Peptide-derived Inhibitors of Protein-Protein Interactions

Size: px
Start display at page:

Download "Peptide-derived Inhibitors of Protein-Protein Interactions"

Transcription

1 Peptide-derived Inhibitors of Protein-Protein Interactions Sven Hennig Department of Chemistry and Pharmaceutical Sciences Vrije Universiteit Amsterdam 1

2 Biomolecular recognitions Classification via interaction areas small molecule protein interaction protein protein interaction PDB 3up3 PDB 1lfd interaction area Å 2 deep cavities interaction area Å 2 flat surface 2

3 Total human proteins 19,613 Intrinsically 16 % dissordered proteins undruggable Intracellular proteins without hydrophobic pockest 3 % approved drugs 7 % potential targets 74 % not or not yet disease-relevant Human Protein Atlas, DrugBank, KS analysis 3

4 Ligands based on protein binding epitopes PDB 1ldf 4

5 Peptidomimetics, Loop α-helix β-sheet 5

6 Peptidomimetics, Loop α-helix β-sheet Review: M Pelay-Gimeno et al. Angew. Chem. Int. Ed. 2015, 54,

7 Peptidomimetics Review: M Pelay-Gimeno et al. Angew. Chem. Int. Ed. 2015, 54,

8 Stabilization of secondary and tertiary structures Monocycles Bicycles crystal structure PDB ID: 4n7y crystal structure PDB ID: 4djs model based on PDB ID: 3cwz 10 aa 15 aa 20 aa 25 aa 30 aa 35 aa 150 aa model based on PDB ID: 1t2w crystal structure unpublished 8

9 Stabilization of secondary and tertiary structures Monocycles Bicycles crystal structure PDB ID: 4n7y crystal structure PDB ID: 4djs model based on PDB ID: 3cwz 10 aa 15 aa 20 aa 25 aa 30 aa 35 aa K d : 1 µm 40 nm b-catenin K d : 5 µm 8 nm Small GTPase (Rab) K d : >100 µm 8 µm Angew. Chem. Int. Ed Cell Chem. Biol ChemBioChem 2016 Chem. Eur. J J. Med. Chem Angew. Chem. Int. Ed Nat. Commun ACS Chem. Biol

10 Hydrocarbon stapled peptides CE Schafmeister, J Po, GL Verdine JACS 2000, 122, , PM Cromm, J Spiegel, TN Grossmann, ACS Chem. Biol. 2015, 10,

11 Fmoc based SPPS: Solid Phase Peptide Synthesis Hydrocarbon stapled peptides Grubbs Catalyst 1 st Generation YW Kim, TN Grossmann, GL Verdine, Nature Prot. 2011, 6,

12 Wnt signaling pathway 12

13 Inhibition of protein-protein interaction (PPI) Inhibition of PPI TCF4 β-catenin PDB 2gl7 J. Sampietro et al. Mol. Cell 2006, 24,

14 β-catenin in protein-protein interactions (PPI) TCF4 β-catenin PDB 2gl7 Axin BCL9 APC PDB 1qz7 PDB 2gl7 PDB 1th1 ICAT LHR1 E-cadherin PDB 1m1e PDB 3tx7 PDB 3ifq 14

15 Scaffolds for peptide stapling destruction complex transcrip. activator complex J. Sampietro et al. Mol. Cell 2006, 24, Y. Xing et al. Genes Dev. 2003, 17,

16 Rational design of stapled inhibitors FP: Fluorescent Polarization T.N. Grossmann et al. PNAS 2012, 109,

17 Rational design of stapled inhibitors CD: Circular Dichrosim PDB 1QZ7 FP: Fluorescent Polarization T.N. Grossmann et al. PNAS 2012, 109,

18 Phage Display Affinity maturation Computational, here: Docking T.N. Grossmann et al. PNAS 2012, 109, D. Krüger et al., J. Med. Chem. 2017, 60, Sequence maturation eg. phage display, in silico design 18

19 Affinity maturation and sequence optimization Pull-Down Variants: here: Competition Pull-Down Variants: here: IP from Lysates - phage display results suggest variants - enrich Arg to trying to increase cellular uptake (in analogy to cell penetrating peptides - CPPs) T.N. Grossmann et al. PNAS 2012, 109,

20 Cellular Uptake in cellulo, here: confocal microscopy, fixed - phage display results suggest variants - enrich Arg to trying to increase cellular uptake (in analogy to cell penetrating peptides - CPPs) - Careful: microscopy is prone to false positives (peptides are still mobile) - Better: live cell and/or flow cytometry in cellulo: see better T.N. Grossmann et al. PNAS 2012, 109,

21 Cellular Activity in cellulo, here: LUC-Reporter gene assay - phage display results suggest variants - enrich Arg to trying to increase cellular uptake (in analogy to cell penetrating peptides - CPPs) - Careful: microscopy is prone to false positives (peptides are still mobile) - Better: live cell and/or flow cytometry - Cellular activity correlates with uptake rather than pure binding affinity T.N. Grossmann et al. PNAS 2012, 109,

22 Crystal structure at 3.0 Å resolution RRWPQS 5 ILDS 5 HVRRVWR Atomic structure, here: X-ray crystallography T.N. Grossmann et al. PNAS 2012, 109,

23 Crystal structure at 3.0 Å resolution RRWPQS 5 ILDS 5 HVRRVWR Atomic structure, here: X-ray crystallography T.N. Grossmann et al. PNAS 2012, 109,

24 Lessons learned from CPPs? stapled peptide StAx L Dietrich et al., Cell Chem. Biol. 2017, 24,

25 Ability of penetrate cells Peptidomimetics Review: M Pelay-Gimeno et al. Angew. Chem. Int. Ed. 2015, 54,

26 Summary Sven Hennig Department of Chemistry and Pharmaceutical Sciences Vrije Universiteit Amsterdam General peptidomimetics: M Pelay-Gimeno et al. Angew. Chem. Int. Ed. 2015, 54, (review) YH Lau et al., Chem. Soc. Rev., 2015, 44, Hydrocarbon stapled peptide: PM Cromm et. al., ACS Chem. Biol. 2015, 10, (review) YW Kim et al., Nature Prot. 2011, 6, (method) Affinity maturation: TN Grossmann et al. PNAS 2012, 109, D Krüger et al., J. Med. Chem. 2017, 60, P Diderich et al., ACS Chem. Biol. 2016, 11, Cellular uptake: L Dietrich et al., Cell Chem. Biol. 2017, 24, Q Chu et al., Med. Chem. Commun. 2015, 6, R Brock, Bioconjugate Chem. 2014, 25,

Virtual affinity fingerprints in drug discovery: The Drug Profile Matching method

Virtual affinity fingerprints in drug discovery: The Drug Profile Matching method Ágnes Peragovics Virtual affinity fingerprints in drug discovery: The Drug Profile Matching method PhD Theses Supervisor: András Málnási-Csizmadia DSc. Associate Professor Structural Biochemistry Doctoral

More information

FRAGMENT SCREENING IN LEAD DISCOVERY BY WEAK AFFINITY CHROMATOGRAPHY (WAC )

FRAGMENT SCREENING IN LEAD DISCOVERY BY WEAK AFFINITY CHROMATOGRAPHY (WAC ) FRAGMENT SCREENING IN LEAD DISCOVERY BY WEAK AFFINITY CHROMATOGRAPHY (WAC ) SARomics Biostructures AB & Red Glead Discovery AB Medicon Village, Lund, Sweden Fragment-based lead discovery The basic idea:

More information

Introduction to FBDD Fragment screening methods and library design

Introduction to FBDD Fragment screening methods and library design Introduction to FBDD Fragment screening methods and library design Samantha Hughes, PhD Fragments 2013 RSC BMCS Workshop 3 rd March 2013 Copyright 2013 Galapagos NV Why fragment screening methods? Guess

More information

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1 Supplementary Figure 1 Crystallization. a, Crystallization constructs of the ET B receptor are shown, with all of the modifications to the human wild-type the ET B receptor indicated. Residues interacting

More information

Fluorine in Peptide and Protein Engineering

Fluorine in Peptide and Protein Engineering Fluorine in Peptide and Protein Engineering Rita Fernandes Porto, February 11 th 2016 Supervisor: Prof. Dr. Beate Koksch 1 Fluorine a unique element for molecule design The most abundant halogen in earth

More information

Retrieving hits through in silico screening and expert assessment M. N. Drwal a,b and R. Griffith a

Retrieving hits through in silico screening and expert assessment M. N. Drwal a,b and R. Griffith a Retrieving hits through in silico screening and expert assessment M.. Drwal a,b and R. Griffith a a: School of Medical Sciences/Pharmacology, USW, Sydney, Australia b: Charité Berlin, Germany Abstract:

More information

Basics of protein structure

Basics of protein structure Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu

More information

György M. Keserű H2020 FRAGNET Network Hungarian Academy of Sciences

György M. Keserű H2020 FRAGNET Network Hungarian Academy of Sciences Fragment based lead discovery - introduction György M. Keserű H2020 FRAGET etwork Hungarian Academy of Sciences www.fragnet.eu Hit discovery from screening Druglike library Fragment library Large molecules

More information

Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes

Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes Introduction The production of new drugs requires time for development and testing, and can result in large prohibitive costs

More information

Using Bayesian Statistics to Predict Water Affinity and Behavior in Protein Binding Sites. J. Andrew Surface

Using Bayesian Statistics to Predict Water Affinity and Behavior in Protein Binding Sites. J. Andrew Surface Using Bayesian Statistics to Predict Water Affinity and Behavior in Protein Binding Sites Introduction J. Andrew Surface Hampden-Sydney College / Virginia Commonwealth University In the past several decades

More information

Central Dogma. modifications genome transcriptome proteome

Central Dogma. modifications genome transcriptome proteome entral Dogma DA ma protein post-translational modifications genome transcriptome proteome 83 ierarchy of Protein Structure 20 Amino Acids There are 20 n possible sequences for a protein of n residues!

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11085 Supplementary Tables: Supplementary Table 1. Summary of crystallographic and structure refinement data Structure BRIL-NOP receptor Data collection Number of crystals 23 Space group

More information

Dr. Sander B. Nabuurs. Computational Drug Discovery group Center for Molecular and Biomolecular Informatics Radboud University Medical Centre

Dr. Sander B. Nabuurs. Computational Drug Discovery group Center for Molecular and Biomolecular Informatics Radboud University Medical Centre Dr. Sander B. Nabuurs Computational Drug Discovery group Center for Molecular and Biomolecular Informatics Radboud University Medical Centre The road to new drugs. How to find new hits? High Throughput

More information

Advanced Medicinal Chemistry SLIDES B

Advanced Medicinal Chemistry SLIDES B Advanced Medicinal Chemistry Filippo Minutolo CFU 3 (21 hours) SLIDES B Drug likeness - ADME two contradictory physico-chemical parameters to balance: 1) aqueous solubility 2) lipid membrane permeability

More information

13-3. Synthesis-Secretory pathway: Sort lumenal proteins, Secrete proteins, Sort membrane proteins

13-3. Synthesis-Secretory pathway: Sort lumenal proteins, Secrete proteins, Sort membrane proteins 13-3. Synthesis-Secretory pathway: Sort lumenal proteins, Secrete proteins, Sort membrane proteins Molecular sorting: specific budding, vesicular transport, fusion 1. Why is this important? A. Form and

More information

Transcription Regulation And Gene Expression in Eukaryotes UPSTREAM TRANSCRIPTION FACTORS

Transcription Regulation And Gene Expression in Eukaryotes UPSTREAM TRANSCRIPTION FACTORS Transcription Regulation And Gene Expression in Eukaryotes UPSTREAM TRANSCRIPTION FACTORS RG. Clerc March 26. 2008 UPSTREAM TRANSCRIPTION FACTORS Experimental approaches DNA binding domains (DBD) Transcription

More information

Synthetic chemistry and molecular modelling groups at CBMN in 01/2007

Synthetic chemistry and molecular modelling groups at CBMN in 01/2007 Biomimetic Supramolecular Chemistry Synthetic chemistry and molecular modelling groups at CBMN in 01/2007 Permanent staff Ivan Huc (GL, DR CNRS) Frédéric Godde (MdC UB) Organic & Medicinal Chemistry Permanent

More information

Supplementary Figure 3 a. Structural comparison between the two determined structures for the IL 23:MA12 complex. The overall RMSD between the two

Supplementary Figure 3 a. Structural comparison between the two determined structures for the IL 23:MA12 complex. The overall RMSD between the two Supplementary Figure 1. Biopanningg and clone enrichment of Alphabody binders against human IL 23. Positive clones in i phage ELISA with optical density (OD) 3 times higher than background are shown for

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/5/243/ra68/dc1 Supplementary Materials for Superbinder SH2 Domains Act as Antagonists of Cell Signaling Tomonori Kaneko, Haiming Huang, Xuan Cao, Xing Li, Chengjun

More information

In silico pharmacology for drug discovery

In silico pharmacology for drug discovery In silico pharmacology for drug discovery In silico drug design In silico methods can contribute to drug targets identification through application of bionformatics tools. Currently, the application of

More information

Using AutoDock for Virtual Screening

Using AutoDock for Virtual Screening Using AutoDock for Virtual Screening CUHK Croucher ASI Workshop 2011 Stefano Forli, PhD Prof. Arthur J. Olson, Ph.D Molecular Graphics Lab Screening and Virtual Screening The ultimate tool for identifying

More information

schematic diagram; EGF binding, dimerization, phosphorylation, Grb2 binding, etc.

schematic diagram; EGF binding, dimerization, phosphorylation, Grb2 binding, etc. Lecture 1: Noncovalent Biomolecular Interactions Bioengineering and Modeling of biological processes -e.g. tissue engineering, cancer, autoimmune disease Example: RTK signaling, e.g. EGFR Growth responses

More information

Chiral Supramolecular Catalyst for Asymmetric Reaction

Chiral Supramolecular Catalyst for Asymmetric Reaction Chiral Supramolecular Catalyst for Asymmetric Reaction 2017/1/21 (Sat.) Literature Seminar Taiki Fujita (B4) 1 Introduction Rational design of chiral ligands remains very difficult. Conventional chiral

More information

Receptor Based Drug Design (1)

Receptor Based Drug Design (1) Induced Fit Model For more than 100 years, the behaviour of enzymes had been explained by the "lock-and-key" mechanism developed by pioneering German chemist Emil Fischer. Fischer thought that the chemicals

More information

Fragment Hotspot Maps: A CSD-derived Method for Hotspot identification

Fragment Hotspot Maps: A CSD-derived Method for Hotspot identification Fragment Hotspot Maps: A CSD-derived Method for Hotspot identification Chris Radoux www.ccdc.cam.ac.uk radoux@ccdc.cam.ac.uk 1 Introduction Hotspots Strongly attractive to organic molecules Organic molecules

More information

COMBINATORIAL CHEMISTRY: CURRENT APPROACH

COMBINATORIAL CHEMISTRY: CURRENT APPROACH COMBINATORIAL CHEMISTRY: CURRENT APPROACH Dwivedi A. 1, Sitoke A. 2, Joshi V. 3, Akhtar A.K. 4* and Chaturvedi M. 1, NRI Institute of Pharmaceutical Sciences, Bhopal, M.P.-India 2, SRM College of Pharmacy,

More information

Details of Protein Structure

Details of Protein Structure Details of Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Anne Mølgaard, Kemisk Institut, Københavns Universitet Learning Objectives

More information

Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes

Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes Introduction Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes The production of new drugs requires time for development and testing, and can result in large prohibitive costs

More information

Microcalorimetry for the Life Sciences

Microcalorimetry for the Life Sciences Microcalorimetry for the Life Sciences Why Microcalorimetry? Microcalorimetry is universal detector Heat is generated or absorbed in every chemical process In-solution No molecular weight limitations Label-free

More information

Introduction to" Protein Structure

Introduction to Protein Structure Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.

More information

Department of Biochemistry, University of Zürich, Winterthurerstrasse 190, CH-8057 Zürich, Switzerland

Department of Biochemistry, University of Zürich, Winterthurerstrasse 190, CH-8057 Zürich, Switzerland Supporting information Twenty crystal structures of bromodomain and PHD finger containing protein 1 (BRPF1)/ligand complexes reveal conserved binding motifs and rare interactions Jian Zhu and Amedeo Caflisch*

More information

Modeling for 3D structure prediction

Modeling for 3D structure prediction Modeling for 3D structure prediction What is a predicted structure? A structure that is constructed using as the sole source of information data obtained from computer based data-mining. However, mixing

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature17991 Supplementary Discussion Structural comparison with E. coli EmrE The DMT superfamily includes a wide variety of transporters with 4-10 TM segments 1. Since the subfamilies of the

More information

Structure-based maximal affinity model predicts small-molecule druggability

Structure-based maximal affinity model predicts small-molecule druggability Structure-based maximal affinity model predicts small-molecule druggability Alan Cheng alan.cheng@amgen.com IMA Workshop (Jan 17, 2008) Druggability prediction Introduction Affinity model Some results

More information

Dispensing Processes Profoundly Impact Biological, Computational and Statistical Analyses

Dispensing Processes Profoundly Impact Biological, Computational and Statistical Analyses Dispensing Processes Profoundly Impact Biological, Computational and Statistical Analyses Sean Ekins 1, Joe Olechno 2 Antony J. Williams 3 1 Collaborations in Chemistry, Fuquay Varina, NC. 2 Labcyte Inc,

More information

Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013

Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013 Hydration of protein-rna recognition sites Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India 1 st November, 2013 Central Dogma of life DNA

More information

Protein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.

Protein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small

More information

Molecularly imprinted polymers

Molecularly imprinted polymers Molecularly imprinted polymers Presentation in Sensors, Arrays, Screening Lennart Niehues, Jan Philip Meyer 1 Overview Introduction Advantages Disadvantages Theory of MIP Requirements for the optimal MIP

More information

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2 Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell

More information

Nature Chem. Nature Chem.

Nature Chem. Nature Chem. Life is one of the most complicated systems on the earth. To understand the living system, scientists have devoted their efforts in two different ways: (i) to control the living systems by chemicals and/or

More information

Reengineering Vancomycin to Combat Bacterial Resistance. Matthew Giletto September 18, 2013 CEM 958

Reengineering Vancomycin to Combat Bacterial Resistance. Matthew Giletto September 18, 2013 CEM 958 Reengineering Vancomycin to Combat Bacterial Resistance Matthew Giletto September 18, 2013 CEM 958 Overview Why bacterial resistance to antibiotics is an important area of research Review the history of

More information

XV 74. Flouorescence-Polarization-Circular-Dichroism- Jablonski diagram Where does the energy go?

XV 74. Flouorescence-Polarization-Circular-Dichroism- Jablonski diagram Where does the energy go? XV 74 Flouorescence-Polarization-Circular-Dichroism- Jablonski diagram Where does the energy go? 1) Excite system through A Absorbance S 0 S n Excite from ground excited singlet S = 0 could be any of them

More information

Current Literature. Development of Highly Potent and Selective Steroidal Inhibitors and Degraders of CDK8

Current Literature. Development of Highly Potent and Selective Steroidal Inhibitors and Degraders of CDK8 Current Literature Development of ighly Potent and Selective Steroidal Inhibitors and Degraders of CDK8 ACS Med. Chem. Lett. 2018, ASAP Rational Drug Development simplification Cortistatin A 16-30 steps;

More information

Chemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller

Chemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller Chemogenomic: Approaches to Rational Drug Design Jonas Skjødt Møller Chemogenomic Chemistry Biology Chemical biology Medical chemistry Chemical genetics Chemoinformatics Bioinformatics Chemoproteomics

More information

17. Biomolecular Interaction

17. Biomolecular Interaction 17. Biomolecular Interaction Methods for characterizing biomolecular interactions Sequence-specific DNA binding ligands Molecular mechanisms of drug action and drug resistance In silico compound design

More information

Supporting Information

Supporting Information S-1 Supporting Information Flaviviral protease inhibitors identied by fragment-based library docking into a structure generated by molecular dynamics Dariusz Ekonomiuk a, Xun-Cheng Su b, Kiyoshi Ozawa

More information

Enzyme Catalysis & Biotechnology

Enzyme Catalysis & Biotechnology L28-1 Enzyme Catalysis & Biotechnology Bovine Pancreatic RNase A Biochemistry, Life, and all that L28-2 A brief word about biochemistry traditionally, chemical engineers used organic and inorganic chemistry

More information

Docking with Water in the Binding Site using GOLD

Docking with Water in the Binding Site using GOLD Docking with Water in the Binding Site using GOLD Version 2.0 November 2017 GOLD v5.6 Table of Contents Docking with Water in the Binding Site... 2 Case Study... 3 Introduction... 3 Provided Input Files...

More information

Principles of Drug Design

Principles of Drug Design Advanced Medicinal Chemistry II Principles of Drug Design Tentative Course Outline Instructors: Longqin Hu and John Kerrigan Direct questions and enquiries to the Course Coordinator: Longqin Hu I. Introduction

More information

Applications of Fragment Based Approaches

Applications of Fragment Based Approaches Applications of Fragment Based Approaches Ben Davis Vernalis R&D, Cambridge UK b.davis@vernalis.com 1 Applications of Fragment Based Approaches creening fragment libraries Techniques Vernalis eeds approach

More information

Structure of the α-helix

Structure of the α-helix Structure of the α-helix Structure of the β Sheet Protein Dynamics Basics of Quenching HDX Hydrogen exchange of amide protons is catalyzed by H 2 O, OH -, and H 3 O +, but it s most dominated by base

More information

Signal Transduction. Dr. Chaidir, Apt

Signal Transduction. Dr. Chaidir, Apt Signal Transduction Dr. Chaidir, Apt Background Complex unicellular organisms existed on Earth for approximately 2.5 billion years before the first multicellular organisms appeared.this long period for

More information

11. IN SILICO DOCKING ANALYSIS

11. IN SILICO DOCKING ANALYSIS 11. IN SILICO DOCKING ANALYSIS 11.1 Molecular docking studies of major active constituents of ethanolic extract of GP The major active constituents are identified from the ethanolic extract of Glycosmis

More information

CD Basis Set of Spectra that is used is that derived from comparing the spectra of globular proteins whose secondary structures are known from X-ray

CD Basis Set of Spectra that is used is that derived from comparing the spectra of globular proteins whose secondary structures are known from X-ray CD Basis Set of Spectra that is used is that derived from comparing the spectra of globular proteins whose secondary structures are known from X-ray crystallography An example of the use of CD Modeling

More information

Executive Summary. IP Owner Summary. Personal Description of Researcher. Market Feasibility. Key Technology Highlights. Trend & Partnership

Executive Summary. IP Owner Summary. Personal Description of Researcher. Market Feasibility. Key Technology Highlights. Trend & Partnership POSTECH Executive Summary Dr. Kimoon Kim, a professor of Postech, has researched supramolecular chemistry using cucurbituril and developed cucurbit[n]uril (CB[n], n=5-10) and functionalized CB[n] with

More information

Edinburgh Research Explorer

Edinburgh Research Explorer Edinburgh Research Explorer Intracellular delivery of a catalytic organometallic complex Citation for published version: Indrigo, E, Clavadetscher, J, Chankeshwara, SV, Megia-fernandez, A, Lilienkampf,

More information

of the Guanine Nucleotide Exchange Factor FARP2

of the Guanine Nucleotide Exchange Factor FARP2 Structure, Volume 21 Supplemental Information Structural Basis for Autoinhibition of the Guanine Nucleotide Exchange Factor FARP2 Xiaojing He, Yi-Chun Kuo, Tyler J. Rosche, and Xuewu Zhang Inventory of

More information

Identifying Interaction Hot Spots with SuperStar

Identifying Interaction Hot Spots with SuperStar Identifying Interaction Hot Spots with SuperStar Version 1.0 November 2017 Table of Contents Identifying Interaction Hot Spots with SuperStar... 2 Case Study... 3 Introduction... 3 Generate SuperStar Maps

More information

Membrane proteins Porins: FadL. Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella

Membrane proteins Porins: FadL. Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella Membrane proteins Porins: FadL Oriol Solà, Dimitri Ivancic, Daniel Folch, Marc Olivella INDEX 1. INTRODUCTION TO MEMBRANE PROTEINS 2. FADL: OUTER MEMBRANE TRANSPORT PROTEIN 3. MAIN FEATURES OF FADL STRUCTURE

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLMTARY IFORMATIO a doi:10.108/nature10402 b 100 nm 100 nm c SAXS Model d ulers assigned to reference- Back-projected free class averages class averages Refinement against single particles Reconstructed

More information

Introduction to Computational Structural Biology

Introduction to Computational Structural Biology Introduction to Computational Structural Biology Part I 1. Introduction The disciplinary character of Computational Structural Biology The mathematical background required and the topics covered Bibliography

More information

1. What is an ångstrom unit, and why is it used to describe molecular structures?

1. What is an ångstrom unit, and why is it used to describe molecular structures? 1. What is an ångstrom unit, and why is it used to describe molecular structures? The ångstrom unit is a unit of distance suitable for measuring atomic scale objects. 1 ångstrom (Å) = 1 10-10 m. The diameter

More information

Determination of the protein-ligand binding volume by high-pressure spectrofluorimetry

Determination of the protein-ligand binding volume by high-pressure spectrofluorimetry Determination of the protein-ligand binding volume by high-pressure spectrofluorimetry Vytautas Petrauskas Department of Biothermodynamics and Drug Design Institute of Biotechnology, Vilnius University

More information

BMB Class 17, November 30, Single Molecule Biophysics (II)

BMB Class 17, November 30, Single Molecule Biophysics (II) BMB 178 2018 Class 17, November 30, 2018 15. Single Molecule Biophysics (II) New Advances in Single Molecule Techniques Atomic Force Microscopy Single Molecule Manipulation - optical traps and tweezers

More information

Synthetic organic compounds

Synthetic organic compounds Synthetic organic compounds for research and drug discovery Compounds for TS Fragment libraries Target-focused libraries Chemical building blocks Custom synthesis Drug discovery services Contract research

More information

Design of Enzyme Literature Seminar Yun-wei Xue

Design of Enzyme Literature Seminar Yun-wei Xue Design of Enzyme 20180714 Literature Seminar Yun-wei Xue 1 Contents 1. Introduction 2. De novo design 3. Incorporation of unnatural amino acid (main paper) 2 1.1 Advantages and limitations of natural enzyme

More information

BA, BSc, and MSc Degree Examinations

BA, BSc, and MSc Degree Examinations Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes

More information

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its

More information

ALL LECTURES IN SB Introduction

ALL LECTURES IN SB Introduction 1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL

More information

Supplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation

Supplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation Supplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation Javier L. Baylon, Ivan L. Lenov, Stephen G. Sligar and Emad Tajkhorshid

More information

1-D Predictions. Prediction of local features: Secondary structure & surface exposure

1-D Predictions. Prediction of local features: Secondary structure & surface exposure 1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local

More information

Supporting Online Material for

Supporting Online Material for www.sciencemag.org/cgi/content/full/317/5846/1881/dc1 Supporting Online Material for Fluorine in Pharmaceuticals: Looking Beyond Intuition Klaus Müller,* Christoph Faeh, François Diederich* *To whom correspondence

More information

Examples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE

Examples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To

More information

Computational Biology 1

Computational Biology 1 Computational Biology 1 Protein Function & nzyme inetics Guna Rajagopal, Bioinformatics Institute, guna@bii.a-star.edu.sg References : Molecular Biology of the Cell, 4 th d. Alberts et. al. Pg. 129 190

More information

The Potassium Ion Channel: Rahmat Muhammad

The Potassium Ion Channel: Rahmat Muhammad The Potassium Ion Channel: 1952-1998 1998 Rahmat Muhammad Ions: Cell volume regulation Electrical impulse formation (e.g. sodium, potassium) Lipid membrane: the dielectric barrier Pro: compartmentalization

More information

Molecular Cell Biology 5068 In Class Exam 2 November 8, 2016

Molecular Cell Biology 5068 In Class Exam 2 November 8, 2016 Molecular Cell Biology 5068 In Class Exam 2 November 8, 2016 Exam Number: Please print your name: Instructions: Please write only on these pages, in the spaces allotted and not on the back. Write your

More information

SUPPLEMENTARY MATERIAL FOR

SUPPLEMENTARY MATERIAL FOR SUPPLEMENTARY MATERIAL FOR THE LIPID-BINDING DOMAIN OF WILD TYPE AND MUTANT ALPHA- SYNUCLEIN: COMPACTNESS AND INTERCONVERSION BETWEEN THE BROKEN- AND EXTENDED-HELIX FORMS. Elka R. Georgieva 1, Trudy F.

More information

Different conformations of the drugs within the virtual library of FDA approved drugs will be generated.

Different conformations of the drugs within the virtual library of FDA approved drugs will be generated. Chapter 3 Molecular Modeling 3.1. Introduction In this study pharmacophore models will be created to screen a virtual library of FDA approved drugs for compounds that may inhibit MA-A and MA-B. The virtual

More information

Computational Modeling of Protein Kinase A and Comparison with Nuclear Magnetic Resonance Data

Computational Modeling of Protein Kinase A and Comparison with Nuclear Magnetic Resonance Data Computational Modeling of Protein Kinase A and Comparison with Nuclear Magnetic Resonance Data ABSTRACT Keyword Lei Shi 1 Advisor: Gianluigi Veglia 1,2 Department of Chemistry 1, & Biochemistry, Molecular

More information

CAP 5510 Lecture 3 Protein Structures

CAP 5510 Lecture 3 Protein Structures CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity

More information

Presentation Microcalorimetry for Life Science Research

Presentation Microcalorimetry for Life Science Research Presentation Microcalorimetry for Life Science Research MicroCalorimetry The Universal Detector Heat is either generated or absorbed in every chemical process Capable of thermal measurements over a wide

More information

Supplementary Information

Supplementary Information Supplementary Information An engineered protein antagonist of K-Ras/B-Raf interaction Monique J. Kauke, 1,2 Michael W. Traxlmayr 1,2, Jillian A. Parker 3, Jonathan D. Kiefer 4, Ryan Knihtila 3, John McGee

More information

Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor

Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Presented by Stephanie Lee Research Mentor: Dr. Rob Coalson Glycine Alpha 1 Receptor (GlyRa1) Member of the superfamily

More information

Nonlinear Optics. Single-Molecule Microscopy Group. Physical Optics Maria Dienerowitz.

Nonlinear Optics. Single-Molecule Microscopy Group. Physical Optics Maria Dienerowitz. Single-Molecule Microscopy Group Nonlinear Optics Physical Optics 21-06-2017 Maria Dienerowitz maria.dienerowitz@med.uni-jena.de www.single-molecule-microscopy.uniklinikum-jena.de Contents Introduction

More information

Table S1 Crystallographic data and structure refinement for complexes 1 and 2. Complex H 2 O

Table S1 Crystallographic data and structure refinement for complexes 1 and 2. Complex H 2 O Electronic Supplementary Information: Ternary oxovanadium(iv) complexes of ONO-donor Schiff base and polypyridyl derivatives as protein tyrosine phosphatase inhibitors: synthesis, characterization and

More information

Plan. Day 2: Exercise on MHC molecules.

Plan. Day 2: Exercise on MHC molecules. Plan Day 1: What is Chemoinformatics and Drug Design? Methods and Algorithms used in Chemoinformatics including SVM. Cross validation and sequence encoding Example and exercise with herg potassium channel:

More information

Structural and functional aspects of gastric proton pump, H +,K + -ATPase

Structural and functional aspects of gastric proton pump, H +,K + -ATPase Kazuhiro ABE, Ph. D. E-mail:kabe@cespi.nagoya-u.ac.jp Structural and functional aspects of gastric proton pump, H +,K + -ATPase In response to food intake, ph of our stomach reaches around 1. This highly

More information

Microplate-Based Measurements of Target Engagement in Live Cells With CETSA - a Reflection on Screen Results and Quantitative Interpretations

Microplate-Based Measurements of Target Engagement in Live Cells With CETSA - a Reflection on Screen Results and Quantitative Interpretations Microplate-Based Measurements of Target Engagement in Live Cells With CETSA - a Reflection on Screen Results and Quantitative Interpretations Thomas Lundbäck Karolinska Institutet ELRIG Drug Discovery

More information

Papers listed: Cell2. This weeks papers. Chapt 4. Protein structure and function. The importance of proteins

Papers listed: Cell2. This weeks papers. Chapt 4. Protein structure and function. The importance of proteins 1 Papers listed: Cell2 During the semester I will speak of information from several papers. For many of them you will not be required to read these papers, however, you can do so for the fun of it (and

More information

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL

More information

Weak hydrogen bonds in crystal engineering

Weak hydrogen bonds in crystal engineering Weak hydrogen bonds in crystal engineering Gautam R. Desiraju School of Chemistry University of yderabad yderabad 500 046, India gautam_desiraju@yahoo.com http://202.41.85.161/~grd/ What is crystal engineering?

More information

Genome wide analysis of protein and mrna half lives reveals dynamic properties of mammalian gene expression

Genome wide analysis of protein and mrna half lives reveals dynamic properties of mammalian gene expression Genome wide analysis of protein and mrna half lives reveals dynamic properties of mammalian gene expression Matthias Selbach Cell Signaling and Mass Spectrometry Max Delbrück Center for Molecular Medicine

More information

Protein Structures: Experiments and Modeling. Patrice Koehl

Protein Structures: Experiments and Modeling. Patrice Koehl Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:

More information

Implementation of novel tools to facilitate fragment-based drug discovery by NMR:

Implementation of novel tools to facilitate fragment-based drug discovery by NMR: Implementation of novel tools to facilitate fragment-based drug discovery by NMR: Automated analysis of large sets of ligand-observed NMR binding data and 19 F methods Andreas Lingel Global Discovery Chemistry

More information

The Chinese University of Hong Kong Department of Chemistry

The Chinese University of Hong Kong Department of Chemistry Prof. Yue Zhao University of Sherbrooke Canada Control of Stimult-Responsive Polymers by New Methods December 1, 2014 (Monday) 2:30 p.m. Room G35 Lady Shaw Building Prof. Chi Wu Prof. Petr Štěpánek Institute

More information

Development of Pharmacophore Model for Indeno[1,2-b]indoles as Human Protein Kinase CK2 Inhibitors and Database Mining

Development of Pharmacophore Model for Indeno[1,2-b]indoles as Human Protein Kinase CK2 Inhibitors and Database Mining Development of Pharmacophore Model for Indeno[1,2-b]indoles as Human Protein Kinase CK2 Inhibitors and Database Mining Samer Haidar 1, Zouhair Bouaziz 2, Christelle Marminon 2, Tiomo Laitinen 3, Anti Poso

More information

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK

More information

Ch 4: Cellular Metabolism, Part 1

Ch 4: Cellular Metabolism, Part 1 Developed by John Gallagher, MS, DVM Ch 4: Cellular Metabolism, Part 1 Energy as it relates to Biology Energy for synthesis and movement Energy transformation Enzymes and how they speed reactions Metabolism

More information

Synthetic organic compounds

Synthetic organic compounds Synthetic organic compounds for research and drug discovery chemicals Compounds for TS Fragment libraries Target-focused libraries Chemical building blocks Custom synthesis Drug discovery services Contract

More information

Structural Perspectives on Drug Resistance

Structural Perspectives on Drug Resistance Structural Perspectives on Drug Resistance Irene Weber Departments of Biology and Chemistry Molecular Basis of Disease Program Georgia State University Atlanta, GA, USA What have we learned from 20 years

More information