1-D Predictions. Prediction of local features: Secondary structure & surface exposure

Size: px
Start display at page:

Download "1-D Predictions. Prediction of local features: Secondary structure & surface exposure"

Transcription

1 1-D Predictions Prediction of local features: Secondary structure & surface exposure 1

2 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local feature terms: Secondary structure Surface accessibility/exposure Transmembrane helix Signal peptide Protein disorder Use different 1-D prediction servers and interpret the results (the exercise). 2

3 Residue Patterns Helices Helix capping Amphiphilic residue patterns C N Sheets Amphiphilic residue patterns Residue preferences at edges vs. middle Special residues Proline Helix breaker Glycine In turns/loops/bends 3

4 1-D predictions Local Structures " Secondary Structure " Trans Membrane Helix Features " Surface Accessibility " Signal Peptides 4

5 Secondary Structure Elements α-helix = H 310-helix = G π-helix = I Extended (ß)-Strand = E Isolated ß-bridge = B Turn = T Bend = S Rest (Coil) = C/. 5

6 Assignment from Structure DSSP ( ) STRIDE ( ) DSSPcont ( ) 6

7 Helices 7

8 Three-State Prediction of Classes Α-helix = H helix = G π-helix = I Extended (ß)-Strand = E Isolated ß-bridge = B Turn = T Bend = S The Rest (Coil) =./C H E C 8

9 Prediction Servers Psi-Pred ( PHDProf Jpred 9

10 PsiPRED PSIPRED PREDICTION RESULTS" " Key" " Conf: Confidence (0=low, 9=high)" Pred: Predicted secondary structure (H=helix, E=strand, C=coil)" AA: Target sequence" " " # PSIPRED HFORMAT (PSIPRED V2.3 by David Jones)" " Conf: " Pred: CCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCHHHHHHH" AA: MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGIL" " " " Conf: " Pred: HHHHHHCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHCCC" AA: GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYS" " " " Conf: " Pred: HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH" AA: AGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV" " " " Conf: " Pred: HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH" AA: LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAY" " " " Conf: " Pred: HHHHCCHHHCCC" AA: QKRMGVQMQRFK" 250" " " Calculate PostScript, PDF and JPEG graphical output for this result using: " 10

11 PsiPred 11

12 Trans-Membrane Helices 12

13 Transmembrane Helix Predictors TMHMM Phobius (Philius) HMMTOP DAS 13

14 Signal Peptide SignalP Phobius Philius 14

15 Prediction Methods Exemplified by Secondary Structure Predictions 15

16 Amino Acid Statistics VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRI!.HHHHHHHHHHHHHHHHS...GGGEEEEEEEEE.SS.EEEEEEETTTTEEEEEEEEEHHHHHHTT.HHHHHHHHHH! Helix Strand Coil VKEFLAKAK! QLDQFDRIK! KKWETPSQN! KEFLAKAKE! LDQFDRIKT! KWETPSQNT! EFLAKAKED! DQFDRIKTL! WETPSQNTA!!.!.!.!.!.!!.!.!.!.!.! 16!.!.!.!.!.!

17 Propensities Helix 17

18 BLOSUM Substitution A R N D C Q E G H I L K M F P S T W Y V B Z X * A R N D C Q E G H I L K M F P S T W Y V

19 Position Specific Substitution Matrices (PSSM) 19

20 PSSM Sequence The 20 amino acid residues A R N D C Q E G H I L K M F P S T W Y V 1 I K E E H V I I Q A E F Y L N P D

21 Neural Networks Benefits Generally applicable Can capture higher order correlations Inputs other than sequence information Drawbacks Needs a lot of data (different solved structures with low sequence identity). Complex methods with several pitfalls. 21

22 Neural Networks (Hidden Layer) Weights 22

23 NetSurfP Prediction of Real Value Solvent Accessibility By Bent Petersen 23

24 Objective Predict residues as being either buried or exposed (25 % threshold) Two states/classes, Buried/Exposed Predict the Relative Solvent Accessibility Real Value 24

25 Why predict RSA? Residues exposed on surface can be: Involved in PTM s Potential antigenic regions Involved in Protein-Protein interactions Prediction of Disease-SNP s 25

26 What is ASA? Accessible Solvent Area, Å 2 Surface area accessible to a rolling water molecule 26

27 RSA RSA = Relative Solvent Accessibility ACC = Accessible area in protein structure ASA = Accessible Surface Area in Gly-X-Gly or Ala-X-Ala Classification networks Real value networks Classification: Buried = RSA < 25 %, Exposed = RSA > 25 %" Real Value: values 0-1, RSA > 1 set to 1" 27

28 Learning / Training dataset Training set: Cull_1764: Max. Seq. ID: 25 % Resolution: 2.0 Å R-Factor: 0.2 Seq. Length AA Excluding non X-ray entries 28

29 Learning / Training dataset Homology reduced against evaluation set CB513 (302 sequences removed) Final Training set: 1764 sequences amino acids Buried: % ( amino acids) Exposed: % ( amino acids) 29

30 Method 30

31 Results - Real Value Prediction Training / Evaluation Train Evaluated Method Ahmad et al. (2003) Not Published 0.48 ANN Yuan and Huang (2004) Not Published 0.52 SVR Nguyen and Rajapakse(2006) Not Published 0.66 Two-Stage SVR Dor and Zhou (2007) Not Published ANN NetSurfP ANN 31

32 NetSurfP /usr/cbs/bio/src/netsurfp/netsurfp -h 32

33 NetSurfP Output 33

34 Protein D iso r d e r Introduction to DisEMBL, IUPred & FoldUnfold 34

35 Protein Folding Initially formed structure is in molten globule state (ensemble). E T Transition state(s), one or more narrow ensembles Molten globule condenses to native fold via transition state. U Unfolded state, ensemble ΔG F Native fold, one structure 35

36 Degrees of Structure 36

37 Structures of Unstructured Regions Estimate: 20% of all proteins contain unstructured regions. 1% of structures in PDB contain unstructured regions. Structural genomics Special structural genomics projects Selection and modification of targets Prediction of crystallisable domains Protein disorder publications in PubMed Iakoucheva & Dunker Structure

38 What s the Fuss About? Properties of Disordered Regions Flexible, i.e. adaptable Accessible Contain Extended Linear Motifs (ELM) Different behaviour in interaction interfaces Very adaptable Many hydrophobic interactions (close packing) No fixed structure without interaction partner Folding upon binding 38

39 DisEMBL Basic notion No consensus on protein disorder definition. Defines three types of disorder The method ANN-based Disorder definitions Loop/Coil (DSSP-assigned residues: T, S, B, I) Hot loops (high B-factor) Missing residues (in X-ray structures, Remark 465 ) 39 Linding et al. Structure 2003

40 DisEMBL Derived propensity scale (implicit) 40

41 DisEMBL Output Ero1-Lα 41

42 IUPred Basic notion: Globular proteins need to make a large number of inter-residue interactions to overcome the loss of entropy upon folding. The method 20 x 20 energy predictor matrix (pairwise interactions). Derived from globular proteins. Quadratic expression in amino acid composition. Definitions Binary definition: Order/disorder Two ranges: long ~ regions/domains Short ~ loops Domain prediction (inverse of long range predictions). 42 Dosztanáyi et al. Bioinformatics 2005

43 IUPred Output Ero1-Lα Position Residue Disorder Tendency 1 E E Q P P

44 FoldUnfold Basic notion Globular proteins need to establish a high number of interactions to compensate for the loss of entropy during the folding process. The method Mean packing density Derived from globular proteins. ANN-based. Definitions Binary definition: Order/disorder Two ranges: Long ~ regions/domains Short ~ loops 44 Galzitskaya et al. Bioinformatics 2006 & Protein Science 2000

45 FoldUnfold Output Ero1-Lα disordered: disordered: disordered: disordered: disordered:

46 Comparison DisEMBL IUPred FoldUnfold Disordered residues:

47 Ero1 example 47

48 Summary: Sequence Analysis Predict properties from sequence Cellular localisation (signal peptides, TM helices, etc.) Secondary structure Identification of flexibillity/disorder/stability etc. Modification sites (phosphorylation, glycosylation, acetylation, etc.) Identification of catalytic residues EPipe An automated tool for sequence comparison Under development 48

49 EPipe Difference Plot AKT1 variants involved in cancer: E17K R25C Alignment seq1 seq2 seq M S D V A I V K E G W L H K R G E Y I K T W R P R Y F L L K N D G T F I G Y K E R P Q D V D Q R E A P L M S D V A I V K E G W L H K R G K Y I K T W R P R Y F L L K N D G T F I G Y K E R P Q D V D Q R E A P L M S D V A I V K E G W L H K R G E Y I K T W R P C Y F L L K N D G T F I G Y K E R P Q D V D Q R E A P L NetSurfP Pfam IUpred PSIPRED Blicher et al. Protein annotation in the era of personal genomics, Curr Opin Struct Biol (2010).

50 Links DisEMBL: IUPred: FoldUnfold 50

51 Exercise Step

IT og Sundhed 2010/11

IT og Sundhed 2010/11 IT og Sundhed 2010/11 Sequence based predictors. Secondary structure and surface accessibility Bent Petersen 13 January 2011 1 NetSurfP Real Value Solvent Accessibility predictions with amino acid associated

More information

SCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like

SCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like SCOP all-β class 4-helical cytokines T4 endonuclease V all-α class, 3 different folds Globin-like TIM-barrel fold α/β class Profilin-like fold α+β class http://scop.mrc-lmb.cam.ac.uk/scop CATH Class, Architecture,

More information

Protein structure alignments

Protein structure alignments Protein structure alignments Proteins that fold in the same way, i.e. have the same fold are often homologs. Structure evolves slower than sequence Sequence is less conserved than structure If BLAST gives

More information

SUPPLEMENTARY MATERIALS

SUPPLEMENTARY MATERIALS SUPPLEMENTARY MATERIALS Enhanced Recognition of Transmembrane Protein Domains with Prediction-based Structural Profiles Baoqiang Cao, Aleksey Porollo, Rafal Adamczak, Mark Jarrell and Jaroslaw Meller Contact:

More information

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL

More information

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK

More information

Introduction to" Protein Structure

Introduction to Protein Structure Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.

More information

Bioinformatics Practical for Biochemists

Bioinformatics Practical for Biochemists Bioinformatics Practical for Biochemists Andrei Lupas, Birte Höcker, Steffen Schmidt WS 2013/14 03. Sequence Features Targeting proteins signal peptide targets proteins to the secretory pathway N-terminal

More information

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this

More information

Introduction to Comparative Protein Modeling. Chapter 4 Part I

Introduction to Comparative Protein Modeling. Chapter 4 Part I Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature

More information

Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics

Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia

More information

Basics of protein structure

Basics of protein structure Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu

More information

THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION

THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION AND CALIBRATION Calculation of turn and beta intrinsic propensities. A statistical analysis of a protein structure

More information

Bioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction. Sepp Hochreiter

Bioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction. Sepp Hochreiter Bioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction Institute of Bioinformatics Johannes Kepler University, Linz, Austria Chapter 4 Protein Secondary

More information

PROTEIN SECONDARY STRUCTURE PREDICTION: AN APPLICATION OF CHOU-FASMAN ALGORITHM IN A HYPOTHETICAL PROTEIN OF SARS VIRUS

PROTEIN SECONDARY STRUCTURE PREDICTION: AN APPLICATION OF CHOU-FASMAN ALGORITHM IN A HYPOTHETICAL PROTEIN OF SARS VIRUS Int. J. LifeSc. Bt & Pharm. Res. 2012 Kaladhar, 2012 Research Paper ISSN 2250-3137 www.ijlbpr.com Vol.1, Issue. 1, January 2012 2012 IJLBPR. All Rights Reserved PROTEIN SECONDARY STRUCTURE PREDICTION:

More information

BIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer Protein Structure Prediction I

BIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer Protein Structure Prediction I BIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer 2013 9. Protein Structure Prediction I Structure Prediction Overview Overview of problem variants Secondary structure prediction

More information

Week 10: Homology Modelling (II) - HHpred

Week 10: Homology Modelling (II) - HHpred Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative

More information

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings

More information

Bioinformatics: Secondary Structure Prediction

Bioinformatics: Secondary Structure Prediction Bioinformatics: Secondary Structure Prediction Prof. David Jones d.t.jones@ucl.ac.uk Possibly the greatest unsolved problem in molecular biology: The Protein Folding Problem MWMPPRPEEVARK LRRLGFVERMAKG

More information

Advanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions

Advanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start

More information

Physiochemical Properties of Residues

Physiochemical Properties of Residues Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)

More information

Bioinformatics: Secondary Structure Prediction

Bioinformatics: Secondary Structure Prediction Bioinformatics: Secondary Structure Prediction Prof. David Jones d.jones@cs.ucl.ac.uk LMLSTQNPALLKRNIIYWNNVALLWEAGSD The greatest unsolved problem in molecular biology:the Protein Folding Problem? Entries

More information

Protein Secondary Structure Assignment and Prediction

Protein Secondary Structure Assignment and Prediction 1 Protein Secondary Structure Assignment and Prediction Defining SS features - Dihedral angles, alpha helix, beta stand (Hydrogen bonds) Assigned manually by crystallographers or Automatic DSSP (Kabsch

More information

Supersecondary Structures (structural motifs)

Supersecondary Structures (structural motifs) Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric

More information

Protein quality assessment

Protein quality assessment Protein quality assessment Speaker: Renzhi Cao Advisor: Dr. Jianlin Cheng Major: Computer Science May 17 th, 2013 1 Outline Introduction Paper1 Paper2 Paper3 Discussion and research plan Acknowledgement

More information

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748 CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr

More information

Protein Structures: Experiments and Modeling. Patrice Koehl

Protein Structures: Experiments and Modeling. Patrice Koehl Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:

More information

Details of Protein Structure

Details of Protein Structure Details of Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Anne Mølgaard, Kemisk Institut, Københavns Universitet Learning Objectives

More information

Protein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods

Protein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods Cell communication channel Bioinformatics Methods Iosif Vaisman Email: ivaisman@gmu.edu SEQUENCE STRUCTURE DNA Sequence Protein Sequence Protein Structure Protein structure ATGAAATTTGGAAACTTCCTTCTCACTTATCAGCCACCT...

More information

Sequence analysis and comparison

Sequence analysis and comparison The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species

More information

Protein Structure Prediction and Display

Protein Structure Prediction and Display Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each

More information

BCB 444/544 Fall 07 Dobbs 1

BCB 444/544 Fall 07 Dobbs 1 BCB 444/544 Lecture 21 Protein Structure Visualization, Classification & Comparison Secondary Structure #21_Oct10 Required Reading (before lecture) Mon Oct 8 - Lecture 20 Protein Secondary Structure Chp

More information

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure

More information

Introduction to Computational Structural Biology

Introduction to Computational Structural Biology Introduction to Computational Structural Biology Part I 1. Introduction The disciplinary character of Computational Structural Biology The mathematical background required and the topics covered Bibliography

More information

Protein Secondary Structure Prediction

Protein Secondary Structure Prediction Protein Secondary Structure Prediction Doug Brutlag & Scott C. Schmidler Overview Goals and problem definition Existing approaches Classic methods Recent successful approaches Evaluating prediction algorithms

More information

Packing of Secondary Structures

Packing of Secondary Structures 7.88 Lecture Notes - 4 7.24/7.88J/5.48J The Protein Folding and Human Disease Professor Gossard Retrieving, Viewing Protein Structures from the Protein Data Base Helix helix packing Packing of Secondary

More information

D Dobbs ISU - BCB 444/544X 1

D Dobbs ISU - BCB 444/544X 1 11/7/05 Protein Structure: Classification, Databases, Visualization Announcements BCB 544 Projects - Important Dates: Nov 2 Wed noon - Project proposals due to David/Drena Nov 4 Fri PM - Approvals/responses

More information

Motif Prediction in Amino Acid Interaction Networks

Motif Prediction in Amino Acid Interaction Networks Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions

More information

Protein Structure Basics

Protein Structure Basics Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes

More information

Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture - 06 Protein Structure IV

Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture - 06 Protein Structure IV Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur Lecture - 06 Protein Structure IV We complete our discussion on Protein Structures today. And just to recap

More information

Outline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins

Outline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2003 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets

More information

Lecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ].

Lecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ]. Lecture 26: Polymers: DA Packing and Protein folding 26.1 Problem Set 4 due today. eading for Lectures 22 24: PKT hapter 8 DA Packing for Eukaryotes: The packing problem for the larger eukaryotic genomes

More information

Outline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins

Outline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2004 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets

More information

Can protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU

Can protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU Can protein model accuracy be identified? Morten Nielsen, CBS, BioCentrum, DTU NO! Identification of Protein-model accuracy Why is it important? What is accuracy RMSD, fraction correct, Protein model correctness/quality

More information

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its

More information

BCH 4053 Spring 2003 Chapter 6 Lecture Notes

BCH 4053 Spring 2003 Chapter 6 Lecture Notes BCH 4053 Spring 2003 Chapter 6 Lecture Notes 1 CHAPTER 6 Proteins: Secondary, Tertiary, and Quaternary Structure 2 Levels of Protein Structure Primary (sequence) Secondary (ordered structure along peptide

More information

Protein Structure. W. M. Grogan, Ph.D. OBJECTIVES

Protein Structure. W. M. Grogan, Ph.D. OBJECTIVES Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate

More information

Improving Protein Secondary-Structure Prediction by Predicting Ends of Secondary-Structure Segments

Improving Protein Secondary-Structure Prediction by Predicting Ends of Secondary-Structure Segments Improving Protein Secondary-Structure Prediction by Predicting Ends of Secondary-Structure Segments Uros Midic 1 A. Keith Dunker 2 Zoran Obradovic 1* 1 Center for Information Science and Technology Temple

More information

CAP 5510 Lecture 3 Protein Structures

CAP 5510 Lecture 3 Protein Structures CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity

More information

We used the PSI-BLAST program (http://www.ncbi.nlm.nih.gov/blast/) to search the

We used the PSI-BLAST program (http://www.ncbi.nlm.nih.gov/blast/) to search the SUPPLEMENTARY METHODS - in silico protein analysis We used the PSI-BLAST program (http://www.ncbi.nlm.nih.gov/blast/) to search the Protein Data Bank (PDB, http://www.rcsb.org/pdb/) and the NCBI non-redundant

More information

Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability

Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Part I. Review of forces Covalent bonds Non-covalent Interactions: Van der Waals Interactions

More information

09/06/25. Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Non-uniform distribution of folds. Scheme of protein structure predicition

09/06/25. Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Non-uniform distribution of folds. Scheme of protein structure predicition Sequence identity Structural similarity Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Fold recognition Sommersemester 2009 Peter Güntert Structural similarity X Sequence identity Non-uniform

More information

Protein Secondary Structure Prediction

Protein Secondary Structure Prediction part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 the goal is the prediction of the secondary structure conformation which is local each amino

More information

Protein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.

Protein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small

More information

Analysis and Prediction of Protein Structure (I)

Analysis and Prediction of Protein Structure (I) Analysis and Prediction of Protein Structure (I) Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 2006 Free for academic use. Copyright @ Jianlin Cheng

More information

DATE A DAtabase of TIM Barrel Enzymes

DATE A DAtabase of TIM Barrel Enzymes DATE A DAtabase of TIM Barrel Enzymes 2 2.1 Introduction.. 2.2 Objective and salient features of the database 2.2.1 Choice of the dataset.. 2.3 Statistical information on the database.. 2.4 Features....

More information

Protein Secondary Structure Prediction

Protein Secondary Structure Prediction C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 7 Protein Secondary Structure Prediction Protein primary

More information

Steps in protein modelling. Structure prediction, fold recognition and homology modelling. Basic principles of protein structure

Steps in protein modelling. Structure prediction, fold recognition and homology modelling. Basic principles of protein structure Structure prediction, fold recognition and homology modelling Marjolein Thunnissen Lund September 2012 Steps in protein modelling 3-D structure known Comparative Modelling Sequence of interest Similarity

More information

Proceedings of the 22nd International Workshop on Database and Expert Systems Applications (2011), 70-74

Proceedings of the 22nd International Workshop on Database and Expert Systems Applications (2011), 70-74 Novel Application of Query-Based Qualitative Predictors for Characterization of Solvent Accessible Residues in Conjunction with Protein Sequence Homology Proceedings of the 22nd International Workshop

More information

4 Proteins: Structure, Function, Folding W. H. Freeman and Company

4 Proteins: Structure, Function, Folding W. H. Freeman and Company 4 Proteins: Structure, Function, Folding 2013 W. H. Freeman and Company CHAPTER 4 Proteins: Structure, Function, Folding Learning goals: Structure and properties of the peptide bond Structural hierarchy

More information

Bayesian Models and Algorithms for Protein Beta-Sheet Prediction

Bayesian Models and Algorithms for Protein Beta-Sheet Prediction 0 Bayesian Models and Algorithms for Protein Beta-Sheet Prediction Zafer Aydin, Student Member, IEEE, Yucel Altunbasak, Senior Member, IEEE, and Hakan Erdogan, Member, IEEE Abstract Prediction of the three-dimensional

More information

ALL LECTURES IN SB Introduction

ALL LECTURES IN SB Introduction 1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL

More information

Bio nformatics. Lecture 23. Saad Mneimneh

Bio nformatics. Lecture 23. Saad Mneimneh Bio nformatics Lecture 23 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely

More information

Lecture 7. Protein Secondary Structure Prediction. Secondary Structure DSSP. Master Course DNA/Protein Structurefunction.

Lecture 7. Protein Secondary Structure Prediction. Secondary Structure DSSP. Master Course DNA/Protein Structurefunction. C N T R F O R N T G R A T V B O N F O R M A T C S V U Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 7 Protein Secondary Structure Prediction Protein primary structure 20 amino

More information

Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27

Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27 Acta Cryst. (2014). D70, doi:10.1107/s1399004714021695 Supporting information Volume 70 (2014) Supporting information for article: Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase

More information

Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013

Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013 Hydration of protein-rna recognition sites Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India 1 st November, 2013 Central Dogma of life DNA

More information

CMPS 3110: Bioinformatics. Tertiary Structure Prediction

CMPS 3110: Bioinformatics. Tertiary Structure Prediction CMPS 3110: Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the laws of physics! Conformation space is finite

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction CMPS 6630: Introduction to Computational Biology and Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the

More information

Protein folding. α-helix. Lecture 21. An α-helix is a simple helix having on average 10 residues (3 turns of the helix)

Protein folding. α-helix. Lecture 21. An α-helix is a simple helix having on average 10 residues (3 turns of the helix) Computat onal Biology Lecture 21 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely

More information

Optimization of the Sliding Window Size for Protein Structure Prediction

Optimization of the Sliding Window Size for Protein Structure Prediction Optimization of the Sliding Window Size for Protein Structure Prediction Ke Chen* 1, Lukasz Kurgan 1 and Jishou Ruan 2 1 University of Alberta, Department of Electrical and Computer Engineering, Edmonton,

More information

Biomolecules: lecture 10

Biomolecules: lecture 10 Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet

More information

Protein Secondary Structure Prediction using Feed-Forward Neural Network

Protein Secondary Structure Prediction using Feed-Forward Neural Network COPYRIGHT 2010 JCIT, ISSN 2078-5828 (PRINT), ISSN 2218-5224 (ONLINE), VOLUME 01, ISSUE 01, MANUSCRIPT CODE: 100713 Protein Secondary Structure Prediction using Feed-Forward Neural Network M. A. Mottalib,

More information

Heteropolymer. Mostly in regular secondary structure

Heteropolymer. Mostly in regular secondary structure Heteropolymer - + + - Mostly in regular secondary structure 1 2 3 4 C >N trace how you go around the helix C >N C2 >N6 C1 >N5 What s the pattern? Ci>Ni+? 5 6 move around not quite 120 "#$%&'!()*(+2!3/'!4#5'!1/,#64!#6!,6!

More information

Getting To Know Your Protein

Getting To Know Your Protein Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research

More information

3D Structure. Prediction & Assessment Pt. 2. David Wishart 3-41 Athabasca Hall

3D Structure. Prediction & Assessment Pt. 2. David Wishart 3-41 Athabasca Hall 3D Structure Prediction & Assessment Pt. 2 David Wishart 3-41 Athabasca Hall david.wishart@ualberta.ca Objectives Become familiar with methods and algorithms for secondary Structure Prediction Become familiar

More information

Biotechnology of Proteins. The Source of Stability in Proteins (III) Fall 2015

Biotechnology of Proteins. The Source of Stability in Proteins (III) Fall 2015 Biotechnology of Proteins The Source of Stability in Proteins (III) Fall 2015 Conformational Entropy of Unfolding It is The factor that makes the greatest contribution to stabilization of the unfolded

More information

Identification of Representative Protein Sequence and Secondary Structure Prediction Using SVM Approach

Identification of Representative Protein Sequence and Secondary Structure Prediction Using SVM Approach Identification of Representative Protein Sequence and Secondary Structure Prediction Using SVM Approach Prof. Dr. M. A. Mottalib, Md. Rahat Hossain Department of Computer Science and Information Technology

More information

Announcements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure

Announcements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Announcements TA Office Hours: Brian Eckenroth Monday 3-4 pm Thursday 11 am-12 pm Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Margaret Daugherty Fall 2003 Homework II posted

More information

arxiv: v1 [cond-mat.soft] 22 Oct 2007

arxiv: v1 [cond-mat.soft] 22 Oct 2007 Conformational Transitions of Heteropolymers arxiv:0710.4095v1 [cond-mat.soft] 22 Oct 2007 Michael Bachmann and Wolfhard Janke Institut für Theoretische Physik, Universität Leipzig, Augustusplatz 10/11,

More information

Improved Protein Secondary Structure Prediction

Improved Protein Secondary Structure Prediction Improved Protein Secondary Structure Prediction Secondary Structure Prediction! Given a protein sequence a 1 a 2 a N, secondary structure prediction aims at defining the state of each amino acid ai as

More information

Copyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years.

Copyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years. Structure Determination and Sequence Analysis The vast majority of the experimentally determined three-dimensional protein structures have been solved by one of two methods: X-ray diffraction and Nuclear

More information

Molecular Modeling lecture 2

Molecular Modeling lecture 2 Molecular Modeling 2018 -- lecture 2 Topics 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction 4. Where do protein structures come from? X-ray crystallography

More information

Secondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure

Secondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted

More information

Public Database 의이용 (1) - SignalP (version 4.1)

Public Database 의이용 (1) - SignalP (version 4.1) Public Database 의이용 (1) - SignalP (version 4.1) 2015. 8. KIST 이철주 Secretion pathway prediction ProteinCenter (Proxeon Bioinformatics, Odense, Denmark; http://www.cbs.dtu.dk/services) SignalP (version 4.1)

More information

STRUCTURAL BIOINFORMATICS. Barry Grant University of Michigan

STRUCTURAL BIOINFORMATICS. Barry Grant University of Michigan STRUCTURAL BIOINFORMATICS Barry Grant University of Michigan www.thegrantlab.org bjgrant@umich.edu Bergen, Norway 28-Sep-2015 Objective: Provide an introduction to the practice of structural bioinformatics,

More information

Protein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds

Protein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino

More information

Useful background reading

Useful background reading Overview of lecture * General comment on peptide bond * Discussion of backbone dihedral angles * Discussion of Ramachandran plots * Description of helix types. * Description of structures * NMR patterns

More information

Biology Chemistry & Physics of Biomolecules. Examination #1. Proteins Module. September 29, Answer Key

Biology Chemistry & Physics of Biomolecules. Examination #1. Proteins Module. September 29, Answer Key Biology 5357 Chemistry & Physics of Biomolecules Examination #1 Proteins Module September 29, 2017 Answer Key Question 1 (A) (5 points) Structure (b) is more common, as it contains the shorter connection

More information

HIV protease inhibitor. Certain level of function can be found without structure. But a structure is a key to understand the detailed mechanism.

HIV protease inhibitor. Certain level of function can be found without structure. But a structure is a key to understand the detailed mechanism. Proteins are linear polypeptide chains (one or more) Building blocks: 20 types of amino acids. Range from a few 10s-1000s They fold into varying three-dimensional shapes structure medicine Certain level

More information

Thermophilic organism

Thermophilic organism Thermophilic organism Thermophiles are organisms that grow and thrive at temperatures (60 80 C) that are often too high for mesophiles most thermophiles are Archaea Some organisms grow at even higher temperatures

More information

Protein Structure Prediction using String Kernels. Technical Report

Protein Structure Prediction using String Kernels. Technical Report Protein Structure Prediction using String Kernels Technical Report Department of Computer Science and Engineering University of Minnesota 4-192 EECS Building 200 Union Street SE Minneapolis, MN 55455-0159

More information

Review. Membrane proteins. Membrane transport

Review. Membrane proteins. Membrane transport Quiz 1 For problem set 11 Q1, you need the equation for the average lateral distance transversed (s) of a molecule in the membrane with respect to the diffusion constant (D) and time (t). s = (4 D t) 1/2

More information

Proteins: Structure & Function. Ulf Leser

Proteins: Structure & Function. Ulf Leser Proteins: Structure & Function Ulf Leser This Lecture Proteins Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding

More information

The Structure and Functions of Proteins

The Structure and Functions of Proteins Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science and Engineering 2003 The Structure and Functions of Proteins Dan E. Krane Wright State University

More information

Procheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics.

Procheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics. Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics Iosif Vaisman Email: ivaisman@gmu.edu ----------------------------------------------------------------- Bond

More information

Modeling for 3D structure prediction

Modeling for 3D structure prediction Modeling for 3D structure prediction What is a predicted structure? A structure that is constructed using as the sole source of information data obtained from computer based data-mining. However, mixing

More information

BIOCHEMISTRY Course Outline (Fall, 2011)

BIOCHEMISTRY Course Outline (Fall, 2011) BIOCHEMISTRY 402 - Course Outline (Fall, 2011) Number OVERVIEW OF LECTURE TOPICS: of Lectures INSTRUCTOR 1. Structural Components of Proteins G. Brayer (a) Amino Acids and the Polypeptide Chain Backbone...2

More information

Protein 8-class Secondary Structure Prediction Using Conditional Neural Fields

Protein 8-class Secondary Structure Prediction Using Conditional Neural Fields 2010 IEEE International Conference on Bioinformatics and Biomedicine Protein 8-class Secondary Structure Prediction Using Conditional Neural Fields Zhiyong Wang, Feng Zhao, Jian Peng, Jinbo Xu* Toyota

More information

Biochemistry - I SPRING Mondays and Wednesdays 9:30-10:45 AM (MR-1307) Lectures 3-4. Based on Profs. Kevin Gardner & Reza Khayat

Biochemistry - I SPRING Mondays and Wednesdays 9:30-10:45 AM (MR-1307) Lectures 3-4. Based on Profs. Kevin Gardner & Reza Khayat Biochemistry - I Mondays and Wednesdays 9:30-10:45 AM (MR-1307) SPRING 2017 Lectures 3-4 Based on Profs. Kevin Gardner & Reza Khayat 1 Outline Overview of protein structure Peptide bonds Secondary structure

More information

Accurate Prediction of Protein Disordered Regions by Mining Protein Structure Data

Accurate Prediction of Protein Disordered Regions by Mining Protein Structure Data Data Mining and Knowledge Discovery, 11, 213 222, 2005 c 2005 Springer Science + Business Media, Inc. Manufactured in The Netherlands. DOI: 10.1007/s10618-005-0001-y Accurate Prediction of Protein Disordered

More information