Phylogenetics - IB 200B 15 Feb Morphometrics

Size: px
Start display at page:

Download "Phylogenetics - IB 200B 15 Feb Morphometrics"

Transcription

1 Morphometrics Morphometrics is the branch of mathematics studying the metrical and statistical properties of shapes and shape changes of geometric objects like molecules, fossils, brains, bird wings, ancient handcraft, modern cars, etc. On Growth and Form Sir D'Arcy W. Thompson, The mathematization of natural history. Thompson comes out punching with an array of arguments and stresses the importance of understanding the natural world quantitatively, but is limited philosophically to descriptive and classificatory methods (although embryology had already embarked on experimental manipulation). Bivariant data plots (X,Y) -- Correlations between morphological characters. Data exploration -- should I plot everything? Two morphological values can be combined into a single variable or ratio, Ratios are excellent for removing size, weight, etc. from a term, but what happens to the variance? Is it still normally distributed in the new term?

2 Multivariant Morphometrics Multivariant Methods Principal component analysis (PCA) has been a commonly used mathematical procedure that transforms a number of (possibly) correlated variables into a (smaller) number of uncorrelated variables called principal components. The first principal component accounts for as much of the variability in the data as possible (typically size), and each succeeding component accounts for as much of the remaining variability as possible.

3 Phylogenetics - IB 200B 15 Feb 2011 Principal component analysis is performed on covariance (scaled sums of squares and cross products), or, correlation (sums of squares and cross products from standardized data) matrices. A correlation matrix is used when the variances of individual variates substantially differ or the units of measurement of the individual variates differ. Trus

4 Truss techniques Uses distances between landmarks to form a truss that represents the configuration of the organism. Homologous landmarks characters are determined and distances between these landmarks measured. The truss measurements can be treated as Cartesian coordinates and can be averaged and standardized and analyzed using principal Procrustes analysis -- The shape of an object can be described by the coordinates of a set of well defined points or landmarks. Coordinate data from similar points across a group of individuals can be used to compare and contrast their shapes provided they have been superimposed (i.e., translated, rotated and scaled) in a common coordinate system In this coordinate system differences in the relative positions of the corresponding points on different configurations are directly reflected by the differences In their coordinates. Point selection.

5 Figure 3. Full Procrustes fit of the bivalve mollusk Mercenaria campechiensis. Data are 13 landmarks for 52 shells (Bush, A. 1999, unpub. M.S thesis, Geological Sciences, VT) Geometric Morphometrics: Geometric morphometrics is a collection of approaches for the multivariate statistical analysis of Cartesian coordinate data, usually (but not always) limited to landmark point locations. The "geometry" referred to by the word "geometric" is the geometry of Kendall's shape space: the estimation of mean shapes and the description of sample variation of shape using the geometry of Procrustes distance. The multivariate part of geometric morphometrics is usually carried out in a linear tangent space to the non- Euclidean shape space. More generally, it is the class of morphometric methods that preserve complete information about the relative spatial arrangements of the data throughout an analysis. As such, these methods allow for the visualization of group and individual differences, sample variation, and other results in the space of the original specimens. (Slice et al. AND

6 Patellogastropoda Sorbeoconcha A B A-D A-D Q 2Q 3Q 1 4q 1Q 2Q 3Q 4q Original Original C D A-D 1Q 2Q Dummy 3Q 4q 1 A-D 1Q 2Q Dummy 4q 3Q 1 cell number E F Original Dummy

7 Scaphopoda Patellogastropoda Vetigastropoda Neritopsina Sorbeoconcha Architaenoglossa Valvatoidea Opisthobranchia Pulmonata A Opist Sorb C Veti Arch Val 0.04 Veti Pul Val Scaph Nerit Pat Pat HTU2 Nerit HTU3 Pul HTU6-7 HTU4-5 Opist Sorb B Opist Sorb Arch Pul Nerit Val PCA 1 Arch Scaph Veti Pat Poly D Scaph HTU Veti Pat Arch Val HTU2 HTU3 Pul HTU6-7 HTU4-5 Opist Nerit Sorb Scaph HTU PCA 1

8 Aligned landmark data - In late 2010 Catalano et al. proposed a new method for the use of landmark data in phylogenetics. Their method uses Farris optimization to estimate ancestral values that minimize the distance between ancestor descendant morphologies through the tree. They contend that existing superimposition methods of to align landmarks (finding the best fit to the data through rotation, translation and size) are satisfactory for comparing shape in pairwise comparisons, but insufficient for evaluating shape changes along a phylogeny because shape change is determined from the changes in the relative position of each individual landmark. The method they propose explicitly evaluates change between observed taxa and hypothetical ancestors and is parsimony based. The choice of alignment algorithms is important and one that minimizes the sum of the linear distances is preferred. The final section of the paper provides a good overview of the supposed incompatibility between morphometrics and cladistics, which the authors argue is not the case. Figg.1.Comparisonbetween(a)Farrisoptimizationand(b)3D landmarkoptimization.infarrisoptimization,thesumofthe numericaldifferencesbetweenstatesisminimized.inlandmark optimization,thedistancesbetweenlandmarkpositionsareminimized.

9 Fig.4.Ahypotheticalexampleshowingancestrallandmarkpositionscalculatedwith spatialoptimization,showingthedifferencebetweenalignmentsproducedwith(a) resistantfittheta rhoanalysisor(b)generalizedleast squaresprocrustesalignment.the changesin(b)occurattheexpectednode,butarespreadoverallthelandmarksinstead ofonlythelandmarksrepresentingthethumb. Fig.5.ThesamealignmentasFig. 4a,butwithancestrallandmark positionscalculatedusingleastsquares parsimony insteadof spatialoptimization.thechanges arespreadoveralltreenodes.

Phylogenetics - IB 200A Morphometrics

Phylogenetics - IB 200A Morphometrics Phylogenetics - IB 200A 2012 Morphometrics Morphometrics is the branch of mathematics studying the metrical and statistical properties of shapes and shape changes of geometric objects like molecules, fossils,

More information

Phylogenetics - IB 200B 8 Feb Heterochrony & Phylogenetics

Phylogenetics - IB 200B 8 Feb Heterochrony & Phylogenetics Heterochrony & Phylogenetics All members of a monophyletic taxon share a common ancestor whose developmental pathway was modified to produce descendant morphologies. Haeckel, E. 1899 - originally a physician

More information

Phylogenetics - IB 200B 17 Feb Heterochrony & Phylogenetics

Phylogenetics - IB 200B 17 Feb Heterochrony & Phylogenetics Heterochrony & Phylogenetics All members of a monophyletic taxon share a common ancestor whose developmental pathway was modified to produce descendant morphologies. Haeckel, E. 1899 - originally a physician

More information

Introduction to characters and parsimony analysis

Introduction to characters and parsimony analysis Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect

More information

Chapter 26 Phylogeny and the Tree of Life

Chapter 26 Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin

More information

Chapter 19: Taxonomy, Systematics, and Phylogeny

Chapter 19: Taxonomy, Systematics, and Phylogeny Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand

More information

Integrating Fossils into Phylogenies. Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.

Integrating Fossils into Phylogenies. Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained. IB 200B Principals of Phylogenetic Systematics Spring 2011 Integrating Fossils into Phylogenies Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.

More information

Chapter 19 Organizing Information About Species: Taxonomy and Cladistics

Chapter 19 Organizing Information About Species: Taxonomy and Cladistics Chapter 19 Organizing Information About Species: Taxonomy and Cladistics An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics

More information

Phenotypic Evolution. and phylogenetic comparative methods. G562 Geometric Morphometrics. Department of Geological Sciences Indiana University

Phenotypic Evolution. and phylogenetic comparative methods. G562 Geometric Morphometrics. Department of Geological Sciences Indiana University Phenotypic Evolution and phylogenetic comparative methods Phenotypic Evolution Change in the mean phenotype from generation to generation... Evolution = Mean(genetic variation * selection) + Mean(genetic

More information

2 Dean C. Adams and Gavin J. P. Naylor the best three-dimensional ordination of the structure space is found through an eigen-decomposition (correspon

2 Dean C. Adams and Gavin J. P. Naylor the best three-dimensional ordination of the structure space is found through an eigen-decomposition (correspon A Comparison of Methods for Assessing the Structural Similarity of Proteins Dean C. Adams and Gavin J. P. Naylor? Dept. Zoology and Genetics, Iowa State University, Ames, IA 50011, U.S.A. 1 Introduction

More information

8/23/2014. Phylogeny and the Tree of Life

8/23/2014. Phylogeny and the Tree of Life Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major

More information

Quantitative evolution of morphology

Quantitative evolution of morphology Quantitative evolution of morphology Properties of Brownian motion evolution of a single quantitative trait Most likely outcome = starting value Variance of the outcomes = number of step * (rate parameter)

More information

The Life System and Environmental & Evolutionary Biology II

The Life System and Environmental & Evolutionary Biology II The Life System and Environmental & Evolutionary Biology II EESC V2300y / ENVB W2002y Laboratory 1 (01/28/03) Systematics and Taxonomy 1 SYNOPSIS In this lab we will give an overview of the methodology

More information

Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz

Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels

More information

GEOMETRIC MORPHOMETRICS. Adrian Castellanos, Michelle Chrpa, & Pedro Afonso Leite

GEOMETRIC MORPHOMETRICS. Adrian Castellanos, Michelle Chrpa, & Pedro Afonso Leite GEOMETRIC MORPHOMETRICS Adrian Castellanos, Michelle Chrpa, & Pedro Afonso Leite WHAT IS MORPHOMETRICS? Quantitative analysis of form, a concept that encompasses size and shape. Analyses performed on live

More information

Multiple lines of evidence support the theory of evolution.

Multiple lines of evidence support the theory of evolution. Section 2: Multiple lines of evidence support the theory of evolution. K What I Know W What I Want to Find Out L What I Learned Essential Questions How do fossils provide evidence of evolution? How does

More information

AP Biology. Cladistics

AP Biology. Cladistics Cladistics Kingdom Summary Review slide Review slide Classification Old 5 Kingdom system Eukaryote Monera, Protists, Plants, Fungi, Animals New 3 Domain system reflects a greater understanding of evolution

More information

The practice of naming and classifying organisms is called taxonomy.

The practice of naming and classifying organisms is called taxonomy. Chapter 18 Key Idea: Biologists use taxonomic systems to organize their knowledge of organisms. These systems attempt to provide consistent ways to name and categorize organisms. The practice of naming

More information

Historical Biogeography. Historical Biogeography. Systematics

Historical Biogeography. Historical Biogeography. Systematics Historical Biogeography I. Definitions II. Fossils: problems with fossil record why fossils are important III. Phylogeny IV. Phenetics VI. Phylogenetic Classification Disjunctions debunked: Examples VII.

More information

Classification and Phylogeny

Classification and Phylogeny Classification and Phylogeny The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme

More information

Processing Activities

Processing Activities Processing Activities Which animals would your group together based on their similarities? horse, rabbit, zebra, squirrel, donkey, deer, chipmunk, and mouse. Describe below how you would group them. 1

More information

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species

More information

Lecture 11 Friday, October 21, 2011

Lecture 11 Friday, October 21, 2011 Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system

More information

Phylogenetic methods in molecular systematics

Phylogenetic methods in molecular systematics Phylogenetic methods in molecular systematics Niklas Wahlberg Stockholm University Acknowledgement Many of the slides in this lecture series modified from slides by others www.dbbm.fiocruz.br/james/lectures.html

More information

How should we organize the diversity of animal life?

How should we organize the diversity of animal life? How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)

More information

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the

More information

Classification and Phylogeny

Classification and Phylogeny Classification and Phylogeny The diversity it of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme

More information

PHYLOGENY & THE TREE OF LIFE

PHYLOGENY & THE TREE OF LIFE PHYLOGENY & THE TREE OF LIFE PREFACE In this powerpoint we learn how biologists distinguish and categorize the millions of species on earth. Early we looked at the process of evolution here we look at

More information

Geometric morphometrics: Ten years of progress following the revolution

Geometric morphometrics: Ten years of progress following the revolution Italian Journal of Zoology ISSN: 1125-0003 (Print) 1748-5851 (Online) Journal homepage: https://www.tandfonline.com/loi/tizo20 Geometric morphometrics: Ten years of progress following the revolution Dean

More information

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS. !! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory

More information

Introduction to Biosystematics - Zool 575

Introduction to Biosystematics - Zool 575 Introduction to Biosystematics Lecture 10 - Introduction to Phylogenetics 1. Pre Lamarck, Pre Darwin Classification without phylogeny 2. Lamarck & Darwin to Hennig (et al.) Classification with phylogeny

More information

Systematics - Bio 615

Systematics - Bio 615 Bayesian Phylogenetic Inference 1. Introduction, history 2. Advantages over ML 3. Bayes Rule 4. The Priors 5. Marginal vs Joint estimation 6. MCMC Derek S. Sikes University of Alaska 7. Posteriors vs Bootstrap

More information

Statistical nonmolecular phylogenetics: can molecular phylogenies illuminate morphological evolution?

Statistical nonmolecular phylogenetics: can molecular phylogenies illuminate morphological evolution? Statistical nonmolecular phylogenetics: can molecular phylogenies illuminate morphological evolution? 30 July 2011. Joe Felsenstein Workshop on Molecular Evolution, MBL, Woods Hole Statistical nonmolecular

More information

Outline. Classification of Living Things

Outline. Classification of Living Things Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics

More information

Thursday, January 14. Teaching Point: SWBAT. assess their knowledge to prepare for the Evolution Summative Assessment. (TOMORROW) Agenda:

Thursday, January 14. Teaching Point: SWBAT. assess their knowledge to prepare for the Evolution Summative Assessment. (TOMORROW) Agenda: Thursday, January 14 Teaching Point: SWBAT. assess their knowledge to prepare for the Evolution Summative Assessment. (TOMORROW) Agenda: 1. Show Hinsz your completed Review WS 2. Discuss answers to Review

More information

Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them?

Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Carolus Linneaus:Systema Naturae (1735) Swedish botanist &

More information

SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology

SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of

More information

Macroevolution Part I: Phylogenies

Macroevolution Part I: Phylogenies Macroevolution Part I: Phylogenies Taxonomy Classification originated with Carolus Linnaeus in the 18 th century. Based on structural (outward and inward) similarities Hierarchal scheme, the largest most

More information

DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi

DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :

More information

Reconstructing the history of lineages

Reconstructing the history of lineages Reconstructing the history of lineages Class outline Systematics Phylogenetic systematics Phylogenetic trees and maps Class outline Definitions Systematics Phylogenetic systematics/cladistics Systematics

More information

Phylogeny, trees and morphospace

Phylogeny, trees and morphospace G562 Geometric Morphometrics Phylogeny, trees and morphospace Hierarchical patterns in morphometric data WALLABY HUMAN Node 0 LEOPARD Node 1 Node 3 FOSSA Node 2 DOG Node 4 OTTER 0 20 40 60 80 Cottonwood

More information

Statistical Analysis. G562 Geometric Morphometrics PC 2 PC 2 PC 3 PC 2 PC 1. Department of Geological Sciences Indiana University

Statistical Analysis. G562 Geometric Morphometrics PC 2 PC 2 PC 3 PC 2 PC 1. Department of Geological Sciences Indiana University PC 2 PC 2 G562 Geometric Morphometrics Statistical Analysis PC 2 PC 1 PC 3 Basic components of GMM Procrustes Whenever shapes are analyzed together, they must be superimposed together This aligns shapes

More information

Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26

Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26 Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,

More information

Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab

Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Date: Agenda Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Ask questions based on 5.1 and 5.2 Quiz on 5.1 and 5.2 How

More information

Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny

More information

Ch. 15 Evolution. p

Ch. 15 Evolution. p Ch. 15 Evolution p. 418-441 15.1 Darwin s Theory of Natural Selection p. 418 422 Essential Question Main Idea! Charles Darwin developed a theory of evolution based on natural selection. What was the primary

More information

Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley

Integrative Biology 200 PRINCIPLES OF PHYLOGENETICS Spring 2018 University of California, Berkeley Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley B.D. Mishler Feb. 14, 2018. Phylogenetic trees VI: Dating in the 21st century: clocks, & calibrations;

More information

Patterns of Evolution

Patterns of Evolution Patterns of Evolution A tree that represents an estimate (hypothesis) of evolutionary relatedness is a phylogeny Classifications can be based on groupings within a phylogeny Groupings can be categorized

More information

Evolutionary Tree Analysis. Overview

Evolutionary Tree Analysis. Overview CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

Lecture 6 Phylogenetic Inference

Lecture 6 Phylogenetic Inference Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,

More information

PHYLOGENY WHAT IS EVOLUTION? 1/22/2018. Change must occur in a population via allele

PHYLOGENY WHAT IS EVOLUTION? 1/22/2018. Change must occur in a population via allele PHYLOGENY EXERCISE 1 AND 2 WHAT IS EVOLUTION? The theory that all living organisms on earth are related and have a common ancestor. These organism have changed over time and are continuing to change. Changes

More information

STATISTICAL SHAPE MODELS (SSM)

STATISTICAL SHAPE MODELS (SSM) STATISTICAL SHAPE MODELS (SSM) Medical Image Analysis Serena Bonaretti serena.bonaretti@istb.unibe.ch ISTB - Institute for Surgical Technology and Biomechanics University of Bern Overview > Introduction

More information

Classifications can be based on groupings g within a phylogeny

Classifications can be based on groupings g within a phylogeny Patterns of Evolution A tree that represents an estimate (hypothesis) of evolutionary relatedness is a phylogeny Classifications can be based on groupings g within a phylogeny y Groupings can be categorized

More information

Bio94 Discussion Activity week 3: Chapter 27 Phylogenies and the History of Life

Bio94 Discussion Activity week 3: Chapter 27 Phylogenies and the History of Life Bio94 Discussion Activity week 3: Chapter 27 Phylogenies and the History of Life 1. Constructing a phylogenetic tree using a cladistic approach Construct a phylogenetic tree using the following table:

More information

Evolution of Body Size in Bears. How to Build and Use a Phylogeny

Evolution of Body Size in Bears. How to Build and Use a Phylogeny Evolution of Body Size in Bears How to Build and Use a Phylogeny Lesson II Using a Phylogeny Objectives for Lesson II: 1. Overview of concepts 1. Simple ancestral state reconstruction on the bear phylogeny

More information

Welcome to Evolution 101 Reading Guide

Welcome to Evolution 101 Reading Guide Name: Welcome to Evolution 101 Reading Guide http://evolution.berkeley.edu/evolibrary/article/evo_01 Read the information on the website. Click on the next arrow at the bottom of each page to move to the

More information

FACTOR ANALYSIS AND MULTIDIMENSIONAL SCALING

FACTOR ANALYSIS AND MULTIDIMENSIONAL SCALING FACTOR ANALYSIS AND MULTIDIMENSIONAL SCALING Vishwanath Mantha Department for Electrical and Computer Engineering Mississippi State University, Mississippi State, MS 39762 mantha@isip.msstate.edu ABSTRACT

More information

Organizing Life s Diversity

Organizing Life s Diversity 17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny

More information

CLASSIFICATION OF LIVING THINGS. Chapter 18

CLASSIFICATION OF LIVING THINGS. Chapter 18 CLASSIFICATION OF LIVING THINGS Chapter 18 How many species are there? About 1.8 million species have been given scientific names Nearly 2/3 of which are insects 99% of all known animal species are smaller

More information

Biodiversity. The Road to the Six Kingdoms of Life

Biodiversity. The Road to the Six Kingdoms of Life Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant

More information

Page 1. Evolutionary Trees. Why build evolutionary tree? Outline

Page 1. Evolutionary Trees. Why build evolutionary tree? Outline Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny

More information

Classification, Phylogeny yand Evolutionary History

Classification, Phylogeny yand Evolutionary History Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize

More information

Chapter 26 Phylogeny and the Tree of Life

Chapter 26 Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

3 Hours 18 / 06 / 2012 EXAMS OFFICE USE ONLY University of the Witwatersrand, Johannesburg Course or topic No(s) ANAT 4000

3 Hours 18 / 06 / 2012 EXAMS OFFICE USE ONLY University of the Witwatersrand, Johannesburg Course or topic No(s) ANAT 4000 3 Hours 18 / 06 / 2012 EXAMS OFFICE USE ONLY University of the Witwatersrand, Johannesburg Course or topic No(s) ANAT 4000 Course or topic name(s) Paper Number & title HUMAN BIOLOGY HONOURS: PAPER 1 Examination

More information

How Biological Diversity Evolves

How Biological Diversity Evolves CHAPTER 14 How Biological Diversity Evolves PowerPoint Lectures for Essential Biology, Third Edition Neil Campbell, Jane Reece, and Eric Simon Essential Biology with Physiology, Second Edition Neil Campbell,

More information

Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food.

Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food. Prokaryotic Cell Eukaryotic Cell Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food. Heterotrophs must get energy by eating autotrophs or other heterotrophs.

More information

16.4 Evidence of Evolution

16.4 Evidence of Evolution 16.4 Evidence of Evolution Lesson Objectives Explain how geologic distribution of species relates to their evolutionary history. Explain how fossils and the fossil record document the descent of modern

More information

"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200 Spring 2018 University of California, Berkeley

PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION Integrative Biology 200 Spring 2018 University of California, Berkeley "PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200 Spring 2018 University of California, Berkeley D.D. Ackerly Feb. 26, 2018 Maximum Likelihood Principles, and Applications to

More information

Workshop: Biosystematics

Workshop: Biosystematics Workshop: Biosystematics by Julian Lee (revised by D. Krempels) Biosystematics (sometimes called simply "systematics") is that biological sub-discipline that is concerned with the theory and practice of

More information

CHAPTERS 24-25: Evidence for Evolution and Phylogeny

CHAPTERS 24-25: Evidence for Evolution and Phylogeny CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology

More information

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.

More information

G562 Geometric Morphometrics. Statistical Tests. Department of Geological Sciences Indiana University. (c) 2012, P. David Polly

G562 Geometric Morphometrics. Statistical Tests. Department of Geological Sciences Indiana University. (c) 2012, P. David Polly Statistical Tests Basic components of GMM Procrustes This aligns shapes and minimizes differences between them to ensure that only real shape differences are measured. PCA (primary use) This creates a

More information

Biologists have used many approaches to estimating the evolutionary history of organisms and using that history to construct classifications.

Biologists have used many approaches to estimating the evolutionary history of organisms and using that history to construct classifications. Phylogenetic Inference Biologists have used many approaches to estimating the evolutionary history of organisms and using that history to construct classifications. Willi Hennig developed d the techniques

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

How to read and make phylogenetic trees Zuzana Starostová

How to read and make phylogenetic trees Zuzana Starostová How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation

More information

FOSSILS. Evidence of change over time

FOSSILS. Evidence of change over time FOSSILS Evidence of change over time Fossils What is a fossil? Preserved remains or evidence of an ancient organism. What do fossils tell us? Fossils tell us what an organism was like (structure) and what

More information

C.DARWIN ( )

C.DARWIN ( ) C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships

More information

Hominid Evolution What derived characteristics differentiate members of the Family Hominidae and how are they related?

Hominid Evolution What derived characteristics differentiate members of the Family Hominidae and how are they related? Hominid Evolution What derived characteristics differentiate members of the Family Hominidae and how are they related? Introduction. The central idea of biological evolution is that all life on Earth shares

More information

Laboratory. Phylogenetics

Laboratory. Phylogenetics Laboratory 11 Phylogenetics Biology 171L SP18 Lab 11: Phylogenetics Student Learning Outcomes 1. Discover Darwin s contribution to biology. 2. Understand the importance of evolution in the study of biology.

More information

Chapters 25 and 26. Searching for Homology. Phylogeny

Chapters 25 and 26. Searching for Homology. Phylogeny Chapters 25 and 26 The Origin of Life as we know it. Phylogeny traces evolutionary history of taxa Systematics- analyzes relationships (modern and past) of organisms Figure 25.1 A gallery of fossils The

More information

Lecture V Phylogeny and Systematics Dr. Kopeny

Lecture V Phylogeny and Systematics Dr. Kopeny Delivered 1/30 and 2/1 Lecture V Phylogeny and Systematics Dr. Kopeny Lecture V How to Determine Evolutionary Relationships: Concepts in Phylogeny and Systematics Textbook Reading: pp 425-433, 435-437

More information

A Phylogenetic Network Construction due to Constrained Recombination

A Phylogenetic Network Construction due to Constrained Recombination A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer

More information

A (short) introduction to phylogenetics

A (short) introduction to phylogenetics A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field

More information

(Stevens 1991) 1. morphological characters should be assumed to be quantitative unless demonstrated otherwise

(Stevens 1991) 1. morphological characters should be assumed to be quantitative unless demonstrated otherwise Bot 421/521 PHYLOGENETIC ANALYSIS I. Origins A. Hennig 1950 (German edition) Phylogenetic Systematics 1966 B. Zimmerman (Germany, 1930 s) C. Wagner (Michigan, 1920-2000) II. Characters and character states

More information

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic

More information

ESS 345 Ichthyology. Systematic Ichthyology Part II Not in Book

ESS 345 Ichthyology. Systematic Ichthyology Part II Not in Book ESS 345 Ichthyology Systematic Ichthyology Part II Not in Book Thought for today: Now, here, you see, it takes all the running you can do, to keep in the same place. If you want to get somewhere else,

More information

How can molecular phylogenies illuminate morphological evolution?

How can molecular phylogenies illuminate morphological evolution? How can molecular phylogenies illuminate morphological evolution? 27 October 2016. Joe Felsenstein UNAM How can molecular phylogenies illuminate morphological evolution? p.1/81 Where this lecture fits

More information

Chapter 16: Evolutionary Theory

Chapter 16: Evolutionary Theory Chapter 16: Evolutionary Theory Section 1: Developing a Theory Evolution: Artificial Selection: Evolution: I. A Theory to Explain Change Over Time B. Charles Darwin C. Theory: D. Modern evolutionary theory

More information

Glossary. Glossary 4/6/ : 31 page 409

Glossary. Glossary 4/6/ : 31 page 409 Glossary 4/6/2004 17: 31 page 409 Glossary Affine transformation (Also called uniform ). Transformation (or mapping) that leaves parallel lines parallel. The possible affine transformations include those

More information

DIMENSION REDUCTION AND CLUSTER ANALYSIS

DIMENSION REDUCTION AND CLUSTER ANALYSIS DIMENSION REDUCTION AND CLUSTER ANALYSIS EECS 833, 6 March 2006 Geoff Bohling Assistant Scientist Kansas Geological Survey geoff@kgs.ku.edu 864-2093 Overheads and resources available at http://people.ku.edu/~gbohling/eecs833

More information

Since Darwin s work, every scientific test has supported Darwin s basic ideas about evolution

Since Darwin s work, every scientific test has supported Darwin s basic ideas about evolution Guided Reading Answers Since Darwin s work, every scientific test has supported Darwin s basic ideas about evolution Biogeography Biogeography is the study of where organisms live now, and where they and

More information

Focus was on solving matrix inversion problems Now we look at other properties of matrices Useful when A represents a transformations.

Focus was on solving matrix inversion problems Now we look at other properties of matrices Useful when A represents a transformations. Previously Focus was on solving matrix inversion problems Now we look at other properties of matrices Useful when A represents a transformations y = Ax Or A simply represents data Notion of eigenvectors,

More information

Using Trees for Classifications. Introduction

Using Trees for Classifications. Introduction Using Trees for Classifications The Phylogenetic Cibele Caio Principles and Practice of Phylogenetic Systematics, Spring 2009 Introduction The impusle to characterize and classify species Ancient Aristoteles

More information

Reconstructing Evolutionary Trees. Chapter 14

Reconstructing Evolutionary Trees. Chapter 14 Reconstructing Evolutionary Trees Chapter 14 Phylogenetic trees The evolutionary history of a group of species = phylogeny The problem: Evolutionary histories can never truly be known. Once again, we are

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods

More information

Biodiversity. The Road to the Six Kingdoms of Life

Biodiversity. The Road to the Six Kingdoms of Life Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant

More information

What is Phylogenetics

What is Phylogenetics What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)

More information

Biology. Slide 1 of 24. End Show. Copyright Pearson Prentice Hall

Biology. Slide 1 of 24. End Show. Copyright Pearson Prentice Hall Biology 1 of 24 18-2 Modern Evolutionary Classification 2 of 24 18-2 Modern Evolutionary Classification Evolutionary Classification Evolutionary Classification Phylogeny is the study of evolutionary relationships

More information