Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata.
|
|
- Emily Rice
- 2 years ago
- Views:
Transcription
1 Supplementary Note S2 Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Phylogenetic trees reconstructed by a variety of methods from either single-copy orthologous loci (Class 4 in Fig. 2) or double-copy loci (Class 0) consistently show C. glabrata branching off outside a clade containing S. cerevisiae and S. castellii. However, the large numbers of ancestral loci in Class 2B (relative to 2D and 2F) and in Class 3A (relative to 3B and 3C), suggest an alternative topology where S. castellii is an outgroup to C. glabrata and S. cerevisiae. The number of ancestral loci is not homogeneously distributed among Classes 2B, 2D and 2F, nor among Classes 3A, 3B and 3C (χ 2 tests; P < 0.05). In order to determine which of these topologies is correct, we searched for genomic rearrangements that could be phylogenetically informative about the relationship among S. castellii, S. cerevisiae and C. glabrata. The YGOB engine was used to search for all instances of a chromosomal inversion that is present in one track in any two post-wgd species, but absent from the same track in the third post-wgd species and absent from the pre-wgd species. The resulting list of about 200 candidate sites was examined manually. We searched specifically for chromosomal inversions, but in examining the candidate regions we also noticed some other rearrangements (interchromosomal translocations) that are phylogenetically informative. In total, five rearrangements shared by S. cerevisiae and C. glabrata to the exclusion of S. castellii were found, as described in Figures S2.1 and S2.2. No rearrangements supporting the alternative topology were identified, strongly suggesting that the novel phylogeny we propose is the correct one. In addition, for loci in Class 3 (Fig. 2 in main text) the topology of the gene tree does not depend on the species phylogeny and can be inferred directly from synteny information. We exploited this to examine the ability of various tree reconstruction methods to recover correct topologies and show that all the methods we employed tend to return a topology where C. glabrata diverges from the S. cerevisiae lineage before S. castellii, even when synteny information clearly shows an alternative topology to be correct. This suggests that a systematic bias 1 may be affecting tree reconstruction and that the trees placing C. glabrata as an outgroup to S. cerevisiae and S. castellii are unreliable. References 1. Phillips, M. J., Delsuc, F. & Penny, D. Genome-scale phylogeny and the detection of systematic biases. Mol Biol Evol 21, (2004).
2 Figure Legends Figure S2.1: Rearrangement #1: An inversion (boxed in red) is shared by Track B of S. cerevisiae and C. glabrata but not S. castellii. The gene order in S. castellii Track B is the same as in K. waltii, a representative pre-wgd species. Rearrangement #2: An interchromosomal translocation (boxed in green) is shared by Track B of S. cerevisiae and C. glabrata, while Track B of S. castellii is colinear with the ancestral gene order. Figure S2.2: The large arrows in this Figure show the route by which the current genomic organizations are inferred to have arisen. Rearrangement #3: A reciprocal translocation occurred between Track B of the region shown in (a), and Track B of the region shown in (b), in the common ancestor of S. cerevisiae and C. glabrata, after it had diverged from S. castellii. In region (a) the gene order in S. castellii is colinear with the ancestral order, represented by K. waltii. In region (b) there is a speciesspecific rearrangement in S. castellii Track B in the interval between genes 611.0d and , and there are also breaks in all three post-wgd species in Track A. However, the gene order seen in K. waltii through region (b) can be deduced to be ancestral because homologs of 611.0d and are also linked in a Z. rouxii plasmid clone (data not shown). Rearrangements #4 and #5: Two local chromosomal inversions that subsequently occurred in the green region are shown in (e). (A tandem duplication that produced the genes YOR172W and YOR162C, boxed in purple, may have been involved in these events).
3
4
5 Phylogenetic trees reconstructed from loci in Classes 3A, 3B, 3C. At loci in Class 3 we know the true topology of the gene tree, independent of the species tree, because it is shown by the high-quality synteny evidence. One of the remaining genes is a paralog of the other two, so it must be the outgroup. The only situation in which this assumption could be invalid is if one gene copy in a species over-writes the other by gene conversion, but we consider it unlikely that gene conversion could produce the systematically biased results we observe. Example: S. cerevisiae ARP9 Track A C. gla S. cas S. cer Topology 1 WGD Topology 2 A S. cerevisiae 1 S. castellii 1 C. glabrata 1 C. glabrata 2 S. castellii 2 S. cerevisiae 2 S. cerevisiae 1 S. cerevisiae and C. glabrata have retained the same copy of the ancestrally duplicated ARP9 gene. Under either species topology they have a common ancestor at A while their most recent common ancestor with the S. castellii copy is at the WGD. Therefore, irrespective of the species topology, the S. cerevisiae and C. glabrata genes should be more similar to each other than either is to the S. castellii homolog. Track B S. cer S. cas C. gla WGD A C. glabrata 1 S. castellii 1 S. castellii 2 C. glabrata 2 S. cerevisiae 2 Trees were drawn for all Class 3 loci (3A, 3B and 3C) using K. lactis as an outgroup. Phylogenetic Methods NJ Phylip 1 Parsimony Phylip 1 Quartet Puzzling Tree Puzzle 2 Maximum Likelihood Phylip 1 ML trees were drawn using JTT + G(4) + I + F References 1. Felsenstein, J PHYLIP - Phylogeny Inference Package (Version 3.2). Cladistics 5: Schmidt, H.A., K. Strimmer, M. Vingron, and A. von Haeseler (2002) TREE-PUZZLE: maximum likelihood phylogenetic analysis using quartets and parallel computing. Bioinformatics. 18:
6 For each locus we compared the topology indicated by Synteny information (i.e., the tree we know to be the true tree because reliable synteny data shows one sequence to be a paralog of the other two) to the topology obtained from the Sequence data using a variety of phylogenetic analysis methods as indicated. Numbers in cells are the number of loci showing a particular combination of Synteny and Sequence topologies. Green highlighting indicates agreement between the Synteny and Sequence trees. Phylogenetic method used to generate Sequence tree Outgroup species as indicated by Sequence tree S. castellii (Class 3A loci) Outgroup species as indicated by Synteny information S. cerevisiae (Class 3B loci) C. glabrata (Class 3C loci) Total number of Sequence trees Number of conflicts between Sequence trees and Synteny trees S. castellii NJ S. cerevisiae C. glabrata Chi-square test for non-homogeneity Total in each Class E-12 NJ + 70% Bootstrap S. castellii S. cerevisiae C. glabrata Total in each Class E-11 S. castellii Parsimony S. cerevisiae C. glabrata Total in each Class E-12 S. castellii Quartet Puzzling S. cerevisiae C. glabrata Total in each Class E-07 Maximum Likelihood S. castellii S. cerevisiae C. glabrata Total in each Class E-09 EXAMPLE: Using the Maximum Likelihood method, out of 28 loci in Class 3B (where the S. cerevisiae gene is a paralog of the S. castellii and C. glabrata genes, and so should appear as the outgroup), only 14 of the ML trees correctly recovered S. cerevisiae as the outgroup; 9 incorrectly identified C. glabrata as outgroup, and 5 incorrectly identified S. castelli as outgroup. Overall, for the ML method, 116 of the 208 gene trees were incorrect according to the synteny data, and in 70 of the 116 cases, the incorrectly proposed outgroup was C. glabrata. In the great majority of loci where a conflict is seen between the Synteny and Sequence trees, C.glabrata is the outgroup proposed by the Sequence tree, regardless of phylogenetic method used. This suggests that a systematic bias is causing C. glabratato branch too deeply in phylogenetic trees inferred from sequence data. The statistical test for non-homogeneity is a chi-square test of the hypothesis that the conflicting trees are uniformly distributed across the three types of Sequence tree.
Bioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
PGA: A Program for Genome Annotation by Comparative Analysis of. Maximum Likelihood Phylogenies of Genes and Species
PGA: A Program for Genome Annotation by Comparative Analysis of Maximum Likelihood Phylogenies of Genes and Species Paulo Bandiera-Paiva 1 and Marcelo R.S. Briones 2 1 Departmento de Informática em Saúde
Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
Comparative Genomics II
Comparative Genomics II Advances in Bioinformatics and Genomics GEN 240B Jason Stajich May 19 Comparative Genomics II Slide 1/31 Outline Introduction Gene Families Pairwise Methods Phylogenetic Methods
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis
Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
Additions, Losses, and Rearrangements on the Evolutionary Route from a Reconstructed Ancestor to the Modern Saccharomyces cerevisiae Genome
Additions, Losses, and Rearrangements on the Evolutionary Route from a Reconstructed Ancestor to the Modern Saccharomyces cerevisiae Genome Jonathan L. Gordon 1,2, Kevin P. Byrne 1, Kenneth H. Wolfe 1
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)
- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction. Lesser Tenrec (Echinops telfairi)
Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction Lesser Tenrec (Echinops telfairi) Goals: 1. Use phylogenetic experimental design theory to select optimal taxa to
Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT
Inferring phylogeny Constructing phylogenetic trees Tõnu Margus Contents What is phylogeny? How/why it is possible to infer it? Representing evolutionary relationships on trees What type questions questions
Phylogenomics: the beginning of incongruence?
Phylogenomics: the beginning of incongruence? Olivier Jeffroy, Henner Brinkmann, Frédéric Delsuc, Hervé Philippe To cite this version: Olivier Jeffroy, Henner Brinkmann, Frédéric Delsuc, Hervé Philippe.
Computational analyses of ancient polyploidy
Computational analyses of ancient polyploidy Kevin P. Byrne 1 and Guillaume Blanc 2* 1 Department of Genetics, Smurfit Institute, University of Dublin, Trinity College, Dublin 2, Ireland. 2 Laboratoire
Phylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
Consensus Methods. * You are only responsible for the first two
Consensus Trees * consensus trees reconcile clades from different trees * consensus is a conservative estimate of phylogeny that emphasizes points of agreement * philosophy: agreement among data sets is
Molecular Clocks. The Holy Grail. Rate Constancy? Protein Variability. Evidence for Rate Constancy in Hemoglobin. Given
Molecular Clocks Rose Hoberman The Holy Grail Fossil evidence is sparse and imprecise (or nonexistent) Predict divergence times by comparing molecular data Given a phylogenetic tree branch lengths (rt)
Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
Session 5: Phylogenomics
Session 5: Phylogenomics B.- Phylogeny based orthology assignment REMINDER: Gene tree reconstruction is divided in three steps: homology search, multiple sequence alignment and model selection plus tree
Reconstruction of Ancestral Genome subject to Whole Genome Duplication, Speciation, Rearrangement and Loss
Reconstruction of Ancestral Genome subject to Whole Genome Duplication, Speciation, Rearrangement and Loss Denis Bertrand, Yves Gagnon, Mathieu Blanchette 2, and Nadia El-Mabrouk DIRO, Université de Montréal,
Phylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
Quartet Inference from SNP Data Under the Coalescent Model
Bioinformatics Advance Access published August 7, 2014 Quartet Inference from SNP Data Under the Coalescent Model Julia Chifman 1 and Laura Kubatko 2,3 1 Department of Cancer Biology, Wake Forest School
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
Comparative genomics of gene families in relation with metabolic pathways for gene candidates highlighting
Comparative genomics of gene families in relation with metabolic pathways for gene candidates highlighting Delphine Larivière & David Couvin Under the supervision of Dominique This, Jean-François Dufayard
CHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
Constructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Orthology Part I: concepts and implications Toni Gabaldón Centre for Genomic Regulation (CRG), Barcelona
Orthology Part I: concepts and implications Toni Gabaldón Centre for Genomic Regulation (CRG), Barcelona (tgabaldon@crg.es) http://gabaldonlab.crg.es Homology the same organ in different animals under
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Reconstructing the history of lineages
Reconstructing the history of lineages Class outline Systematics Phylogenetic systematics Phylogenetic trees and maps Class outline Definitions Systematics Phylogenetic systematics/cladistics Systematics
Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family
Review: Gene Families Gene Families part 2 03 327/727 Lecture 8 What is a Case study: ian globin genes Gene trees and how they differ from species trees Homology, orthology, and paralogy Last tuesday 1
Evolution by duplication
6.095/6.895 - Computational Biology: Genomes, Networks, Evolution Lecture 18 Nov 10, 2005 Evolution by duplication Somewhere, something went wrong Challenges in Computational Biology 4 Genome Assembly
Cladistics and Bioinformatics Questions 2013
AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species
Introduction to characters and parsimony analysis
Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect
Genome Rearrangements In Man and Mouse. Abhinav Tiwari Department of Bioengineering
Genome Rearrangements In Man and Mouse Abhinav Tiwari Department of Bioengineering Genome Rearrangement Scrambling of the order of the genome during evolution Operations on chromosomes Reversal Translocation
Concepts and Methods in Molecular Divergence Time Estimation
Concepts and Methods in Molecular Divergence Time Estimation 26 November 2012 Prashant P. Sharma American Museum of Natural History Overview 1. Why do we date trees? 2. The molecular clock 3. Local clocks
Anatomy of a tree. clade is group of organisms with a shared ancestor. a monophyletic group shares a single common ancestor = tapirs-rhinos-horses
Anatomy of a tree outgroup: an early branching relative of the interest groups sister taxa: taxa derived from the same recent ancestor polytomy: >2 taxa emerge from a node Anatomy of a tree clade is group
Divergence Pattern of Duplicate Genes in Protein-Protein Interactions Follows the Power Law
Divergence Pattern of Duplicate Genes in Protein-Protein Interactions Follows the Power Law Ze Zhang,* Z. W. Luo,* Hirohisa Kishino,à and Mike J. Kearsey *School of Biosciences, University of Birmingham,
Chromosomal rearrangements in mammalian genomes : characterising the breakpoints. Claire Lemaitre
PhD defense Chromosomal rearrangements in mammalian genomes : characterising the breakpoints Claire Lemaitre Laboratoire de Biométrie et Biologie Évolutive Université Claude Bernard Lyon 1 6 novembre 2008
Nature Genetics: doi: /ng Supplementary Figure 1. Icm/Dot secretion system region I in 41 Legionella species.
Supplementary Figure 1 Icm/Dot secretion system region I in 41 Legionella species. Homologs of the effector-coding gene lega15 (orange) were found within Icm/Dot region I in 13 Legionella species. In four
Unsupervised Learning in Spectral Genome Analysis
Unsupervised Learning in Spectral Genome Analysis Lutz Hamel 1, Neha Nahar 1, Maria S. Poptsova 2, Olga Zhaxybayeva 3, J. Peter Gogarten 2 1 Department of Computer Sciences and Statistics, University of
Lecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS. Masatoshi Nei"
MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS Masatoshi Nei" Abstract: Phylogenetic trees: Recent advances in statistical methods for phylogenetic reconstruction and genetic diversity analysis were
A PARSIMONY APPROACH TO ANALYSIS OF HUMAN SEGMENTAL DUPLICATIONS
A PARSIMONY APPROACH TO ANALYSIS OF HUMAN SEGMENTAL DUPLICATIONS CRYSTAL L. KAHN and BENJAMIN J. RAPHAEL Box 1910, Brown University Department of Computer Science & Center for Computational Molecular Biology
Chapter 27: Evolutionary Genetics
Chapter 27: Evolutionary Genetics Student Learning Objectives Upon completion of this chapter you should be able to: 1. Understand what the term species means to biology. 2. Recognize the various patterns
Effects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
A Methodological Framework for the Reconstruction of Contiguous Regions of Ancestral Genomes and Its Application to Mammalian Genomes
A Methodological Framework for the Reconstruction of Contiguous Regions of Ancestral Genomes and Its Application to Mammalian Genomes Cedric Chauve 1, Eric Tannier 2,3,4,5 * 1 Department of Mathematics,
7. Tests for selection
Sequence analysis and genomics 7. Tests for selection Dr. Katja Nowick Group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute for Brain Research www. nowicklab.info
molecular evolution and phylogenetics
molecular evolution and phylogenetics Charlotte Darby Computational Genomics: Applied Comparative Genomics 2.13.18 https://www.thinglink.com/scene/762084640000311296 Internal node Root TIME Branch Leaves
Anatomy of a species tree
Anatomy of a species tree T 1 Size of current and ancestral Populations (N) N Confidence in branches of species tree t/2n = 1 coalescent unit T 2 Branch lengths and divergence times of species & populations
Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!
Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site: http://hydrodictyon.eeb.uconn.edu/people/plewis
Today's project. Test input data Six alignments (from six independent markers) of Curcuma species
DNA sequences II Analyses of multiple sequence data datasets, incongruence tests, gene trees vs. species tree reconstruction, networks, detection of hybrid species DNA sequences II Test of congruence of
Letter to the Editor. The Effect of Taxonomic Sampling on Accuracy of Phylogeny Estimation: Test Case of a Known Phylogeny Steven Poe 1
Letter to the Editor The Effect of Taxonomic Sampling on Accuracy of Phylogeny Estimation: Test Case of a Known Phylogeny Steven Poe 1 Department of Zoology and Texas Memorial Museum, University of Texas
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
Big Questions. Is polyploidy an evolutionary dead-end? If so, why are all plants the products of multiple polyploidization events?
Plant of the Day Cyperus esculentus - Cyperaceae Chufa (tigernut) 8,000 kg/ha, 720 kcal/sq m per month Top Crop for kcal productivity! One of the world s worst weeds Big Questions Is polyploidy an evolutionary
Incomplete Lineage Sorting: Consistent Phylogeny Estimation From Multiple Loci
University of Pennsylvania ScholarlyCommons Statistics Papers Wharton Faculty Research 1-2010 Incomplete Lineage Sorting: Consistent Phylogeny Estimation From Multiple Loci Elchanan Mossel University of
Comparative Bioinformatics Midterm II Fall 2004
Comparative Bioinformatics Midterm II Fall 2004 Objective Answer, part I: For each of the following, select the single best answer or completion of the phrase. (3 points each) 1. Deinococcus radiodurans
Assessing an Unknown Evolutionary Process: Effect of Increasing Site- Specific Knowledge Through Taxon Addition
Assessing an Unknown Evolutionary Process: Effect of Increasing Site- Specific Knowledge Through Taxon Addition David D. Pollock* and William J. Bruno* *Theoretical Biology and Biophysics, Los Alamos National
Phylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
Some of these slides have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!
Some of these slides have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site: http://hydrodictyon.eeb.uconn.edu/people/plewis
Estimating Evolutionary Trees. Phylogenetic Methods
Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent
1 Genomes with odd ploidy are generally deemed to be infertile because
BIOINFORMAIC Vol. 23 IMB/ECCB 2007, pages i433 i439 doi:10.1093/bioinformatics/btm169 Polyploids, genome halving and phylogeny David ankoff 1, *, Chunfang Zheng 2 and Qian Zhu 3 1 Department of Mathematics
Michael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D
7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
Using phylogenetics to estimate species divergence times... Basics and basic issues for Bayesian inference of divergence times (plus some digression)
Using phylogenetics to estimate species divergence times... More accurately... Basics and basic issues for Bayesian inference of divergence times (plus some digression) "A comparison of the structures
A (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
2 Genome evolution: gene fusion versus gene fission
2 Genome evolution: gene fusion versus gene fission Berend Snel, Peer Bork and Martijn A. Huynen Trends in Genetics 16 (2000) 9-11 13 Chapter 2 Introduction With the advent of complete genome sequencing,
The Phylogenetic Handbook
The Phylogenetic Handbook A Practical Approach to DNA and Protein Phylogeny Edited by Marco Salemi University of California, Irvine and Katholieke Universiteit Leuven, Belgium and Anne-Mieke Vandamme Rega
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
Letter to the Editor. Department of Biology, Arizona State University
Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona
PhyQuart-A new algorithm to avoid systematic bias & phylogenetic incongruence
PhyQuart-A new algorithm to avoid systematic bias & phylogenetic incongruence Are directed quartets the key for more reliable supertrees? Patrick Kück Department of Life Science, Vertebrates Division,
Phylogenetic inference: from sequences to trees
W ESTFÄLISCHE W ESTFÄLISCHE W ILHELMS -U NIVERSITÄT NIVERSITÄT WILHELMS-U ÜNSTER MM ÜNSTER VOLUTIONARY FUNCTIONAL UNCTIONAL GENOMICS ENOMICS EVOLUTIONARY Bioinformatics 1 Phylogenetic inference: from sequences
Phylogeny and the Tree of Life
LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 26 Phylogeny and the Tree of Life
Package WGDgc. June 3, 2014
Package WGDgc June 3, 2014 Type Package Title Whole genome duplication detection using gene counts Version 1.1 Date 2014-06-03 Author Tram Ta, Charles-Elie Rabier, Cecile Ane Maintainer Tram Ta
How should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
Descendants of Whole Genome Duplication within Gene Order Phylogeny. CHUNFANG ZHENG, QIAN ZHU, and DAVID SANKOFF ABSTRACT
JORNAL OF COMPAIONAL BIOLOGY Volume 15, Number 8, 2008 Mary Ann Liebert, Inc. Pp. 947 964 DOI: 10.1089/cmb.2008.0118 Descants of Whole Genome Duplication within Gene Order Phylogeny CHNFANG ZHENG, QIAN
Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies 1 What is phylogeny? Essay written for the course in Markov Chains 2004 Torbjörn Karfunkel Phylogeny is the evolutionary development
Comparative genomics: Overview & Tools + MUMmer algorithm
Comparative genomics: Overview & Tools + MUMmer algorithm Urmila Kulkarni-Kale Bioinformatics Centre University of Pune, Pune 411 007. urmila@bioinfo.ernet.in Genome sequence: Fact file 1995: The first
Computational approaches for functional genomics
Computational approaches for functional genomics Kalin Vetsigian October 31, 2001 The rapidly increasing number of completely sequenced genomes have stimulated the development of new methods for finding
How to detect paleoploidy?
Genome duplications (polyploidy) / ancient genome duplications (paleopolyploidy) How to detect paleoploidy? e.g. a diploid cell undergoes failed meiosis, producing diploid gametes, which selffertilize
Biology 559R: Introduction to Phylogenetic Comparative Methods Topics for this week (Jan 27 & 29):
Biology 559R: Introduction to Phylogenetic Comparative Methods Topics for this week (Jan 27 & 29): Statistical estimation of models of sequence evolution Phylogenetic inference using maximum likelihood:
Evaluating phylogenetic hypotheses
Evaluating phylogenetic hypotheses Methods for evaluating topologies Topological comparisons: e.g., parametric bootstrapping, constrained searches Methods for evaluating nodes Resampling techniques: bootstrapping,
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
Phylogenetics in the Age of Genomics: Prospects and Challenges
Phylogenetics in the Age of Genomics: Prospects and Challenges Antonis Rokas Department of Biological Sciences, Vanderbilt University http://as.vanderbilt.edu/rokaslab http://pubmed2wordle.appspot.com/
Gene-Tree Reconciliation with MUL-Trees to Resolve Polyploidy Events
Syst. Biol. 66(6):1007 1018, 2017 The Author(s) 2017. Published by Oxford University Press, on behalf of the Society of Systematic Biologists. All rights reserved. For Permissions, please email: journals.permissions@oup.com
GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.
!! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory