCAGAGTAGCGTTGGTAGAATCG ACGAGGCTCAAGCAGCACAAGATG ACAAATGTTGCTGGACCGTGCTAC AGAGACTACACCGCAGTATGAT AAAGCCCAAGCGAGGA GGGTGGGTCATTAGACCACG TGAGGAGATAATGAGCCTACGG GAATACCGCTGGAGATAGTTG GTGCCCGTTCCCTTGA CTTGAAGCCCTACGATTACGA GCTACATACACAACATACATACGC Quantitative RT PCR BmLanB1-wQ-F CGAGGCTCAAGCAGCACAAGA BmLanB1-wQ-R BGIBMGA002018Q-F BGIBMGA002018Q-R CGGTAAATGCGAAAGTCGTAATC CAACTGCGGCGGTGAGAC CCCATAAACGGCTGGTAGAAG
6 BGIBMGA000910Q-F TGGAACTGGATGTGACCCTTG BGIBMGA000910Q-R BGIBMGA002114Q-F BGIBMGA002114Q-R BGIBMGA001218Q-F BGIBMGA001218Q-R sw F sw R TTGTGTATGCTCCTGTGGCG CAATGAATCCAGGCTTCTCGC TCGGCTATCAAACGGTCCAG GGTATTCCCCGCTTTTCACG CAGGTGTGGGCTGGACATCTT TTCGTACTGGCTCTTCTCGT CAAAGTTGATAGCAATTCCCT RNAi BmLanB1-wdsRNA1-F TAATACGACTCACTATAGGGAGAATCTGCCAGTAATAATGCCAATC BmLanB1-wdsRNA1-R TAATACGACTCACTATAGGGAGAGCTTCGTAGCACGGTCCAG BmLanB1-wdsRNA2-F TAATACGACTCACTATAGGGAGAAGCGGAACTCAAAGCAAGA BmLanB1-wdsRNA2-R TAATACGACTCACTATAGGGAGACGAAAAACATTTAAGGGCAT BmLanB1-wdsRNA3-F TAATACGACTCACTATAGGGAGAGTTGAAGCCCTACGATTACGA BmLanB1-wdsRNA3-R TAATACGACTCACTATAGGGAGAGCACAATATCTGTAGTTCTCGGA
7 Table S2 Abbreviation table of proteins used in phylogenetic trees Abbreviation Species Subunits Accession NO. Dmwb lamininα AAD31714 DmLanA lamininα AAF50672 DmLanB1 lamininβ AAF52563 DmLanB2 lamininγ AAF50238 AmLanα1,2 Apis mellifera lamininα XP_ AmLanA Apis mellifera lamininα XP_ AmLanB1 Apis mellifera lamininβ XP_ AmLanB2 Apis mellifera lamininγ XP_ AaLanα1,2 Aedes aegypti lamininα XP_ AaLanA Aedes aegypti lamininα XP_ AaLanB1 Aedes aegypti lamininβ XP_ AaLanB2 Aedes aegypti lamininγ XP_ TcLanα1,2 Tribolium castaneum lamininα XP_ TcLanA Tribolium castaneum lamininα XP_ TcLanB1 Tribolium castaneum lamininβ EFA11219 TcLanB2 Tribolium castaneum lamininγ XP_ HsLanα2 Homo sapiens lamininα XP_ HsLanα3 Homo sapiens lamininα NP_ HsLanB1 Homo sapiens lamininβ AAA59482 HsLanB2 Homo sapiens lamininγ AAA59492 CeLanA Caenorhabditis elegans lamininα BAA32347 CeLanB1 Caenorhabditis elegans lamininβ NP_ CeLanB2 Caenorhabditis elegans lamininγ NP_509204
GATA family of transcription factors of vertebrates: phylogenetics and chromosomal synteny
Phylogenetics and chromosomal synteny of the GATAs 1273 GATA family of transcription factors of vertebrates: phylogenetics and chromosomal synteny CHUNJIANG HE, HANHUA CHENG* and RONGJIA ZHOU* Department
Comparing Genomes! Homologies and Families! Sequence Alignments!
Comparing Genomes! Homologies and Families! Sequence Alignments! Allows us to achieve a greater understanding of vertebrate evolution! Tells us what is common and what is unique between different species
SUPPLEMENTARY INFORMATION
doi:1.138/nature1213 Supplementary Table 1. The Taxonomy of the Organisms Used in this Study Organism (acronym) Taxonomy Yeasts Zygosacharomyces rouxii (Zrou) Verterbrates Xenopus tropicalis (Xtro) Gallus
Marine medaka ATP-binding cassette (ABC) superfamily and new insight into teleost Abch nomenclature
Supplementary file for: Marine medaka ATP-binding cassette (ABC) superfamily and new insight into teleost Abch nomenclature Chang-Bum Jeong a,b,#, Bo-Mi Kim a,#, Hye-Min Kang a, Ik-Young Choi c, Jae-Sung
Genome-wide comparison of genes involved in the biosynthesis, metabolism, and signaling of juvenile hormone between silkworm and other insects
Research Article Genetics and Molecular Biology, 37, 2, 444-459 (2014) Copyright 2014, Sociedade Brasileira de Genética. Printed in Brazil www.sbg.org.br Genome-wide comparison of genes involved in the
Title: A novel mechanism of protein thermostability: a unique N-terminal domain confers
1 2 Title: A novel mechanism of protein thermostability: a unique N-terminal domain confers heat resistance to Fe/Mn-SODs 3 4 Running Title: Thermostability-improving peptide for SODs 5 6 7 8 Authors Wei
Supplementary Information
Supplementary Information Rice APC/C TE controls tillering through mediating the degradation of MONOCULM 1 Qibing Lin 1*, Dan Wang 1*, Hui Dong 2*, Suhai Gu 1, Zhijun Cheng 1, Jie Gong 2, Ruizhen Qin 1,
Supporting Information
Supporting Information Pueyo et al. 10.1073/pnas.0804093105 SI Text Periplaneta americana (Delta GenBank Accession Number FJ222590). MR- WTQQTRVQGAVVVVILAALQQVCCSGVFELRLKSF- INDYGKDSVGQCCSGTPSPGTKACSGPCRTRFRVCL-
Hands-On Nine The PAX6 Gene and Protein
Hands-On Nine The PAX6 Gene and Protein Main Purpose of Hands-On Activity: Using bioinformatics tools to examine the sequences, homology, and disease relevance of the Pax6: a master gene of eye formation.
Procedure to Create NCBI KOGS
Procedure to Create NCBI KOGS full details in: Tatusov et al (2003) BMC Bioinformatics 4:41. 1. Detect and mask typical repetitive domains Reason: masking prevents spurious lumping of non-orthologs based
Large-scale gene family analysis of 76 Arthropods
Large-scale gene family analysis of 76 Arthropods i5k webinar / September 5, 28 Gregg Thomas @greggwcthomas Indiana University The genomic basis of Arthropod diversity https://www.biorxiv.org/content/early/28/8/4/382945
Biased amino acid composition in warm-blooded animals
Biased amino acid composition in warm-blooded animals Guang-Zhong Wang and Martin J. Lercher Bioinformatics group, Heinrich-Heine-University, Düsseldorf, Germany Among eubacteria and archeabacteria, amino
Graph Alignment and Biological Networks
Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale
2. Der Dissertation zugrunde liegende Publikationen und Manuskripte. 2.1 Fine scale mapping in the sex locus region of the honey bee (Apis mellifera)
2. Der Dissertation zugrunde liegende Publikationen und Manuskripte 2.1 Fine scale mapping in the sex locus region of the honey bee (Apis mellifera) M. Hasselmann 1, M. K. Fondrk², R. E. Page Jr.² und
The Developmental Transcriptome of the Mosquito Aedes aegypti, an invasive species and major arbovirus vector.
The Developmental Transcriptome of the Mosquito Aedes aegypti, an invasive species and major arbovirus vector. Omar S. Akbari*, Igor Antoshechkin*, Henry Amrhein, Brian Williams, Race Diloreto, Jeremy
Supplemental Figure 1.
Supplemental Material: Annu. Rev. Genet. 2015. 49:213 42 doi: 10.1146/annurev-genet-120213-092023 A Uniform System for the Annotation of Vertebrate microrna Genes and the Evolution of the Human micrornaome
CGS 5991 (2 Credits) Bioinformatics Tools
CAP 5991 (3 Credits) Introduction to Bioinformatics CGS 5991 (2 Credits) Bioinformatics Tools Giri Narasimhan 8/26/03 CAP/CGS 5991: Lecture 1 1 Course Schedules CAP 5991 (3 credit) will meet every Tue
Pyrobayes: an improved base caller for SNP discovery in pyrosequences
Pyrobayes: an improved base caller for SNP discovery in pyrosequences Aaron R Quinlan, Donald A Stewart, Michael P Strömberg & Gábor T Marth Supplementary figures and text: Supplementary Figure 1. The
microrna Studies Chen-Hanson Ting SVFIG June 23, 2018
microrna Studies Chen-Hanson Ting SVFIG June 23, 2018 Summary MicroRNA (mirna) Species and organisms studied mirna in mitocondria Huge genome files mirna in human Chromosome 1 mirna in bacteria Tools used
Quantitative Measurement of Genome-wide Protein Domain Co-occurrence of Transcription Factors
Quantitative Measurement of Genome-wide Protein Domain Co-occurrence of Transcription Factors Arli Parikesit, Peter F. Stadler, Sonja J. Prohaska Bioinformatics Group Institute of Computer Science University
Hereditary Hemochromatosis
Hereditary Hemochromatosis The HFE gene Becky Reese What is hereditary hemochromatosis? Recessively inherited Iron overload disorder Inability to regulate iron absorption No cure http://www.consultant360.com/article/genetics-gastroenterology-what-you-need-know-part-1
Characterization and expression profiling of ATP-binding cassette transporter genes in the diamondback moth, Plutella xylostella (L.
Qi et al. BMC Genomics (2016) 17:760 DOI 10.1186/s12864-016-3096-1 RESEARCH ARTICLE Open Access Characterization and expression profiling of ATP-binding cassette transporter genes in the diamondback moth,
RNA polymerase II clustering through carboxyterminal domain phase separation
SUPPLEMENTARY INFORMATION Articles https://doi.org/10.1038/s41594-018-0112-y In the format provided by the authors and unedited. RNA polymerase II clustering through carboxyterminal domain phase separation
Cryo-EM data collection, refinement and validation statistics
1 Table S1 Cryo-EM data collection, refinement and validation statistics Data collection and processing CPSF-160 WDR33 (EMDB-7114) (PDB 6BM0) CPSF-160 WDR33 (EMDB-7113) (PDB 6BLY) CPSF-160 WDR33 CPSF-30
Supplementary text for the section Interactions conserved across species: can one select the conserved interactions?
1 Supporting Information: What Evidence is There for the Homology of Protein-Protein Interactions? Anna C. F. Lewis, Nick S. Jones, Mason A. Porter, Charlotte M. Deane Supplementary text for the section
Quantitative and qualitative analyses. of in-paralogs
Quantitative and qualitative analyses of in-paralogs Dissertation zur Erlangung des naturwissentschaflichen Doktorgrades der Bayerischen Julius-Maximilians Universität Würzburg vorgelegt von Stanislav
Small RNA in rice genome
Vol. 45 No. 5 SCIENCE IN CHINA (Series C) October 2002 Small RNA in rice genome WANG Kai ( 1, ZHU Xiaopeng ( 2, ZHONG Lan ( 1,3 & CHEN Runsheng ( 1,2 1. Beijing Genomics Institute/Center of Genomics and
BLAST Database Searching. BME 110: CompBio Tools Todd Lowe April 8, 2010
BLAST Database Searching BME 110: CompBio Tools Todd Lowe April 8, 2010 Admin Reading: Read chapter 7, and the NCBI Blast Guide and tutorial http://www.ncbi.nlm.nih.gov/blast/why.shtml Read Chapter 8 for
Aoife McLysaght Dept. of Genetics Trinity College Dublin
Aoife McLysaght Dept. of Genetics Trinity College Dublin Evolution of genome arrangement Evolution of genome content. Evolution of genome arrangement Gene order changes Inversions, translocations Evolution
BLAST. Varieties of BLAST
BLAST Basic Local Alignment Search Tool (1990) Altschul, Gish, Miller, Myers, & Lipman Uses short-cuts or heuristics to improve search speed Like speed-reading, does not examine every nucleotide of database
Supplementary Information. Recognition of the pre-mirna structure by Drosophila Dicer-1
Supplementary Information Recognition of the pre-mirna structure by Drosophila Dicer-1 Akihisa Tsutsumi 1,2, Tomoko Kawamata 1, Natsuko Izumi 1 Hervé Seitz 3,4 and Yukihide Tomari 1,2 Nature Structural
BIOINFORMATICS LAB AP BIOLOGY
BIOINFORMATICS LAB AP BIOLOGY Bioinformatics is the science of collecting and analyzing complex biological data. Bioinformatics combines computer science, statistics and biology to allow scientists to
GENERAL BIOLOGY LABORATORY EXERCISE Amino Acid Sequence Analysis of Cytochrome C in Bacteria and Eukarya Using Bioinformatics
GENERAL BIOLOGY LABORATORY EXERCISE Amino Acid Sequence Analysis of Cytochrome C in Bacteria and Eukarya Using Bioinformatics INTRODUCTION: All life forms undergo metabolic processes to obtain energy.
The MANTiS Manual. Contents. MANTiS Version 1.1
The MANTiS Manual MANTiS Version 1.1 Contents Connection to the MANTiS database... 2 Memory settings... 2 Main functionalities... 2 Character Mapping View... 4 Genome content View... 5 Biological processes
Unit 5: Cell Division and Development Guided Reading Questions (45 pts total)
Name: AP Biology Biology, Campbell and Reece, 7th Edition Adapted from chapter reading guides originally created by Lynn Miriello Chapter 12 The Cell Cycle Unit 5: Cell Division and Development Guided
Hexapoda Origins: Monophyletic, Paraphyletic or Polyphyletic? Rob King and Matt Kretz
Hexapoda Origins: Monophyletic, Paraphyletic or Polyphyletic? Rob King and Matt Kretz Outline Review Hexapod Origins Response to Hexapod Origins How the same data = different trees Arthropod Origins The
Supplemental Table 1. Primers used for cloning and PCR amplification in this study
Supplemental Table 1. Primers used for cloning and PCR amplification in this study Target Gene Primer sequence NATA1 (At2g393) forward GGG GAC AAG TTT GTA CAA AAA AGC AGG CTT CAT GGC GCC TCC AAC CGC AGC
Application of new distance matrix to phylogenetic tree construction
Application of new distance matrix to phylogenetic tree construction P.V.Lakshmi Computer Science & Engg Dept GITAM Institute of Technology GITAM University Andhra Pradesh India Allam Appa Rao Jawaharlal
Genome sequence of Plasmopara viticola and insight into the pathogenic mechanism
Genome sequence of Plasmopara viticola and insight into the pathogenic mechanism Ling Yin 1,3,, Yunhe An 1,2,, Junjie Qu 3,, Xinlong Li 1, Yali Zhang 1, Ian Dry 5, Huijun Wu 2*, Jiang Lu 1,4** 1 College
Sequencing alignment Ameer Effat M. Elfarash
Sequencing alignment Ameer Effat M. Elfarash Dept. of Genetics Fac. of Agriculture, Assiut Univ. aelfarash@aun.edu.eg Why perform a multiple sequence alignment? MSAs are at the heart of comparative genomics
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
SUPPLEMENTARY INFORMATION
doi:10.1038/nature12414 Supplementary Figure 1 a b Illumina 521M reads, single-end/76 bp Illumina 354M reads, paired-end/ bp raw read processing Trinity assembly primary assembly: 189,820 transcripts Frequency
Hox genes and evolution of body plan
Hox genes and evolution of body plan Prof. LS Shashidhara Indian Institute of Science Education and Research (IISER), Pune ls.shashidhara@iiserpune.ac.in 2009 marks 150 years since Darwin and Wallace proposed
RELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES
Molecular Biology-2018 1 Definitions: RELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES Heterologues: Genes or proteins that possess different sequences and activities. Homologues: Genes or proteins that
Exploring metazoan evolution through dynamic and holistic changes in protein families and domains
Wang et al. BMC Evolutionary Biology 2012, 12:138 RESEARCH ARTICLE Open Access Exploring metazoan evolution through dynamic and holistic changes in protein families and domains Zhengyuan Wang 1, Dante
Master Biomedizin ) UCSC & UniProt 2) Homology 3) MSA 4) Phylogeny. Pablo Mier
Master Biomedizin 2018 1) UCSC & UniProt 2) Homology 3) MSA 4) 1 12 a. All of the sequences in file1.fasta (https://cbdm.uni-mainz.de/mb18/) are homologs. How many groups of orthologs would you say there
Fig. S1. Proliferation and cell cycle exit are affected by the med mutation. (A,B) M-phase nuclei are visualized by a-ph3 labeling in wild-type (A)
Fig. S1. Proliferation and cell cycle exit are affected by the med mutation. (A,B) M-phase nuclei are visualized by a-ph3 labeling in wild-type (A) and mutant (B) 4 dpf retinae. The central retina of the
Introduction to Bioinformatics
Introduction to Bioinformatics Lecture : p he biological problem p lobal alignment p Local alignment p Multiple alignment 6 Background: comparative genomics p Basic question in biology: what properties
Molecular Cloning and Characterization of the First Caspase in the Striped Stem Borer, Chilo suppressalis
Int. J. Mol. Sci. 2013, 14, 10229-10241; doi:10.3390/ijms140510229 Article OPEN ACCESS International Journal of Molecular Sciences ISSN 1422-0067 www.mdpi.com/journal/ijms Molecular Cloning and Characterization
Nature Genetics: doi: /ng Supplementary Figure 1. The phenotypes of PI , BR121, and Harosoy under short-day conditions.
Supplementary Figure 1 The phenotypes of PI 159925, BR121, and Harosoy under short-day conditions. (a) Plant height. (b) Number of branches. (c) Average internode length. (d) Number of nodes. (e) Pods
Ensembl focuses on metazoan (animal) genomes. The genomes currently available at the Ensembl site are:
Comparative genomics and proteomics Species available Ensembl focuses on metazoan (animal) genomes. The genomes currently available at the Ensembl site are: Vertebrates: human, chimpanzee, mouse, rat,
Reassessing Domain Architecture Evolution of Metazoan Proteins: Major Impact of Gene Prediction Errors
Genes 2011, 2, 449-501; doi:10.3390/genes2030449 Article OPEN ACCESS genes ISSN 2073-4425 www.mdpi.com/journal/genes Reassessing Domain Architecture Evolution of Metazoan Proteins: Major Impact of Gene
Female Behaviour Drives Expression and Evolution of Gustatory Receptors in Butterflies
Female Behaviour Drives Expression and Evolution of Gustatory Receptors in Butterflies Adriana D. Briscoe 1 *, Aide Macias-Muñoz 1, Krzysztof M. Kozak 2, James R. Walters 3, Furong Yuan 1, Gabriel A. Jamie
Improving Hox Protein Classification across the Major Model Organisms
Improving Hox Protein Classification across the Major Model Organisms Stefanie D. Hueber, Georg F. Weiller*, Michael A. Djordjevic, Tancred Frickey Genomic Interactions Group, Research School of Biology,
Exploring Evolution & Bioinformatics
Chapter 6 Exploring Evolution & Bioinformatics Jane Goodall The human sequence (red) differs from the chimpanzee sequence (blue) in only one amino acid in a protein chain of 153 residues for myoglobin
Sequencing alignment Ameer Effat M. Elfarash
Sequencing alignment Ameer Effat M. Elfarash Dept. of Genetics Fac. of Agriculture, Assiut Univ. amir_effat@yahoo.com Why perform a multiple sequence alignment? MSAs are at the heart of comparative genomics
Supplemental Data. Perea-Resa et al. Plant Cell. (2012) /tpc
Supplemental Data. Perea-Resa et al. Plant Cell. (22)..5/tpc.2.3697 Sm Sm2 Supplemental Figure. Sequence alignment of Arabidopsis LSM proteins. Alignment of the eleven Arabidopsis LSM proteins. Sm and
SLiM Analysis in Human SALMs and Linx
Worcester Polytechnic Institute Digital WPI Major Qualifying Projects (All Years) Major Qualifying Projects January 2017 SLiM Analysis in Human SALMs and Linx Daniele Anina Worcester Polytechnic Institute
Camello, a novel family of Histone Acetyltransferases that acetylate histone H4 and is essential for zebrafish development
Supplementary Information: Camello, a novel family of Histone Acetyltransferases that acetylate histone H4 and is essential for zebrafish development Krishanpal Karmodiya 1, Krishanpal Anamika 1,2, Vijaykumar
Computational Structural Bioinformatics
Computational Structural Bioinformatics ECS129 Instructor: Patrice Koehl http://koehllab.genomecenter.ucdavis.edu/teaching/ecs129 koehl@cs.ucdavis.edu Learning curve Math / CS Biology/ Chemistry Pre-requisite
ECOL/MCB 320 and 320H Genetics
ECOL/MCB 320 and 320H Genetics Instructors Dr. C. William Birky, Jr. Dept. of Ecology and Evolutionary Biology Lecturing on Molecular genetics Transmission genetics Population and evolutionary genetics
Prentice Hall. Biology: Concepts and Connections, 6th edition 2009, (Campbell, et. al) High School
Prentice Hall Biology: Concepts and Connections, 6th edition 2009, (Campbell, et. al) High School C O R R E L A T E D T O Correlation to the Mississippi Curriculum Frameworks - Biology II (High School)
DNA Barcoding and taxonomy of Glossina
DNA Barcoding and taxonomy of Glossina Dan Masiga Molecular Biology and Biotechnology Department, icipe & Johnson Ouma Trypanosomiasis Research Centre, KARI The taxonomic problem Following ~250 years of
Cubic Spline Interpolation Reveals Different Evolutionary Trends of Various Species
Cubic Spline Interpolation Reveals Different Evolutionary Trends of Various Species Zhiqiang Li 1 and Peter Z. Revesz 1,a 1 Department of Computer Science, University of Nebraska-Lincoln, Lincoln, NE,
Introduction to Bioinformatics. Shifra Ben-Dor Irit Orr
Introduction to Bioinformatics Shifra Ben-Dor Irit Orr Lecture Outline: Technical Course Items Introduction to Bioinformatics Introduction to Databases This week and next week What is bioinformatics? A
Connection-improved conductive network of carbon nanotubes in the rubber crosslink network
Supporting Information Connection-improved conductive network of carbon nanotubes in the rubber crosslink network Lin Gan, Ming Dong, Ying Han, Yanfang Xiao, Lin Yang, Jin Huang* School of Chemistry and
Phylogenetic analysis of ionotropic L- glutamate receptor genes in the Bilateria, with special notes on Aplysia californica
Greer et al. BMC Evolutionary Biology (2017) 17:11 DOI 10.1186/s12862-016-0871-1 RESEARCH ARTICLE Open Access Phylogenetic analysis of ionotropic L- glutamate receptor genes in the Bilateria, with special
D. Incorrect! That is what a phylogenetic tree intends to depict.
Genetics - Problem Drill 24: Evolutionary Genetics No. 1 of 10 1. A phylogenetic tree gives all of the following information except for. (A) DNA sequence homology among species. (B) Protein sequence similarity
Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata.
Supplementary Note S2 Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Phylogenetic trees reconstructed by a variety of methods from either single-copy orthologous loci (Class
MiGA: The Microbial Genome Atlas
December 12 th 2017 MiGA: The Microbial Genome Atlas Jim Cole Center for Microbial Ecology Dept. of Plant, Soil & Microbial Sciences Michigan State University East Lansing, Michigan U.S.A. Where I m From
Computational Biology, Part 24 Clustering and Unmixing of Subcellular Patterns
Computational Biology, Part 24 Clustering and Unmixing of Subcellular Patterns Robert F. Murphy Copyright 1996, 1999, 2000-2009. All rights reserved. Unsupervised Learning to Identify High-Resolution Protein
High class-imbalance in pre-mirna prediction: a novel approach based on deepsom
IEEE/ACM TRANS. ON COMPUTATIONAL BIOLOGY AND BIOINFORMATICS, APRIL 2016 1 High class-imbalance in pre-mirna prediction: a novel approach based on deepsom G. Stegmayer, Member, IEEE, C. Yones, L. Kamenetzky,
Towards a Comprehensive Annotation of Structured RNAs in Drosophila
Towards a Comprehensive Annotation of Structured RNAs in Drosophila Rebecca Kirsch 31st TBI Winterseminar, Bled 20/02/2016 Studying Non-Coding RNAs in Drosophila Why Drosophila? especially for novel molecules
Advanced Algorithms and Models for Computational Biology
Advanced Algorithms and Models for Computational Biology Introduction to cell biology genomics development and probability Eric ing Lecture January 3 006 Reading: Chap. DTM book Introduction to cell biology
Butterfly genomics: insights from the genome of Melitaea cinxia
Ann. Zool. Fennici 54: 275 291 ISSN 0003-455X (print), ISSN 1797-2450 (online) Helsinki 15 May 2017 Finnish Zoological and Botanical Publishing Board 2017 Ilkka Hanski: The legacy of a multifaceted ecologist
York University School of Medicine, 550 First Avenue, MSB 599, New York, New York 10016, USA.
SCF Fbxl3 Ubiquitin Ligase Targets Cryptochromes at Their Cofactor Pocket Weiman Xing 1,2, Luca Busino 3, Thomas R. Hinds 1, Samuel T. Marionni 4, Nabiha H. Saifee 1, Matthew F. Bush 4, Michele Pagano
Introduction to protein alignments
Introduction to protein alignments Comparative Analysis of Proteins Experimental evidence from one or more proteins can be used to infer function of related protein(s). Gene A Gene X Protein A compare
Genomics and bioinformatics summary. Finding genes -- computer searches
Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY METHODS Mef2 primary screen. RNAi hairpins from the VDRC collection were crossed to Mef2-GAL4 at 27 C. After 2 weeks lethality rate and stage was scored, and if possible 20-30 males containing
Computational Biology: Basics & Interesting Problems
Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information
Characterization of the Drosophila melanogaster alkali-metal/proton exchanger (NHE) gene family
The Journal of Experimental Biology 24, 373 3716 (21) Printed in Great Britain The Company of Biologists Limited 21 JEB3616 373 Characterization of the Drosophila melanogaster alkali-metal/proton exchanger
Synonymous Codon Substitution Matrices
Synonymous Codon Substitution Matrices Adrian Schneider, Gaston H. Gonnet, and Gina M. Cannarozzi Computational Biology Research Group, Institute for Computational Science, ETH Zürich, Universitätstrasse
NUCLEOTIDE SUBSTITUTIONS AND THE EVOLUTION OF DUPLICATE GENES
Conery, J.S. and Lynch, M. Nucleotide substitutions and evolution of duplicate genes. Pacific Symposium on Biocomputing 6:167-178 (2001). NUCLEOTIDE SUBSTITUTIONS AND THE EVOLUTION OF DUPLICATE GENES JOHN
Systematic prediction of gene function in Arabidopsis thaliana using a probabilistic functional gene network
Systematic prediction of gene function in Arabidopsis thaliana using a probabilistic functional gene network Sohyun Hwang 1, Seung Y Rhee 2, Edward M Marcotte 3,4 & Insuk Lee 1 protocol 1 Department of
changes in gene expression, we developed and tested several models. Each model was
Additional Files Additional File 1 File format: PDF Title: Experimental design and linear models Description: This additional file describes in detail the experimental design and linear models used to
Nature Biotechnology: doi: /nbt Supplementary Figure 1. Detailed overview of the primer-free full-length SSU rrna library preparation.
Supplementary Figure 1 Detailed overview of the primer-free full-length SSU rrna library preparation. Detailed overview of the primer-free full-length SSU rrna library preparation. Supplementary Figure
Supplementary Figure 1 Schematic overview of ASTNs in neuronal migration. (a) Schematic of roles played by ASTNs 1 and 2. ASTN-1-mediated adhesions
Supplementary Figure 1 Schematic overview of ASTNs in neuronal migration. (a) Schematic of roles played by ASTNs 1 and 2. ASTN-1-mediated adhesions undergo endocytosis into clathrin-coated vesicles dependent
EVOLUTIONARY DISTANCE MODEL BASED ON DIFFERENTIAL EQUATION AND MARKOV PROCESS
August 0 Vol 4 No 005-0 JATIT & LLS All rights reserved ISSN: 99-8645 wwwjatitorg E-ISSN: 87-95 EVOLUTIONAY DISTANCE MODEL BASED ON DIFFEENTIAL EUATION AND MAKOV OCESS XIAOFENG WANG College of Mathematical
CRISPRseek Workshop Design of target-specific guide RNAs in CRISPR-Cas9 genome-editing systems
April 2008 CRISPRseek Workshop Design of target-specific guide RNAs in CRISPR-Cas9 genome-editing systems Lihua Julie Zhu Sept 10th 2014 Michael Brodsky Jianhong Ou INSTALLATION First install R 3.1.0 Windows:
11/24/13. Science, then, and now. Computational Structural Bioinformatics. Learning curve. ECS129 Instructor: Patrice Koehl
Computational Structural Bioinformatics ECS129 Instructor: Patrice Koehl http://www.cs.ucdavis.edu/~koehl/teaching/ecs129/index.html koehl@cs.ucdavis.edu Learning curve Math / CS Biology/ Chemistry Pre-requisite
Lineage-specific expansion of the Zinc Finger Associated Domain ZAD
MBE Advance Access published June 14, 2007 Lineage-specific expansion of the Zinc Finger Associated Domain ZAD Ho-Ryun Chung* Ulrike Löhr* Herbert Jäckle* *Max-Planck-Institut für biophysikalische Chemie,
A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family
A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family Jieming Shen 1,2 and Hugh B. Nicholas, Jr. 3 1 Bioengineering and Bioinformatics Summer
Comparative Virology as Context. Loy Volkman Professor Emerita Plant & Microbial Biology University of California, Berkeley
Comparative Virology as Context Loy Volkman Professor Emerita Plant & Microbial Biology University of California, Berkeley LEFT FIELD Oxygen Accumulation and Evolutionary History of Life on Earth PHOTOSYNTHESIS
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço
Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço jcarrico@fm.ul.pt Charles Darwin (1809-1882) Charles Darwin s tree of life in Notebook B, 1837-1838 Ernst Haeckel (1934-1919)
THE domesticated silkmoth Bombyx mori (Bombycidae:
Copyright Ó 2007 by the Genetics Society of America DOI: 10.1534/genetics.107.073122 Synteny and Chromosome Evolution in the Lepidoptera: Evidence From Mapping in Heliconius melpomene Elizabeth G. Pringle,*,
Computational methods for predicting protein-protein interactions
Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational
CSE P 590 A Spring : MLE, EM
CSE P 590 A Spring 2013 4: MLE, EM 1 Outline HW#2 Discussion MLE: Maximum Likelihood Estimators EM: the Expectation Maximization Algorithm Next: Motif description & discovery 2 HW # 2 Discussion Species
mosaic: Supplementary material
mosaic: Supplementary material Stefan R. Maetschke, Karin S. Kassahn, Jasmyn A. Dunn, Siew P. Han, Eva Z. Curley, Katryn J. Stacey, Mark A. Ragan January 14, 2010 1 1 Analysis of toll-like receptors TLR1
Giri Narasimhan. CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Evaluation. Course Homepage.
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 389; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs06.html 1/12/06 CAP5510/CGS5166 1 Evaluation
Appendix 1. 2K(K +1) n " k "1. = "2ln L + 2K +
Appendix 1 Selection of model of amino acid substitution. In the SOWHL tests performed on amino acid alignments either the WAG (Whelan and Goldman 2001) or the JTT (Jones et al. 1992) replacement matrix