Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!
|
|
- Edgar Rich
- 2 years ago
- Views:
Transcription
1 Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site:
2 Genealogies within a population Present Past Biparental inheritance would make the picture messier, but the genealogy of the gene copies would still form a tree (if there is no recombination).
3 terminology: genealogical trees within population or species trees It is tempting to refer to the tips of these gene trees as alleles or haplotypes. allele an alternative form a gene. haplotype a linked set of alleles But both of these terms require a differences in sequence. The gene trees that we draw depict genealogical relationships regardless of whether or not nucleotide differences distinguish the gene copies at the tips of the tree.
4
5 2 1
6 A gene tree within a species tree Gorilla Chimp Human deep coalescence coalescence events
7 terminology: genealogical trees within population or species trees coalescence merging of the genealogy of multiple gene copies into their common ancestor. Merging only makes sense when viewed backwards in time. deep coalescence or incomplete lineage sorting refer to the failure of gene copies to coalesce within the duration of the species the lineages coalesce in an ancestral species
8 terminology: genealogical trees within population or species trees coalescence merging of the genealogy of multiple gene copies into their common ancestor. Merging only makes sense when viewed backwards in time. deep coalescence or incomplete lineage sorting refer to the failure of gene copies to coalesce within the duration of the species the lineages coalesce in an ancestral species
9 A gene family tree Opazo, Hoffmann and Storz Genomic evidence for independent origins of β-like globin genes in monotremes and therian mammals PNAS 105(5) 2008 Fig. 1. Bayesian phylogram describing relationships among the -like globin genes of vertebrates. The -globin sequences from spiny dogfish (S. acanthias)
10 Fig. 4. An evolutionary hypothesis regarding the evolution of the -globin gene family. According to this model, the -globin gene originated via duplication of an ancient -globin gene that occurred before the divergence of birds and mammals but after the amniote/amphibian split. The -globin gene has been retained in contemporary monotremes and marsupials, but it has been lost independently in birds and placental mammals. In the common ancestor of marsupials and placental mammals, a pair of - and -globin genes originated via duplication of a proto -globin gene after the therian/monotreme split. In the placental mammal lineage, subsequent duplications of the - and -globin genes gave rise to the prenatally expressed -globin and the adult-expressed -globin, respectively. In the monotreme lineage, a pair of -like globin genes ( P - and P -globin) originated via duplication of a proto -globin gene sometime before the divergence of the platypus and echidnas (the two monotreme lineages). The P -globin gene is expressed during adulthood, and, on the basis of positional homology with other -like globin genes, expression of the P -globin gene is most likely restricted to embryonic erythroid cells. Opazo, Hoffmann and Storz Genomic evidence for independent origins of β-like globin genes in monotremes and therian mammals PNAS 105(5) 2008 subclass Prototheria. We use the P superscript to acknowledge that these genes are not 1:1 orthologs of the -and -globin genes of therian mammals. castebeina), reptiles (Geochelone chilensis, G. carbonaria, and Alligator mississipiensis), birds (Cairina and Taeniopygia), and some additional mammalian taxa (SI Table 2). The -globin sequences from spiny dogfish (Squalus acanthias) and arctic skate (Amblyraja hyperborea) were used as outgroups. Our
11 terminology: trees of gene families duplication the creation of a new copy of a gene within the same genome. homologous descended from a common ancestor. paralogous homologous, but resulting from a gene duplication in the common ancestor. orthologous homologous, and resulting from a speciation event at the common ancestor.
12 Multiple contexts for tree estimation (again): The cause of Important caveats splitting Gene tree DNA replication recombination is usually ignored Species tree speciation recombination, hybridization, and Phylogeny deep coalescence cause conflict in the data we use to estimate phylogenies Gene family tree speciation or recombination (eg. domain duplication swapping) is not tree-like
13 The main subject of this course: estimating a tree from character data Tree construction: strictly algorithmic approaches - use a recipe to construct a tree optimality based approaches - choose a way to score a trees and then search for the tree that has the best score. Expressing support for aspects of the tree: bootstrapping, testing competing trees against each other, posterior probabilities (in Bayesian approaches).
14 Phylogeny with complete genome + phenome as colors: This figure: dramatically underestimates polymorphism ignore geographic aspects of speciation and character evolution
15 Extant species are just a thin slice of the phylogeny:
16 Our exemplar specimens are a subset of the current diversity:
17 The phylogenetic inference problem:
18
19
20
21 Multiple origins of the yellow state violates our assumption that the state codes in our transformation scheme represent homologous states
22
23 Character matrices: Taxa Characters Homo sapiens 0.13 A A rounded Pan paniscus 0.34 A G flat Gorilla gorilla 0.46 C G pointed Characters (aka transformation series ) are the columns. The values in the cells are character states (aka characters ).
24 Taxa Characters Homo sapiens 0.13 A A rounded Pan paniscus 0.34 A G flat Gorilla gorilla 0.46 C G pointed Character coding: Taxa Characters Homo sapiens 0 A A Pan paniscus 2 A G 1 2 0,1 Gorilla gorilla 3 C G 2 1 1,2
25 The meaning of homology (very roughly): 1. comparable (when applied to characters) 2. identical by descent (when applied to character states) Ideally, each possible character state would arise once in the entire history of life on earth.
26 Instances of the filled character state are homologous Instances of the hollow character state are homologous
27 Instances of the filled character state are homologous Instances of the hollow character state are NOT homologous
28 Instances of the filled character state are NOT homologous Instances of the hollow character state are homologous
29 Inference deriving a conclusion based solely on what one already knows 1 logical statistical 1 definition from Wikipedia, so it must be correct!
30 A B C D A D B C A C B D
31 A B C D
32 A B C D A B C D A B C D A B C D A B C D A B C D A B C D A B C D A B C D A B C D A B C D
33 A B C D A B C D A B C D A B C D A B C D A B C D A B C D A B C D A B C D A B C D A B C D
34 A B C D? A D B C? A B C D A? C B D
35 A B C D A D B C A B C D A C B D
36 Logical Inference Deductive reasoning: 1. start from premises 2. apply proper rules 3. arrive at statements that were not obviously contained in the premises. If the rules are valid (logically sound) and the premises are true, then the conclusions are guaranteed to be true.
37 Deductive reasoning All men are mortal. Socrates is a man Therefore Socrates is mortal. Can we infer phylogenies from character data using deductive reasoning?
38 Logical approach to phylogenetics Premise: The following character matrix is correctly coded (character states are homologous in the strict sense): taxon A taxon B taxon C 1 Z Y Y Is there a valid set of rules that will generate the tree as a conclusion?
39 Logical approach to phylogenetics (cont) Rule: Two taxa that share a character state must be more closely related to each other than either is to a taxon that displays a different state. Is this a valid rule?
40 Invalid rule Here is an example in which we are confident that the homology statements are correct, but our rule implies two conflicting trees: placenta vertebra Homo sapiens Z A Rana catesbiana Y A Drosophila melanogaster Y B
41 Hennigian logical analysis The German entomologist Willi Hennig (in addition to providing strong arguments for phylogenetic classifications) clarified the logic of phylogenetic inference. Hennig s correction to our rule: Two taxa that share a derived character state must be more closely related to each other than either is to a taxon that displays the primitive state.
42 Hennig s logic is valid Here we will use 0 for the primitive state, and 1 for the derived state. placenta vertebra Homo sapiens 1 1 Rana catesbiana 0 1 Drosophila melanogaster 0 0 Now the character placenta does not provide a grouping, but vertebra groups human and frog as sister taxa.
43 Hennigian terminology prefixes: apo - refers to the new or derived state plesio - refers to the primitive state syn or sym - used to indicate shared between taxa aut - used to indicate a state being unique to one taxon
44 Hennigian rules synapomorphy - shared, derived states. Used to diagnose monophyletic groups. symplesiomorphy - shared, primitive states. Diagnose icky, unwanted paraphyletic groups. autapomorphy a unique derived state. No evidence of phylogenetic relationships. constant characters columns in a matrix with no variability between taxa. No evidence of phylogenetic relationships.
45
46 Hennigian inference When we create a character matrix for Hennig s system, it is crucial that: traits assigned the same state represent homologous states (trace back to the MRCA) we correctly identify the directionality of the transformations (which state is plesiomorphic and which is apomorphic). The process of identifying the direction of change is called polarization. Polarization could be done based on developmental considerations, paleontological evidence, or biogeographic considerations, but the most common technique is outgroup polarization.
47 Character # Taxon A B C D
48 1 B B C D 10 A C 5 D A
49 Interestingly, without polarization Hennig s method can infer unrooted trees. We can get the tree topology, but be unable to tell paraphyletic from monophyletic groups. The outgroup method amounts to inferring an unrooted tree and then rooting the tree on the branch that leads to an outgroup.
50 D 5 1 B B C 10 A D A C
51 Inadequacy of logic Unfortunately, though Hennigian logic is valid we quickly find that we do not have a reliable method of generating accurate homology statements. The logic is valid, but we don t know that the premises are true. In fact, we almost always find that it is impossible for all of our premises to be true.
52 Character conflict Homo sapiens AGTTCAAGT Rana catesbiana AATTCAAGT Drosophila melanogaster AGTTCAAGC C. elegans AATTCAAGC The red character implies that either (Homo + Drosophila) is a group (if G is derived) and/or (Rana + C. elegans) is a group. The green character implies that either (Homo + Rana) is a group (if T is derived) and/or (Drosophila + C. elegans) is a group. The green and red character cannot both be correct.
53 Character # Taxon A B C D
54 C B D A
Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!
Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site: http://hydrodictyon.eeb.uconn.edu/people/plewis
Module 13: Molecular Phylogenetics
Module 13: Molecular Phylogenetics Instructors: Joe Felsenstein (University of Washington) Mark Holder (University of Kansas) Jeff Thorne (North Carolina State University) Wednesday July 18: Day I 1:30
Module 12: Molecular Phylogenetics
Module 12: Molecular Phylogenetics http://evolution.gs.washington.edu/sisg/2014/ MTH Thanks to Paul Lewis, Tracy Heath, Joe Felsenstein, Peter Beerli, Derrick Zwickl, and Joe Bielawski for slides Monday
Reconstructing the history of lineages
Reconstructing the history of lineages Class outline Systematics Phylogenetic systematics Phylogenetic trees and maps Class outline Definitions Systematics Phylogenetic systematics/cladistics Systematics
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
What is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
Introduction to Phylogenetics Workshop on Molecular Evolution 2018 Marine Biological Lab, Woods Hole, MA. USA. Mark T. Holder University of Kansas
Introduction to Phylogenetics Workshop on Molecular Evolution 2018 Marine Biological Lab, Woods Hole, MA. USA Mark T. Holder University of Kansas Outline 1. phylogenetics is crucial for comparative biology
Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
Classification, Phylogeny yand Evolutionary History
Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize
Module 13: Molecular Phylogenetics
Module 13: Molecular Phylogenetics http://evolution.gs.washington.edu/sisg/2013/ MTH Thanks to Paul Lewis, Joe Felsenstein, Peter Beerli, Derrick Zwickl, and Joe Bielawski for slides Wednesday July 17:
How should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them?
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Carolus Linneaus:Systema Naturae (1735) Swedish botanist &
Phylogenetic analysis. Characters
Typical steps: Phylogenetic analysis Selection of taxa. Selection of characters. Construction of data matrix: character coding. Estimating the best-fitting tree (model) from the data matrix: phylogenetic
UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)
- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the
1 ATGGGTCTC 2 ATGAGTCTC
We need an optimality criterion to choose a best estimate (tree) Other optimality criteria used to choose a best estimate (tree) Parsimony: begins with the assumption that the simplest hypothesis that
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Module 12: Molecular Phylogenetics
Module 12: Molecular Phylogenetics http://evolution.gs.washington.edu/sisg/2014/ MTH Thanks to Paul Lewis, Tracy Heath, Joe Felsenstein, Peter Beerli, Derrick Zwickl, and Joe Bielawski for slides Monday
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
Phylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
The Tree of Life. Phylogeny
The Tree of Life Phylogeny Phylogenetics Phylogenetic trees illustrate the evolutionary relationships among groups of organisms, or among a family of related nucleic acid or protein sequences Each branch
(Stevens 1991) 1. morphological characters should be assumed to be quantitative unless demonstrated otherwise
Bot 421/521 PHYLOGENETIC ANALYSIS I. Origins A. Hennig 1950 (German edition) Phylogenetic Systematics 1966 B. Zimmerman (Germany, 1930 s) C. Wagner (Michigan, 1920-2000) II. Characters and character states
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
Lecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family
Review: Gene Families Gene Families part 2 03 327/727 Lecture 8 What is a Case study: ian globin genes Gene trees and how they differ from species trees Homology, orthology, and paralogy Last tuesday 1
Anatomy of a tree. clade is group of organisms with a shared ancestor. a monophyletic group shares a single common ancestor = tapirs-rhinos-horses
Anatomy of a tree outgroup: an early branching relative of the interest groups sister taxa: taxa derived from the same recent ancestor polytomy: >2 taxa emerge from a node Anatomy of a tree clade is group
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
Estimating Evolutionary Trees. Phylogenetic Methods
Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent
1/27/2010. Systematics and Phylogenetics of the. An Introduction. Taxonomy and Systematics
Systematics and Phylogenetics of the Amphibia: An Introduction Taxonomy and Systematics Taxonomy, the science of describing biodiversity, mainly naming unnamed species, and arranging the diversity into
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
Classification and Phylogeny
Classification and Phylogeny The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley
Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley B.D. Mishler Feb. 14, 2018. Phylogenetic trees VI: Dating in the 21st century: clocks, & calibrations;
Lecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
Classification and Phylogeny
Classification and Phylogeny The diversity it of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
Macroevolution Part I: Phylogenies
Macroevolution Part I: Phylogenies Taxonomy Classification originated with Carolus Linnaeus in the 18 th century. Based on structural (outward and inward) similarities Hierarchal scheme, the largest most
Homework Assignment, Evolutionary Systems Biology, Spring Homework Part I: Phylogenetics:
Homework Assignment, Evolutionary Systems Biology, Spring 2009. Homework Part I: Phylogenetics: Introduction. The objective of this assignment is to understand the basics of phylogenetic relationships
Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
--Therefore, congruence among all postulated homologies provides a test of any single character in question [the central epistemological advance].
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2008 University of California, Berkeley B.D. Mishler Jan. 29, 2008. The Hennig Principle: Homology, Synapomorphy, Rooting issues The fundamental
Dr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
Algorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
C.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
Phylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
Name. Ecology & Evolutionary Biology 2245/2245W Exam 2 1 March 2014
Name 1 Ecology & Evolutionary Biology 2245/2245W Exam 2 1 March 2014 1. Use the following matrix of nucleotide sequence data and the corresponding tree to answer questions a. through h. below. (16 points)
Intraspecific gene genealogies: trees grafting into networks
Intraspecific gene genealogies: trees grafting into networks by David Posada & Keith A. Crandall Kessy Abarenkov Tartu, 2004 Article describes: Population genetics principles Intraspecific genetic variation
BIOL 428: Introduction to Systematics Midterm Exam
Midterm exam page 1 BIOL 428: Introduction to Systematics Midterm Exam Please, write your name on each page! The exam is worth 150 points. Verify that you have all 8 pages. Read the questions carefully,
How to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
Biologists have used many approaches to estimating the evolutionary history of organisms and using that history to construct classifications.
Phylogenetic Inference Biologists have used many approaches to estimating the evolutionary history of organisms and using that history to construct classifications. Willi Hennig developed d the techniques
CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny
CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny To trace phylogeny or the evolutionary history of life, biologists use evidence from paleontology, molecular data, comparative
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
Bodega Bay Workshop in Applied Phylogenetics
Bodega Bay Workshop in Applied Phylogenetics Introductory State of the Union Lecture Mark T. Holder Department of Ecology and Evolutionary Biology, University of Kansas March 8, 2014 about me I m mainly
AP Biology. Cladistics
Cladistics Kingdom Summary Review slide Review slide Classification Old 5 Kingdom system Eukaryote Monera, Protists, Plants, Fungi, Animals New 3 Domain system reflects a greater understanding of evolution
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
Lecture V Phylogeny and Systematics Dr. Kopeny
Delivered 1/30 and 2/1 Lecture V Phylogeny and Systematics Dr. Kopeny Lecture V How to Determine Evolutionary Relationships: Concepts in Phylogeny and Systematics Textbook Reading: pp 425-433, 435-437
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence
molecular evolution and phylogenetics
molecular evolution and phylogenetics Charlotte Darby Computational Genomics: Applied Comparative Genomics 2.13.18 https://www.thinglink.com/scene/762084640000311296 Internal node Root TIME Branch Leaves
CHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
I. Short Answer Questions DO ALL QUESTIONS
EVOLUTION 313 FINAL EXAM Part 1 Saturday, 7 May 2005 page 1 I. Short Answer Questions DO ALL QUESTIONS SAQ #1. Please state and BRIEFLY explain the major objectives of this course in evolution. Recall
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2012 University of California, Berkeley
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2012 University of California, Berkeley B.D. Mishler April 12, 2012. Phylogenetic trees IX: Below the "species level;" phylogeography; dealing
Using phylogenetics to estimate species divergence times... Basics and basic issues for Bayesian inference of divergence times (plus some digression)
Using phylogenetics to estimate species divergence times... More accurately... Basics and basic issues for Bayesian inference of divergence times (plus some digression) "A comparison of the structures
Anatomy of a species tree
Anatomy of a species tree T 1 Size of current and ancestral Populations (N) N Confidence in branches of species tree t/2n = 1 coalescent unit T 2 Branch lengths and divergence times of species & populations
Biology 211 (2) Week 1 KEY!
Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of
Patterns of Evolution
Patterns of Evolution A tree that represents an estimate (hypothesis) of evolutionary relatedness is a phylogeny Classifications can be based on groupings within a phylogeny Groupings can be categorized
Classifications can be based on groupings g within a phylogeny
Patterns of Evolution A tree that represents an estimate (hypothesis) of evolutionary relatedness is a phylogeny Classifications can be based on groupings g within a phylogeny y Groupings can be categorized
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2011 University of California, Berkeley
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2011 University of California, Berkeley B.D. Mishler March 31, 2011. Reticulation,"Phylogeography," and Population Biology:
Introduction to characters and parsimony analysis
Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
X X (2) X Pr(X = x θ) (3)
Notes for 848 lecture 6: A ML basis for compatibility and parsimony Notation θ Θ (1) Θ is the space of all possible trees (and model parameters) θ is a point in the parameter space = a particular tree
A Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
PHYLOGENY & THE TREE OF LIFE
PHYLOGENY & THE TREE OF LIFE PREFACE In this powerpoint we learn how biologists distinguish and categorize the millions of species on earth. Early we looked at the process of evolution here we look at
Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
Phylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
Chapter 16: Reconstructing and Using Phylogenies
Chapter Review 1. Use the phylogenetic tree shown at the right to complete the following. a. Explain how many clades are indicated: Three: (1) chimpanzee/human, (2) chimpanzee/ human/gorilla, and (3)chimpanzee/human/
Systematics Lecture 3 Characters: Homology, Morphology
Systematics Lecture 3 Characters: Homology, Morphology I. Introduction Nearly all methods of phylogenetic analysis rely on characters as the source of data. A. Character variation is coded into a character-by-taxon
Taming the Beast Workshop
Workshop and Chi Zhang June 28, 2016 1 / 19 Species tree Species tree the phylogeny representing the relationships among a group of species Figure adapted from [Rogers and Gibbs, 2014] Gene tree the phylogeny
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
Unit 9: Evolution Guided Reading Questions (80 pts total)
Name: AP Biology Biology, Campbell and Reece, 7th Edition Adapted from chapter reading guides originally created by Lynn Miriello Unit 9: Evolution Guided Reading Questions (80 pts total) Chapter 22 Descent
Chapter 26: Phylogeny and the Tree of Life
Chapter 26: Phylogeny and the Tree of Life 1. Key Concepts Pertaining to Phylogeny 2. Determining Phylogenies 3. Evolutionary History Revealed in Genomes 1. Key Concepts Pertaining to Phylogeny PHYLOGENY
METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Molecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
ELE4120 Bioinformatics Tutorial 8
ELE4120 ioinformatics Tutorial 8 ontent lassifying Organisms Systematics and Speciation Taxonomy and phylogenetics Phenetics versus cladistics Phylogenetic trees iological classification Goal: To develop
Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata.
Supplementary Note S2 Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Phylogenetic trees reconstructed by a variety of methods from either single-copy orthologous loci (Class
Concepts and Methods in Molecular Divergence Time Estimation
Concepts and Methods in Molecular Divergence Time Estimation 26 November 2012 Prashant P. Sharma American Museum of Natural History Overview 1. Why do we date trees? 2. The molecular clock 3. Local clocks
ESS 345 Ichthyology. Systematic Ichthyology Part II Not in Book
ESS 345 Ichthyology Systematic Ichthyology Part II Not in Book Thought for today: Now, here, you see, it takes all the running you can do, to keep in the same place. If you want to get somewhere else,
Integrating Fossils into Phylogenies. Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.
IB 200B Principals of Phylogenetic Systematics Spring 2011 Integrating Fossils into Phylogenies Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.
Consensus Methods. * You are only responsible for the first two
Consensus Trees * consensus trees reconcile clades from different trees * consensus is a conservative estimate of phylogeny that emphasizes points of agreement * philosophy: agreement among data sets is
Surprise! A New Hominin Fossil Changes Almost Nothing!
Surprise! A New Hominin Fossil Changes Almost Nothing! Author: Andrew J Petto Table 1: Brief Comparison of Australopithecus with early Homo fossils Species Apes (outgroup) Thanks to Louise S Mead for comments
Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab
Date: Agenda Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Ask questions based on 5.1 and 5.2 Quiz on 5.1 and 5.2 How
Chapter 10. Classification and Phylogeny of Animals. Order in Diversity. Hierarchy of taxa. Table Linnaeus introduced binomial nomenclature
Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. Chapter 10 Classification and Phylogeny of Animals Order in Diversity History Systematic zoologists have three
Phylogeny is the evolutionary history of a group of organisms. Based on the idea that organisms are related by evolution
Bio 1M: Phylogeny and the history of life 1 Phylogeny S25.1; Bioskill 11 (2ndEd S27.1; Bioskills 3) Bioskills are in the back of your book Phylogeny is the evolutionary history of a group of organisms
Thanks to Paul Lewis and Joe Felsenstein for the use of slides
Thanks to Paul Lewis and Joe Felsenstein for the use of slides Review Hennigian logic reconstructs the tree if we know polarity of characters and there is no homoplasy UPGMA infers a tree from a distance
Evolution Problem Drill 10: Human Evolution
Evolution Problem Drill 10: Human Evolution Question No. 1 of 10 Question 1. Which of the following statements is true regarding the human phylogenetic relationship with the African great apes? Question
Some of these slides have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!
Some of these slides have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site: http://hydrodictyon.eeb.uconn.edu/people/plewis
Phylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
Fig. 26.7a. Biodiversity. 1. Course Outline Outcomes Instructors Text Grading. 2. Course Syllabus. Fig. 26.7b Table
Fig. 26.7a Biodiversity 1. Course Outline Outcomes Instructors Text Grading 2. Course Syllabus Fig. 26.7b Table 26.2-1 1 Table 26.2-2 Outline: Systematics and the Phylogenetic Revolution I. Naming and
Organizing Life s Diversity
17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny
Bio94 Discussion Activity week 3: Chapter 27 Phylogenies and the History of Life
Bio94 Discussion Activity week 3: Chapter 27 Phylogenies and the History of Life 1. Constructing a phylogenetic tree using a cladistic approach Construct a phylogenetic tree using the following table: