1-D Predictions. Prediction of local features: Secondary structure & surface exposure
|
|
- Francis Brooks
- 5 years ago
- Views:
Transcription
1 1-D Predictions Prediction of local features: Secondary structure & surface exposure 1
2 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local feature terms: Secondary structure Surface accessibility/exposure Transmembrane helix Signal peptide Protein disorder Use different 1-D prediction servers and interpret the results (the exercise). 2
3 Residue Patterns Helices Helix capping Amphiphilic residue patterns C N Sheets Amphiphilic residue patterns Residue preferences at edges vs. middle Special residues Proline Helix breaker Glycine In turns/loops/bends 3
4 1-D predictions Local Structures " Secondary Structure " Trans Membrane Helix Features " Surface Accessibility " Signal Peptides 4
5 Secondary Structure Elements α-helix = H 310-helix = G π-helix = I Extended (ß)-Strand = E Isolated ß-bridge = B Turn = T Bend = S Rest (Coil) = C/. 5
6 Assignment from Structure DSSP ( ) STRIDE ( ) DSSPcont ( ) 6
7 Helices 7
8 Three-State Prediction of Classes Α-helix = H helix = G π-helix = I Extended (ß)-Strand = E Isolated ß-bridge = B Turn = T Bend = S The Rest (Coil) =./C H E C 8
9 Prediction Servers Psi-Pred ( PHDProf Jpred 9
10 PsiPRED PSIPRED PREDICTION RESULTS" " Key" " Conf: Confidence (0=low, 9=high)" Pred: Predicted secondary structure (H=helix, E=strand, C=coil)" AA: Target sequence" " " # PSIPRED HFORMAT (PSIPRED V2.3 by David Jones)" " Conf: " Pred: CCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCHHHHHHH" AA: MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGIL" " " " Conf: " Pred: HHHHHHCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHCCC" AA: GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYS" " " " Conf: " Pred: HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH" AA: AGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV" " " " Conf: " Pred: HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH" AA: LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAY" " " " Conf: " Pred: HHHHCCHHHCCC" AA: QKRMGVQMQRFK" 250" " " Calculate PostScript, PDF and JPEG graphical output for this result using: " 10
11 PsiPred 11
12 Trans-Membrane Helices 12
13 Transmembrane Helix Predictors TMHMM Phobius (Philius) HMMTOP DAS 13
14 Signal Peptide SignalP Phobius Philius 14
15 Prediction Methods Exemplified by Secondary Structure Predictions 15
16 Amino Acid Statistics VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRI!.HHHHHHHHHHHHHHHHS...GGGEEEEEEEEE.SS.EEEEEEETTTTEEEEEEEEEHHHHHHTT.HHHHHHHHHH! Helix Strand Coil VKEFLAKAK! QLDQFDRIK! KKWETPSQN! KEFLAKAKE! LDQFDRIKT! KWETPSQNT! EFLAKAKED! DQFDRIKTL! WETPSQNTA!!.!.!.!.!.!!.!.!.!.!.! 16!.!.!.!.!.!
17 Propensities Helix 17
18 BLOSUM Substitution A R N D C Q E G H I L K M F P S T W Y V B Z X * A R N D C Q E G H I L K M F P S T W Y V
19 Position Specific Substitution Matrices (PSSM) 19
20 PSSM Sequence The 20 amino acid residues A R N D C Q E G H I L K M F P S T W Y V 1 I K E E H V I I Q A E F Y L N P D
21 Neural Networks Benefits Generally applicable Can capture higher order correlations Inputs other than sequence information Drawbacks Needs a lot of data (different solved structures with low sequence identity). Complex methods with several pitfalls. 21
22 Neural Networks (Hidden Layer) Weights 22
23 NetSurfP Prediction of Real Value Solvent Accessibility By Bent Petersen 23
24 Objective Predict residues as being either buried or exposed (25 % threshold) Two states/classes, Buried/Exposed Predict the Relative Solvent Accessibility Real Value 24
25 Why predict RSA? Residues exposed on surface can be: Involved in PTM s Potential antigenic regions Involved in Protein-Protein interactions Prediction of Disease-SNP s 25
26 What is ASA? Accessible Solvent Area, Å 2 Surface area accessible to a rolling water molecule 26
27 RSA RSA = Relative Solvent Accessibility ACC = Accessible area in protein structure ASA = Accessible Surface Area in Gly-X-Gly or Ala-X-Ala Classification networks Real value networks Classification: Buried = RSA < 25 %, Exposed = RSA > 25 %" Real Value: values 0-1, RSA > 1 set to 1" 27
28 Learning / Training dataset Training set: Cull_1764: Max. Seq. ID: 25 % Resolution: 2.0 Å R-Factor: 0.2 Seq. Length AA Excluding non X-ray entries 28
29 Learning / Training dataset Homology reduced against evaluation set CB513 (302 sequences removed) Final Training set: 1764 sequences amino acids Buried: % ( amino acids) Exposed: % ( amino acids) 29
30 Method 30
31 Results - Real Value Prediction Training / Evaluation Train Evaluated Method Ahmad et al. (2003) Not Published 0.48 ANN Yuan and Huang (2004) Not Published 0.52 SVR Nguyen and Rajapakse(2006) Not Published 0.66 Two-Stage SVR Dor and Zhou (2007) Not Published ANN NetSurfP ANN 31
32 NetSurfP /usr/cbs/bio/src/netsurfp/netsurfp -h 32
33 NetSurfP Output 33
34 Protein D iso r d e r Introduction to DisEMBL, IUPred & FoldUnfold 34
35 Protein Folding Initially formed structure is in molten globule state (ensemble). E T Transition state(s), one or more narrow ensembles Molten globule condenses to native fold via transition state. U Unfolded state, ensemble ΔG F Native fold, one structure 35
36 Degrees of Structure 36
37 Structures of Unstructured Regions Estimate: 20% of all proteins contain unstructured regions. 1% of structures in PDB contain unstructured regions. Structural genomics Special structural genomics projects Selection and modification of targets Prediction of crystallisable domains Protein disorder publications in PubMed Iakoucheva & Dunker Structure
38 What s the Fuss About? Properties of Disordered Regions Flexible, i.e. adaptable Accessible Contain Extended Linear Motifs (ELM) Different behaviour in interaction interfaces Very adaptable Many hydrophobic interactions (close packing) No fixed structure without interaction partner Folding upon binding 38
39 DisEMBL Basic notion No consensus on protein disorder definition. Defines three types of disorder The method ANN-based Disorder definitions Loop/Coil (DSSP-assigned residues: T, S, B, I) Hot loops (high B-factor) Missing residues (in X-ray structures, Remark 465 ) 39 Linding et al. Structure 2003
40 DisEMBL Derived propensity scale (implicit) 40
41 DisEMBL Output Ero1-Lα 41
42 IUPred Basic notion: Globular proteins need to make a large number of inter-residue interactions to overcome the loss of entropy upon folding. The method 20 x 20 energy predictor matrix (pairwise interactions). Derived from globular proteins. Quadratic expression in amino acid composition. Definitions Binary definition: Order/disorder Two ranges: long ~ regions/domains Short ~ loops Domain prediction (inverse of long range predictions). 42 Dosztanáyi et al. Bioinformatics 2005
43 IUPred Output Ero1-Lα Position Residue Disorder Tendency 1 E E Q P P
44 FoldUnfold Basic notion Globular proteins need to establish a high number of interactions to compensate for the loss of entropy during the folding process. The method Mean packing density Derived from globular proteins. ANN-based. Definitions Binary definition: Order/disorder Two ranges: Long ~ regions/domains Short ~ loops 44 Galzitskaya et al. Bioinformatics 2006 & Protein Science 2000
45 FoldUnfold Output Ero1-Lα disordered: disordered: disordered: disordered: disordered:
46 Comparison DisEMBL IUPred FoldUnfold Disordered residues:
47 Ero1 example 47
48 Summary: Sequence Analysis Predict properties from sequence Cellular localisation (signal peptides, TM helices, etc.) Secondary structure Identification of flexibillity/disorder/stability etc. Modification sites (phosphorylation, glycosylation, acetylation, etc.) Identification of catalytic residues EPipe An automated tool for sequence comparison Under development 48
49 EPipe Difference Plot AKT1 variants involved in cancer: E17K R25C Alignment seq1 seq2 seq M S D V A I V K E G W L H K R G E Y I K T W R P R Y F L L K N D G T F I G Y K E R P Q D V D Q R E A P L M S D V A I V K E G W L H K R G K Y I K T W R P R Y F L L K N D G T F I G Y K E R P Q D V D Q R E A P L M S D V A I V K E G W L H K R G E Y I K T W R P C Y F L L K N D G T F I G Y K E R P Q D V D Q R E A P L NetSurfP Pfam IUpred PSIPRED Blicher et al. Protein annotation in the era of personal genomics, Curr Opin Struct Biol (2010).
50 Links DisEMBL: IUPred: FoldUnfold 50
51 Exercise Step
IT og Sundhed 2010/11
IT og Sundhed 2010/11 Sequence based predictors. Secondary structure and surface accessibility Bent Petersen 13 January 2011 1 NetSurfP Real Value Solvent Accessibility predictions with amino acid associated
More informationSCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like
SCOP all-β class 4-helical cytokines T4 endonuclease V all-α class, 3 different folds Globin-like TIM-barrel fold α/β class Profilin-like fold α+β class http://scop.mrc-lmb.cam.ac.uk/scop CATH Class, Architecture,
More informationProtein structure alignments
Protein structure alignments Proteins that fold in the same way, i.e. have the same fold are often homologs. Structure evolves slower than sequence Sequence is less conserved than structure If BLAST gives
More informationSUPPLEMENTARY MATERIALS
SUPPLEMENTARY MATERIALS Enhanced Recognition of Transmembrane Protein Domains with Prediction-based Structural Profiles Baoqiang Cao, Aleksey Porollo, Rafal Adamczak, Mark Jarrell and Jaroslaw Meller Contact:
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationBioinformatics Practical for Biochemists
Bioinformatics Practical for Biochemists Andrei Lupas, Birte Höcker, Steffen Schmidt WS 2013/14 03. Sequence Features Targeting proteins signal peptide targets proteins to the secretory pathway N-terminal
More informationNeural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha
Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationStatistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics
Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationTHE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION
THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION AND CALIBRATION Calculation of turn and beta intrinsic propensities. A statistical analysis of a protein structure
More informationBioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction. Sepp Hochreiter
Bioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction Institute of Bioinformatics Johannes Kepler University, Linz, Austria Chapter 4 Protein Secondary
More informationPROTEIN SECONDARY STRUCTURE PREDICTION: AN APPLICATION OF CHOU-FASMAN ALGORITHM IN A HYPOTHETICAL PROTEIN OF SARS VIRUS
Int. J. LifeSc. Bt & Pharm. Res. 2012 Kaladhar, 2012 Research Paper ISSN 2250-3137 www.ijlbpr.com Vol.1, Issue. 1, January 2012 2012 IJLBPR. All Rights Reserved PROTEIN SECONDARY STRUCTURE PREDICTION:
More informationBIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer Protein Structure Prediction I
BIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer 2013 9. Protein Structure Prediction I Structure Prediction Overview Overview of problem variants Secondary structure prediction
More informationWeek 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
More informationAmino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1
Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings
More informationBioinformatics: Secondary Structure Prediction
Bioinformatics: Secondary Structure Prediction Prof. David Jones d.t.jones@ucl.ac.uk Possibly the greatest unsolved problem in molecular biology: The Protein Folding Problem MWMPPRPEEVARK LRRLGFVERMAKG
More informationAdvanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions
BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More informationBioinformatics: Secondary Structure Prediction
Bioinformatics: Secondary Structure Prediction Prof. David Jones d.jones@cs.ucl.ac.uk LMLSTQNPALLKRNIIYWNNVALLWEAGSD The greatest unsolved problem in molecular biology:the Protein Folding Problem? Entries
More informationProtein Secondary Structure Assignment and Prediction
1 Protein Secondary Structure Assignment and Prediction Defining SS features - Dihedral angles, alpha helix, beta stand (Hydrogen bonds) Assigned manually by crystallographers or Automatic DSSP (Kabsch
More informationSupersecondary Structures (structural motifs)
Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric
More informationProtein quality assessment
Protein quality assessment Speaker: Renzhi Cao Advisor: Dr. Jianlin Cheng Major: Computer Science May 17 th, 2013 1 Outline Introduction Paper1 Paper2 Paper3 Discussion and research plan Acknowledgement
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More informationProtein Structures: Experiments and Modeling. Patrice Koehl
Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:
More informationDetails of Protein Structure
Details of Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Anne Mølgaard, Kemisk Institut, Københavns Universitet Learning Objectives
More informationProtein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods
Cell communication channel Bioinformatics Methods Iosif Vaisman Email: ivaisman@gmu.edu SEQUENCE STRUCTURE DNA Sequence Protein Sequence Protein Structure Protein structure ATGAAATTTGGAAACTTCCTTCTCACTTATCAGCCACCT...
More informationSequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
More informationProtein Structure Prediction and Display
Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each
More informationBCB 444/544 Fall 07 Dobbs 1
BCB 444/544 Lecture 21 Protein Structure Visualization, Classification & Comparison Secondary Structure #21_Oct10 Required Reading (before lecture) Mon Oct 8 - Lecture 20 Protein Secondary Structure Chp
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure
More informationIntroduction to Computational Structural Biology
Introduction to Computational Structural Biology Part I 1. Introduction The disciplinary character of Computational Structural Biology The mathematical background required and the topics covered Bibliography
More informationProtein Secondary Structure Prediction
Protein Secondary Structure Prediction Doug Brutlag & Scott C. Schmidler Overview Goals and problem definition Existing approaches Classic methods Recent successful approaches Evaluating prediction algorithms
More informationPacking of Secondary Structures
7.88 Lecture Notes - 4 7.24/7.88J/5.48J The Protein Folding and Human Disease Professor Gossard Retrieving, Viewing Protein Structures from the Protein Data Base Helix helix packing Packing of Secondary
More informationD Dobbs ISU - BCB 444/544X 1
11/7/05 Protein Structure: Classification, Databases, Visualization Announcements BCB 544 Projects - Important Dates: Nov 2 Wed noon - Project proposals due to David/Drena Nov 4 Fri PM - Approvals/responses
More informationMotif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
More informationProtein Structure Basics
Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes
More informationBiochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture - 06 Protein Structure IV
Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur Lecture - 06 Protein Structure IV We complete our discussion on Protein Structures today. And just to recap
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2003 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More informationLecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ].
Lecture 26: Polymers: DA Packing and Protein folding 26.1 Problem Set 4 due today. eading for Lectures 22 24: PKT hapter 8 DA Packing for Eukaryotes: The packing problem for the larger eukaryotic genomes
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2004 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More informationCan protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU
Can protein model accuracy be identified? Morten Nielsen, CBS, BioCentrum, DTU NO! Identification of Protein-model accuracy Why is it important? What is accuracy RMSD, fraction correct, Protein model correctness/quality
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationBCH 4053 Spring 2003 Chapter 6 Lecture Notes
BCH 4053 Spring 2003 Chapter 6 Lecture Notes 1 CHAPTER 6 Proteins: Secondary, Tertiary, and Quaternary Structure 2 Levels of Protein Structure Primary (sequence) Secondary (ordered structure along peptide
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationImproving Protein Secondary-Structure Prediction by Predicting Ends of Secondary-Structure Segments
Improving Protein Secondary-Structure Prediction by Predicting Ends of Secondary-Structure Segments Uros Midic 1 A. Keith Dunker 2 Zoran Obradovic 1* 1 Center for Information Science and Technology Temple
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationWe used the PSI-BLAST program (http://www.ncbi.nlm.nih.gov/blast/) to search the
SUPPLEMENTARY METHODS - in silico protein analysis We used the PSI-BLAST program (http://www.ncbi.nlm.nih.gov/blast/) to search the Protein Data Bank (PDB, http://www.rcsb.org/pdb/) and the NCBI non-redundant
More informationLecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability
Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Part I. Review of forces Covalent bonds Non-covalent Interactions: Van der Waals Interactions
More information09/06/25. Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Non-uniform distribution of folds. Scheme of protein structure predicition
Sequence identity Structural similarity Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Fold recognition Sommersemester 2009 Peter Güntert Structural similarity X Sequence identity Non-uniform
More informationProtein Secondary Structure Prediction
part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 the goal is the prediction of the secondary structure conformation which is local each amino
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationAnalysis and Prediction of Protein Structure (I)
Analysis and Prediction of Protein Structure (I) Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 2006 Free for academic use. Copyright @ Jianlin Cheng
More informationDATE A DAtabase of TIM Barrel Enzymes
DATE A DAtabase of TIM Barrel Enzymes 2 2.1 Introduction.. 2.2 Objective and salient features of the database 2.2.1 Choice of the dataset.. 2.3 Statistical information on the database.. 2.4 Features....
More informationProtein Secondary Structure Prediction
C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 7 Protein Secondary Structure Prediction Protein primary
More informationSteps in protein modelling. Structure prediction, fold recognition and homology modelling. Basic principles of protein structure
Structure prediction, fold recognition and homology modelling Marjolein Thunnissen Lund September 2012 Steps in protein modelling 3-D structure known Comparative Modelling Sequence of interest Similarity
More informationProceedings of the 22nd International Workshop on Database and Expert Systems Applications (2011), 70-74
Novel Application of Query-Based Qualitative Predictors for Characterization of Solvent Accessible Residues in Conjunction with Protein Sequence Homology Proceedings of the 22nd International Workshop
More information4 Proteins: Structure, Function, Folding W. H. Freeman and Company
4 Proteins: Structure, Function, Folding 2013 W. H. Freeman and Company CHAPTER 4 Proteins: Structure, Function, Folding Learning goals: Structure and properties of the peptide bond Structural hierarchy
More informationBayesian Models and Algorithms for Protein Beta-Sheet Prediction
0 Bayesian Models and Algorithms for Protein Beta-Sheet Prediction Zafer Aydin, Student Member, IEEE, Yucel Altunbasak, Senior Member, IEEE, and Hakan Erdogan, Member, IEEE Abstract Prediction of the three-dimensional
More informationALL LECTURES IN SB Introduction
1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL
More informationBio nformatics. Lecture 23. Saad Mneimneh
Bio nformatics Lecture 23 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely
More informationLecture 7. Protein Secondary Structure Prediction. Secondary Structure DSSP. Master Course DNA/Protein Structurefunction.
C N T R F O R N T G R A T V B O N F O R M A T C S V U Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 7 Protein Secondary Structure Prediction Protein primary structure 20 amino
More informationStructure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27
Acta Cryst. (2014). D70, doi:10.1107/s1399004714021695 Supporting information Volume 70 (2014) Supporting information for article: Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase
More informationRanjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013
Hydration of protein-rna recognition sites Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India 1 st November, 2013 Central Dogma of life DNA
More informationCMPS 3110: Bioinformatics. Tertiary Structure Prediction
CMPS 3110: Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the laws of physics! Conformation space is finite
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction
CMPS 6630: Introduction to Computational Biology and Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the
More informationProtein folding. α-helix. Lecture 21. An α-helix is a simple helix having on average 10 residues (3 turns of the helix)
Computat onal Biology Lecture 21 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely
More informationOptimization of the Sliding Window Size for Protein Structure Prediction
Optimization of the Sliding Window Size for Protein Structure Prediction Ke Chen* 1, Lukasz Kurgan 1 and Jishou Ruan 2 1 University of Alberta, Department of Electrical and Computer Engineering, Edmonton,
More informationBiomolecules: lecture 10
Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet
More informationProtein Secondary Structure Prediction using Feed-Forward Neural Network
COPYRIGHT 2010 JCIT, ISSN 2078-5828 (PRINT), ISSN 2218-5224 (ONLINE), VOLUME 01, ISSUE 01, MANUSCRIPT CODE: 100713 Protein Secondary Structure Prediction using Feed-Forward Neural Network M. A. Mottalib,
More informationHeteropolymer. Mostly in regular secondary structure
Heteropolymer - + + - Mostly in regular secondary structure 1 2 3 4 C >N trace how you go around the helix C >N C2 >N6 C1 >N5 What s the pattern? Ci>Ni+? 5 6 move around not quite 120 "#$%&'!()*(+2!3/'!4#5'!1/,#64!#6!,6!
More informationGetting To Know Your Protein
Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research
More information3D Structure. Prediction & Assessment Pt. 2. David Wishart 3-41 Athabasca Hall
3D Structure Prediction & Assessment Pt. 2 David Wishart 3-41 Athabasca Hall david.wishart@ualberta.ca Objectives Become familiar with methods and algorithms for secondary Structure Prediction Become familiar
More informationBiotechnology of Proteins. The Source of Stability in Proteins (III) Fall 2015
Biotechnology of Proteins The Source of Stability in Proteins (III) Fall 2015 Conformational Entropy of Unfolding It is The factor that makes the greatest contribution to stabilization of the unfolded
More informationIdentification of Representative Protein Sequence and Secondary Structure Prediction Using SVM Approach
Identification of Representative Protein Sequence and Secondary Structure Prediction Using SVM Approach Prof. Dr. M. A. Mottalib, Md. Rahat Hossain Department of Computer Science and Information Technology
More informationAnnouncements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure
Announcements TA Office Hours: Brian Eckenroth Monday 3-4 pm Thursday 11 am-12 pm Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Margaret Daugherty Fall 2003 Homework II posted
More informationarxiv: v1 [cond-mat.soft] 22 Oct 2007
Conformational Transitions of Heteropolymers arxiv:0710.4095v1 [cond-mat.soft] 22 Oct 2007 Michael Bachmann and Wolfhard Janke Institut für Theoretische Physik, Universität Leipzig, Augustusplatz 10/11,
More informationImproved Protein Secondary Structure Prediction
Improved Protein Secondary Structure Prediction Secondary Structure Prediction! Given a protein sequence a 1 a 2 a N, secondary structure prediction aims at defining the state of each amino acid ai as
More informationCopyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years.
Structure Determination and Sequence Analysis The vast majority of the experimentally determined three-dimensional protein structures have been solved by one of two methods: X-ray diffraction and Nuclear
More informationMolecular Modeling lecture 2
Molecular Modeling 2018 -- lecture 2 Topics 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction 4. Where do protein structures come from? X-ray crystallography
More informationSecondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure
Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted
More informationPublic Database 의이용 (1) - SignalP (version 4.1)
Public Database 의이용 (1) - SignalP (version 4.1) 2015. 8. KIST 이철주 Secretion pathway prediction ProteinCenter (Proxeon Bioinformatics, Odense, Denmark; http://www.cbs.dtu.dk/services) SignalP (version 4.1)
More informationSTRUCTURAL BIOINFORMATICS. Barry Grant University of Michigan
STRUCTURAL BIOINFORMATICS Barry Grant University of Michigan www.thegrantlab.org bjgrant@umich.edu Bergen, Norway 28-Sep-2015 Objective: Provide an introduction to the practice of structural bioinformatics,
More informationProtein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds
Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino
More informationUseful background reading
Overview of lecture * General comment on peptide bond * Discussion of backbone dihedral angles * Discussion of Ramachandran plots * Description of helix types. * Description of structures * NMR patterns
More informationBiology Chemistry & Physics of Biomolecules. Examination #1. Proteins Module. September 29, Answer Key
Biology 5357 Chemistry & Physics of Biomolecules Examination #1 Proteins Module September 29, 2017 Answer Key Question 1 (A) (5 points) Structure (b) is more common, as it contains the shorter connection
More informationHIV protease inhibitor. Certain level of function can be found without structure. But a structure is a key to understand the detailed mechanism.
Proteins are linear polypeptide chains (one or more) Building blocks: 20 types of amino acids. Range from a few 10s-1000s They fold into varying three-dimensional shapes structure medicine Certain level
More informationThermophilic organism
Thermophilic organism Thermophiles are organisms that grow and thrive at temperatures (60 80 C) that are often too high for mesophiles most thermophiles are Archaea Some organisms grow at even higher temperatures
More informationProtein Structure Prediction using String Kernels. Technical Report
Protein Structure Prediction using String Kernels Technical Report Department of Computer Science and Engineering University of Minnesota 4-192 EECS Building 200 Union Street SE Minneapolis, MN 55455-0159
More informationReview. Membrane proteins. Membrane transport
Quiz 1 For problem set 11 Q1, you need the equation for the average lateral distance transversed (s) of a molecule in the membrane with respect to the diffusion constant (D) and time (t). s = (4 D t) 1/2
More informationProteins: Structure & Function. Ulf Leser
Proteins: Structure & Function Ulf Leser This Lecture Proteins Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding
More informationThe Structure and Functions of Proteins
Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science and Engineering 2003 The Structure and Functions of Proteins Dan E. Krane Wright State University
More informationProcheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics.
Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics Iosif Vaisman Email: ivaisman@gmu.edu ----------------------------------------------------------------- Bond
More informationModeling for 3D structure prediction
Modeling for 3D structure prediction What is a predicted structure? A structure that is constructed using as the sole source of information data obtained from computer based data-mining. However, mixing
More informationBIOCHEMISTRY Course Outline (Fall, 2011)
BIOCHEMISTRY 402 - Course Outline (Fall, 2011) Number OVERVIEW OF LECTURE TOPICS: of Lectures INSTRUCTOR 1. Structural Components of Proteins G. Brayer (a) Amino Acids and the Polypeptide Chain Backbone...2
More informationProtein 8-class Secondary Structure Prediction Using Conditional Neural Fields
2010 IEEE International Conference on Bioinformatics and Biomedicine Protein 8-class Secondary Structure Prediction Using Conditional Neural Fields Zhiyong Wang, Feng Zhao, Jian Peng, Jinbo Xu* Toyota
More informationBiochemistry - I SPRING Mondays and Wednesdays 9:30-10:45 AM (MR-1307) Lectures 3-4. Based on Profs. Kevin Gardner & Reza Khayat
Biochemistry - I Mondays and Wednesdays 9:30-10:45 AM (MR-1307) SPRING 2017 Lectures 3-4 Based on Profs. Kevin Gardner & Reza Khayat 1 Outline Overview of protein structure Peptide bonds Secondary structure
More informationAccurate Prediction of Protein Disordered Regions by Mining Protein Structure Data
Data Mining and Knowledge Discovery, 11, 213 222, 2005 c 2005 Springer Science + Business Media, Inc. Manufactured in The Netherlands. DOI: 10.1007/s10618-005-0001-y Accurate Prediction of Protein Disordered
More information