Peptide-derived Inhibitors of Protein-Protein Interactions
|
|
- Deirdre Fox
- 5 years ago
- Views:
Transcription
1 Peptide-derived Inhibitors of Protein-Protein Interactions Sven Hennig Department of Chemistry and Pharmaceutical Sciences Vrije Universiteit Amsterdam 1
2 Biomolecular recognitions Classification via interaction areas small molecule protein interaction protein protein interaction PDB 3up3 PDB 1lfd interaction area Å 2 deep cavities interaction area Å 2 flat surface 2
3 Total human proteins 19,613 Intrinsically 16 % dissordered proteins undruggable Intracellular proteins without hydrophobic pockest 3 % approved drugs 7 % potential targets 74 % not or not yet disease-relevant Human Protein Atlas, DrugBank, KS analysis 3
4 Ligands based on protein binding epitopes PDB 1ldf 4
5 Peptidomimetics, Loop α-helix β-sheet 5
6 Peptidomimetics, Loop α-helix β-sheet Review: M Pelay-Gimeno et al. Angew. Chem. Int. Ed. 2015, 54,
7 Peptidomimetics Review: M Pelay-Gimeno et al. Angew. Chem. Int. Ed. 2015, 54,
8 Stabilization of secondary and tertiary structures Monocycles Bicycles crystal structure PDB ID: 4n7y crystal structure PDB ID: 4djs model based on PDB ID: 3cwz 10 aa 15 aa 20 aa 25 aa 30 aa 35 aa 150 aa model based on PDB ID: 1t2w crystal structure unpublished 8
9 Stabilization of secondary and tertiary structures Monocycles Bicycles crystal structure PDB ID: 4n7y crystal structure PDB ID: 4djs model based on PDB ID: 3cwz 10 aa 15 aa 20 aa 25 aa 30 aa 35 aa K d : 1 µm 40 nm b-catenin K d : 5 µm 8 nm Small GTPase (Rab) K d : >100 µm 8 µm Angew. Chem. Int. Ed Cell Chem. Biol ChemBioChem 2016 Chem. Eur. J J. Med. Chem Angew. Chem. Int. Ed Nat. Commun ACS Chem. Biol
10 Hydrocarbon stapled peptides CE Schafmeister, J Po, GL Verdine JACS 2000, 122, , PM Cromm, J Spiegel, TN Grossmann, ACS Chem. Biol. 2015, 10,
11 Fmoc based SPPS: Solid Phase Peptide Synthesis Hydrocarbon stapled peptides Grubbs Catalyst 1 st Generation YW Kim, TN Grossmann, GL Verdine, Nature Prot. 2011, 6,
12 Wnt signaling pathway 12
13 Inhibition of protein-protein interaction (PPI) Inhibition of PPI TCF4 β-catenin PDB 2gl7 J. Sampietro et al. Mol. Cell 2006, 24,
14 β-catenin in protein-protein interactions (PPI) TCF4 β-catenin PDB 2gl7 Axin BCL9 APC PDB 1qz7 PDB 2gl7 PDB 1th1 ICAT LHR1 E-cadherin PDB 1m1e PDB 3tx7 PDB 3ifq 14
15 Scaffolds for peptide stapling destruction complex transcrip. activator complex J. Sampietro et al. Mol. Cell 2006, 24, Y. Xing et al. Genes Dev. 2003, 17,
16 Rational design of stapled inhibitors FP: Fluorescent Polarization T.N. Grossmann et al. PNAS 2012, 109,
17 Rational design of stapled inhibitors CD: Circular Dichrosim PDB 1QZ7 FP: Fluorescent Polarization T.N. Grossmann et al. PNAS 2012, 109,
18 Phage Display Affinity maturation Computational, here: Docking T.N. Grossmann et al. PNAS 2012, 109, D. Krüger et al., J. Med. Chem. 2017, 60, Sequence maturation eg. phage display, in silico design 18
19 Affinity maturation and sequence optimization Pull-Down Variants: here: Competition Pull-Down Variants: here: IP from Lysates - phage display results suggest variants - enrich Arg to trying to increase cellular uptake (in analogy to cell penetrating peptides - CPPs) T.N. Grossmann et al. PNAS 2012, 109,
20 Cellular Uptake in cellulo, here: confocal microscopy, fixed - phage display results suggest variants - enrich Arg to trying to increase cellular uptake (in analogy to cell penetrating peptides - CPPs) - Careful: microscopy is prone to false positives (peptides are still mobile) - Better: live cell and/or flow cytometry in cellulo: see better T.N. Grossmann et al. PNAS 2012, 109,
21 Cellular Activity in cellulo, here: LUC-Reporter gene assay - phage display results suggest variants - enrich Arg to trying to increase cellular uptake (in analogy to cell penetrating peptides - CPPs) - Careful: microscopy is prone to false positives (peptides are still mobile) - Better: live cell and/or flow cytometry - Cellular activity correlates with uptake rather than pure binding affinity T.N. Grossmann et al. PNAS 2012, 109,
22 Crystal structure at 3.0 Å resolution RRWPQS 5 ILDS 5 HVRRVWR Atomic structure, here: X-ray crystallography T.N. Grossmann et al. PNAS 2012, 109,
23 Crystal structure at 3.0 Å resolution RRWPQS 5 ILDS 5 HVRRVWR Atomic structure, here: X-ray crystallography T.N. Grossmann et al. PNAS 2012, 109,
24 Lessons learned from CPPs? stapled peptide StAx L Dietrich et al., Cell Chem. Biol. 2017, 24,
25 Ability of penetrate cells Peptidomimetics Review: M Pelay-Gimeno et al. Angew. Chem. Int. Ed. 2015, 54,
26 Summary Sven Hennig Department of Chemistry and Pharmaceutical Sciences Vrije Universiteit Amsterdam General peptidomimetics: M Pelay-Gimeno et al. Angew. Chem. Int. Ed. 2015, 54, (review) YH Lau et al., Chem. Soc. Rev., 2015, 44, Hydrocarbon stapled peptide: PM Cromm et. al., ACS Chem. Biol. 2015, 10, (review) YW Kim et al., Nature Prot. 2011, 6, (method) Affinity maturation: TN Grossmann et al. PNAS 2012, 109, D Krüger et al., J. Med. Chem. 2017, 60, P Diderich et al., ACS Chem. Biol. 2016, 11, Cellular uptake: L Dietrich et al., Cell Chem. Biol. 2017, 24, Q Chu et al., Med. Chem. Commun. 2015, 6, R Brock, Bioconjugate Chem. 2014, 25,
Virtual affinity fingerprints in drug discovery: The Drug Profile Matching method
Ágnes Peragovics Virtual affinity fingerprints in drug discovery: The Drug Profile Matching method PhD Theses Supervisor: András Málnási-Csizmadia DSc. Associate Professor Structural Biochemistry Doctoral
More informationFRAGMENT SCREENING IN LEAD DISCOVERY BY WEAK AFFINITY CHROMATOGRAPHY (WAC )
FRAGMENT SCREENING IN LEAD DISCOVERY BY WEAK AFFINITY CHROMATOGRAPHY (WAC ) SARomics Biostructures AB & Red Glead Discovery AB Medicon Village, Lund, Sweden Fragment-based lead discovery The basic idea:
More informationIntroduction to FBDD Fragment screening methods and library design
Introduction to FBDD Fragment screening methods and library design Samantha Hughes, PhD Fragments 2013 RSC BMCS Workshop 3 rd March 2013 Copyright 2013 Galapagos NV Why fragment screening methods? Guess
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Crystallization. a, Crystallization constructs of the ET B receptor are shown, with all of the modifications to the human wild-type the ET B receptor indicated. Residues interacting
More informationFluorine in Peptide and Protein Engineering
Fluorine in Peptide and Protein Engineering Rita Fernandes Porto, February 11 th 2016 Supervisor: Prof. Dr. Beate Koksch 1 Fluorine a unique element for molecule design The most abundant halogen in earth
More informationRetrieving hits through in silico screening and expert assessment M. N. Drwal a,b and R. Griffith a
Retrieving hits through in silico screening and expert assessment M.. Drwal a,b and R. Griffith a a: School of Medical Sciences/Pharmacology, USW, Sydney, Australia b: Charité Berlin, Germany Abstract:
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationGyörgy M. Keserű H2020 FRAGNET Network Hungarian Academy of Sciences
Fragment based lead discovery - introduction György M. Keserű H2020 FRAGET etwork Hungarian Academy of Sciences www.fragnet.eu Hit discovery from screening Druglike library Fragment library Large molecules
More informationChemical properties that affect binding of enzyme-inhibiting drugs to enzymes
Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes Introduction The production of new drugs requires time for development and testing, and can result in large prohibitive costs
More informationUsing Bayesian Statistics to Predict Water Affinity and Behavior in Protein Binding Sites. J. Andrew Surface
Using Bayesian Statistics to Predict Water Affinity and Behavior in Protein Binding Sites Introduction J. Andrew Surface Hampden-Sydney College / Virginia Commonwealth University In the past several decades
More informationCentral Dogma. modifications genome transcriptome proteome
entral Dogma DA ma protein post-translational modifications genome transcriptome proteome 83 ierarchy of Protein Structure 20 Amino Acids There are 20 n possible sequences for a protein of n residues!
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11085 Supplementary Tables: Supplementary Table 1. Summary of crystallographic and structure refinement data Structure BRIL-NOP receptor Data collection Number of crystals 23 Space group
More informationDr. Sander B. Nabuurs. Computational Drug Discovery group Center for Molecular and Biomolecular Informatics Radboud University Medical Centre
Dr. Sander B. Nabuurs Computational Drug Discovery group Center for Molecular and Biomolecular Informatics Radboud University Medical Centre The road to new drugs. How to find new hits? High Throughput
More informationAdvanced Medicinal Chemistry SLIDES B
Advanced Medicinal Chemistry Filippo Minutolo CFU 3 (21 hours) SLIDES B Drug likeness - ADME two contradictory physico-chemical parameters to balance: 1) aqueous solubility 2) lipid membrane permeability
More information13-3. Synthesis-Secretory pathway: Sort lumenal proteins, Secrete proteins, Sort membrane proteins
13-3. Synthesis-Secretory pathway: Sort lumenal proteins, Secrete proteins, Sort membrane proteins Molecular sorting: specific budding, vesicular transport, fusion 1. Why is this important? A. Form and
More informationTranscription Regulation And Gene Expression in Eukaryotes UPSTREAM TRANSCRIPTION FACTORS
Transcription Regulation And Gene Expression in Eukaryotes UPSTREAM TRANSCRIPTION FACTORS RG. Clerc March 26. 2008 UPSTREAM TRANSCRIPTION FACTORS Experimental approaches DNA binding domains (DBD) Transcription
More informationSynthetic chemistry and molecular modelling groups at CBMN in 01/2007
Biomimetic Supramolecular Chemistry Synthetic chemistry and molecular modelling groups at CBMN in 01/2007 Permanent staff Ivan Huc (GL, DR CNRS) Frédéric Godde (MdC UB) Organic & Medicinal Chemistry Permanent
More informationSupplementary Figure 3 a. Structural comparison between the two determined structures for the IL 23:MA12 complex. The overall RMSD between the two
Supplementary Figure 1. Biopanningg and clone enrichment of Alphabody binders against human IL 23. Positive clones in i phage ELISA with optical density (OD) 3 times higher than background are shown for
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/5/243/ra68/dc1 Supplementary Materials for Superbinder SH2 Domains Act as Antagonists of Cell Signaling Tomonori Kaneko, Haiming Huang, Xuan Cao, Xing Li, Chengjun
More informationIn silico pharmacology for drug discovery
In silico pharmacology for drug discovery In silico drug design In silico methods can contribute to drug targets identification through application of bionformatics tools. Currently, the application of
More informationUsing AutoDock for Virtual Screening
Using AutoDock for Virtual Screening CUHK Croucher ASI Workshop 2011 Stefano Forli, PhD Prof. Arthur J. Olson, Ph.D Molecular Graphics Lab Screening and Virtual Screening The ultimate tool for identifying
More informationschematic diagram; EGF binding, dimerization, phosphorylation, Grb2 binding, etc.
Lecture 1: Noncovalent Biomolecular Interactions Bioengineering and Modeling of biological processes -e.g. tissue engineering, cancer, autoimmune disease Example: RTK signaling, e.g. EGFR Growth responses
More informationChiral Supramolecular Catalyst for Asymmetric Reaction
Chiral Supramolecular Catalyst for Asymmetric Reaction 2017/1/21 (Sat.) Literature Seminar Taiki Fujita (B4) 1 Introduction Rational design of chiral ligands remains very difficult. Conventional chiral
More informationReceptor Based Drug Design (1)
Induced Fit Model For more than 100 years, the behaviour of enzymes had been explained by the "lock-and-key" mechanism developed by pioneering German chemist Emil Fischer. Fischer thought that the chemicals
More informationFragment Hotspot Maps: A CSD-derived Method for Hotspot identification
Fragment Hotspot Maps: A CSD-derived Method for Hotspot identification Chris Radoux www.ccdc.cam.ac.uk radoux@ccdc.cam.ac.uk 1 Introduction Hotspots Strongly attractive to organic molecules Organic molecules
More informationCOMBINATORIAL CHEMISTRY: CURRENT APPROACH
COMBINATORIAL CHEMISTRY: CURRENT APPROACH Dwivedi A. 1, Sitoke A. 2, Joshi V. 3, Akhtar A.K. 4* and Chaturvedi M. 1, NRI Institute of Pharmaceutical Sciences, Bhopal, M.P.-India 2, SRM College of Pharmacy,
More informationDetails of Protein Structure
Details of Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Anne Mølgaard, Kemisk Institut, Københavns Universitet Learning Objectives
More informationChemical properties that affect binding of enzyme-inhibiting drugs to enzymes
Introduction Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes The production of new drugs requires time for development and testing, and can result in large prohibitive costs
More informationMicrocalorimetry for the Life Sciences
Microcalorimetry for the Life Sciences Why Microcalorimetry? Microcalorimetry is universal detector Heat is generated or absorbed in every chemical process In-solution No molecular weight limitations Label-free
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationDepartment of Biochemistry, University of Zürich, Winterthurerstrasse 190, CH-8057 Zürich, Switzerland
Supporting information Twenty crystal structures of bromodomain and PHD finger containing protein 1 (BRPF1)/ligand complexes reveal conserved binding motifs and rare interactions Jian Zhu and Amedeo Caflisch*
More informationModeling for 3D structure prediction
Modeling for 3D structure prediction What is a predicted structure? A structure that is constructed using as the sole source of information data obtained from computer based data-mining. However, mixing
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature17991 Supplementary Discussion Structural comparison with E. coli EmrE The DMT superfamily includes a wide variety of transporters with 4-10 TM segments 1. Since the subfamilies of the
More informationStructure-based maximal affinity model predicts small-molecule druggability
Structure-based maximal affinity model predicts small-molecule druggability Alan Cheng alan.cheng@amgen.com IMA Workshop (Jan 17, 2008) Druggability prediction Introduction Affinity model Some results
More informationDispensing Processes Profoundly Impact Biological, Computational and Statistical Analyses
Dispensing Processes Profoundly Impact Biological, Computational and Statistical Analyses Sean Ekins 1, Joe Olechno 2 Antony J. Williams 3 1 Collaborations in Chemistry, Fuquay Varina, NC. 2 Labcyte Inc,
More informationRanjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013
Hydration of protein-rna recognition sites Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India 1 st November, 2013 Central Dogma of life DNA
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationMolecularly imprinted polymers
Molecularly imprinted polymers Presentation in Sensors, Arrays, Screening Lennart Niehues, Jan Philip Meyer 1 Overview Introduction Advantages Disadvantages Theory of MIP Requirements for the optimal MIP
More informationTable 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2
Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell
More informationNature Chem. Nature Chem.
Life is one of the most complicated systems on the earth. To understand the living system, scientists have devoted their efforts in two different ways: (i) to control the living systems by chemicals and/or
More informationReengineering Vancomycin to Combat Bacterial Resistance. Matthew Giletto September 18, 2013 CEM 958
Reengineering Vancomycin to Combat Bacterial Resistance Matthew Giletto September 18, 2013 CEM 958 Overview Why bacterial resistance to antibiotics is an important area of research Review the history of
More informationXV 74. Flouorescence-Polarization-Circular-Dichroism- Jablonski diagram Where does the energy go?
XV 74 Flouorescence-Polarization-Circular-Dichroism- Jablonski diagram Where does the energy go? 1) Excite system through A Absorbance S 0 S n Excite from ground excited singlet S = 0 could be any of them
More informationCurrent Literature. Development of Highly Potent and Selective Steroidal Inhibitors and Degraders of CDK8
Current Literature Development of ighly Potent and Selective Steroidal Inhibitors and Degraders of CDK8 ACS Med. Chem. Lett. 2018, ASAP Rational Drug Development simplification Cortistatin A 16-30 steps;
More informationChemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller
Chemogenomic: Approaches to Rational Drug Design Jonas Skjødt Møller Chemogenomic Chemistry Biology Chemical biology Medical chemistry Chemical genetics Chemoinformatics Bioinformatics Chemoproteomics
More information17. Biomolecular Interaction
17. Biomolecular Interaction Methods for characterizing biomolecular interactions Sequence-specific DNA binding ligands Molecular mechanisms of drug action and drug resistance In silico compound design
More informationSupporting Information
S-1 Supporting Information Flaviviral protease inhibitors identied by fragment-based library docking into a structure generated by molecular dynamics Dariusz Ekonomiuk a, Xun-Cheng Su b, Kiyoshi Ozawa
More informationEnzyme Catalysis & Biotechnology
L28-1 Enzyme Catalysis & Biotechnology Bovine Pancreatic RNase A Biochemistry, Life, and all that L28-2 A brief word about biochemistry traditionally, chemical engineers used organic and inorganic chemistry
More informationDocking with Water in the Binding Site using GOLD
Docking with Water in the Binding Site using GOLD Version 2.0 November 2017 GOLD v5.6 Table of Contents Docking with Water in the Binding Site... 2 Case Study... 3 Introduction... 3 Provided Input Files...
More informationPrinciples of Drug Design
Advanced Medicinal Chemistry II Principles of Drug Design Tentative Course Outline Instructors: Longqin Hu and John Kerrigan Direct questions and enquiries to the Course Coordinator: Longqin Hu I. Introduction
More informationApplications of Fragment Based Approaches
Applications of Fragment Based Approaches Ben Davis Vernalis R&D, Cambridge UK b.davis@vernalis.com 1 Applications of Fragment Based Approaches creening fragment libraries Techniques Vernalis eeds approach
More informationStructure of the α-helix
Structure of the α-helix Structure of the β Sheet Protein Dynamics Basics of Quenching HDX Hydrogen exchange of amide protons is catalyzed by H 2 O, OH -, and H 3 O +, but it s most dominated by base
More informationSignal Transduction. Dr. Chaidir, Apt
Signal Transduction Dr. Chaidir, Apt Background Complex unicellular organisms existed on Earth for approximately 2.5 billion years before the first multicellular organisms appeared.this long period for
More information11. IN SILICO DOCKING ANALYSIS
11. IN SILICO DOCKING ANALYSIS 11.1 Molecular docking studies of major active constituents of ethanolic extract of GP The major active constituents are identified from the ethanolic extract of Glycosmis
More informationCD Basis Set of Spectra that is used is that derived from comparing the spectra of globular proteins whose secondary structures are known from X-ray
CD Basis Set of Spectra that is used is that derived from comparing the spectra of globular proteins whose secondary structures are known from X-ray crystallography An example of the use of CD Modeling
More informationExecutive Summary. IP Owner Summary. Personal Description of Researcher. Market Feasibility. Key Technology Highlights. Trend & Partnership
POSTECH Executive Summary Dr. Kimoon Kim, a professor of Postech, has researched supramolecular chemistry using cucurbituril and developed cucurbit[n]uril (CB[n], n=5-10) and functionalized CB[n] with
More informationEdinburgh Research Explorer
Edinburgh Research Explorer Intracellular delivery of a catalytic organometallic complex Citation for published version: Indrigo, E, Clavadetscher, J, Chankeshwara, SV, Megia-fernandez, A, Lilienkampf,
More informationof the Guanine Nucleotide Exchange Factor FARP2
Structure, Volume 21 Supplemental Information Structural Basis for Autoinhibition of the Guanine Nucleotide Exchange Factor FARP2 Xiaojing He, Yi-Chun Kuo, Tyler J. Rosche, and Xuewu Zhang Inventory of
More informationIdentifying Interaction Hot Spots with SuperStar
Identifying Interaction Hot Spots with SuperStar Version 1.0 November 2017 Table of Contents Identifying Interaction Hot Spots with SuperStar... 2 Case Study... 3 Introduction... 3 Generate SuperStar Maps
More informationMembrane proteins Porins: FadL. Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella
Membrane proteins Porins: FadL Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella INDEX 1. INTRODUCTION TO MEMBRANE PROTEINS 2. FADL: OUTER MEMBRANE TRANSPORT PROTEIN 3. MAIN FEATURES OF FADL STRUCTURE
More informationSUPPLEMENTARY INFORMATION
SUPPLMTARY IFORMATIO a doi:10.108/nature10402 b 100 nm 100 nm c SAXS Model d ulers assigned to reference- Back-projected free class averages class averages Refinement against single particles Reconstructed
More informationIntroduction to Computational Structural Biology
Introduction to Computational Structural Biology Part I 1. Introduction The disciplinary character of Computational Structural Biology The mathematical background required and the topics covered Bibliography
More information1. What is an ångstrom unit, and why is it used to describe molecular structures?
1. What is an ångstrom unit, and why is it used to describe molecular structures? The ångstrom unit is a unit of distance suitable for measuring atomic scale objects. 1 ångstrom (Å) = 1 10-10 m. The diameter
More informationDetermination of the protein-ligand binding volume by high-pressure spectrofluorimetry
Determination of the protein-ligand binding volume by high-pressure spectrofluorimetry Vytautas Petrauskas Department of Biothermodynamics and Drug Design Institute of Biotechnology, Vilnius University
More informationBMB Class 17, November 30, Single Molecule Biophysics (II)
BMB 178 2018 Class 17, November 30, 2018 15. Single Molecule Biophysics (II) New Advances in Single Molecule Techniques Atomic Force Microscopy Single Molecule Manipulation - optical traps and tweezers
More informationSynthetic organic compounds
Synthetic organic compounds for research and drug discovery Compounds for TS Fragment libraries Target-focused libraries Chemical building blocks Custom synthesis Drug discovery services Contract research
More informationDesign of Enzyme Literature Seminar Yun-wei Xue
Design of Enzyme 20180714 Literature Seminar Yun-wei Xue 1 Contents 1. Introduction 2. De novo design 3. Incorporation of unnatural amino acid (main paper) 2 1.1 Advantages and limitations of natural enzyme
More informationBA, BSc, and MSc Degree Examinations
Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationALL LECTURES IN SB Introduction
1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL
More informationSupplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation
Supplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation Javier L. Baylon, Ivan L. Lenov, Stephen G. Sligar and Emad Tajkhorshid
More information1-D Predictions. Prediction of local features: Secondary structure & surface exposure
1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/317/5846/1881/dc1 Supporting Online Material for Fluorine in Pharmaceuticals: Looking Beyond Intuition Klaus Müller,* Christoph Faeh, François Diederich* *To whom correspondence
More informationExamples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE
Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To
More informationComputational Biology 1
Computational Biology 1 Protein Function & nzyme inetics Guna Rajagopal, Bioinformatics Institute, guna@bii.a-star.edu.sg References : Molecular Biology of the Cell, 4 th d. Alberts et. al. Pg. 129 190
More informationThe Potassium Ion Channel: Rahmat Muhammad
The Potassium Ion Channel: 1952-1998 1998 Rahmat Muhammad Ions: Cell volume regulation Electrical impulse formation (e.g. sodium, potassium) Lipid membrane: the dielectric barrier Pro: compartmentalization
More informationMolecular Cell Biology 5068 In Class Exam 2 November 8, 2016
Molecular Cell Biology 5068 In Class Exam 2 November 8, 2016 Exam Number: Please print your name: Instructions: Please write only on these pages, in the spaces allotted and not on the back. Write your
More informationSUPPLEMENTARY MATERIAL FOR
SUPPLEMENTARY MATERIAL FOR THE LIPID-BINDING DOMAIN OF WILD TYPE AND MUTANT ALPHA- SYNUCLEIN: COMPACTNESS AND INTERCONVERSION BETWEEN THE BROKEN- AND EXTENDED-HELIX FORMS. Elka R. Georgieva 1, Trudy F.
More informationDifferent conformations of the drugs within the virtual library of FDA approved drugs will be generated.
Chapter 3 Molecular Modeling 3.1. Introduction In this study pharmacophore models will be created to screen a virtual library of FDA approved drugs for compounds that may inhibit MA-A and MA-B. The virtual
More informationComputational Modeling of Protein Kinase A and Comparison with Nuclear Magnetic Resonance Data
Computational Modeling of Protein Kinase A and Comparison with Nuclear Magnetic Resonance Data ABSTRACT Keyword Lei Shi 1 Advisor: Gianluigi Veglia 1,2 Department of Chemistry 1, & Biochemistry, Molecular
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationPresentation Microcalorimetry for Life Science Research
Presentation Microcalorimetry for Life Science Research MicroCalorimetry The Universal Detector Heat is either generated or absorbed in every chemical process Capable of thermal measurements over a wide
More informationSupplementary Information
Supplementary Information An engineered protein antagonist of K-Ras/B-Raf interaction Monique J. Kauke, 1,2 Michael W. Traxlmayr 1,2, Jillian A. Parker 3, Jonathan D. Kiefer 4, Ryan Knihtila 3, John McGee
More informationBuilding a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor
Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Presented by Stephanie Lee Research Mentor: Dr. Rob Coalson Glycine Alpha 1 Receptor (GlyRa1) Member of the superfamily
More informationNonlinear Optics. Single-Molecule Microscopy Group. Physical Optics Maria Dienerowitz.
Single-Molecule Microscopy Group Nonlinear Optics Physical Optics 21-06-2017 Maria Dienerowitz maria.dienerowitz@med.uni-jena.de www.single-molecule-microscopy.uniklinikum-jena.de Contents Introduction
More informationTable S1 Crystallographic data and structure refinement for complexes 1 and 2. Complex H 2 O
Electronic Supplementary Information: Ternary oxovanadium(iv) complexes of ONO-donor Schiff base and polypyridyl derivatives as protein tyrosine phosphatase inhibitors: synthesis, characterization and
More informationPlan. Day 2: Exercise on MHC molecules.
Plan Day 1: What is Chemoinformatics and Drug Design? Methods and Algorithms used in Chemoinformatics including SVM. Cross validation and sequence encoding Example and exercise with herg potassium channel:
More informationStructural and functional aspects of gastric proton pump, H +,K + -ATPase
Kazuhiro ABE, Ph. D. E-mail:kabe@cespi.nagoya-u.ac.jp Structural and functional aspects of gastric proton pump, H +,K + -ATPase In response to food intake, ph of our stomach reaches around 1. This highly
More informationMicroplate-Based Measurements of Target Engagement in Live Cells With CETSA - a Reflection on Screen Results and Quantitative Interpretations
Microplate-Based Measurements of Target Engagement in Live Cells With CETSA - a Reflection on Screen Results and Quantitative Interpretations Thomas Lundbäck Karolinska Institutet ELRIG Drug Discovery
More informationPapers listed: Cell2. This weeks papers. Chapt 4. Protein structure and function. The importance of proteins
1 Papers listed: Cell2 During the semester I will speak of information from several papers. For many of them you will not be required to read these papers, however, you can do so for the fun of it (and
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationWeak hydrogen bonds in crystal engineering
Weak hydrogen bonds in crystal engineering Gautam R. Desiraju School of Chemistry University of yderabad yderabad 500 046, India gautam_desiraju@yahoo.com http://202.41.85.161/~grd/ What is crystal engineering?
More informationGenome wide analysis of protein and mrna half lives reveals dynamic properties of mammalian gene expression
Genome wide analysis of protein and mrna half lives reveals dynamic properties of mammalian gene expression Matthias Selbach Cell Signaling and Mass Spectrometry Max Delbrück Center for Molecular Medicine
More informationProtein Structures: Experiments and Modeling. Patrice Koehl
Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:
More informationImplementation of novel tools to facilitate fragment-based drug discovery by NMR:
Implementation of novel tools to facilitate fragment-based drug discovery by NMR: Automated analysis of large sets of ligand-observed NMR binding data and 19 F methods Andreas Lingel Global Discovery Chemistry
More informationThe Chinese University of Hong Kong Department of Chemistry
Prof. Yue Zhao University of Sherbrooke Canada Control of Stimult-Responsive Polymers by New Methods December 1, 2014 (Monday) 2:30 p.m. Room G35 Lady Shaw Building Prof. Chi Wu Prof. Petr Štěpánek Institute
More informationDevelopment of Pharmacophore Model for Indeno[1,2-b]indoles as Human Protein Kinase CK2 Inhibitors and Database Mining
Development of Pharmacophore Model for Indeno[1,2-b]indoles as Human Protein Kinase CK2 Inhibitors and Database Mining Samer Haidar 1, Zouhair Bouaziz 2, Christelle Marminon 2, Tiomo Laitinen 3, Anti Poso
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationCh 4: Cellular Metabolism, Part 1
Developed by John Gallagher, MS, DVM Ch 4: Cellular Metabolism, Part 1 Energy as it relates to Biology Energy for synthesis and movement Energy transformation Enzymes and how they speed reactions Metabolism
More informationSynthetic organic compounds
Synthetic organic compounds for research and drug discovery chemicals Compounds for TS Fragment libraries Target-focused libraries Chemical building blocks Custom synthesis Drug discovery services Contract
More informationStructural Perspectives on Drug Resistance
Structural Perspectives on Drug Resistance Irene Weber Departments of Biology and Chemistry Molecular Basis of Disease Program Georgia State University Atlanta, GA, USA What have we learned from 20 years
More information