CAP 5510 Lecture 3 Protein Structures
|
|
- Adam Fleming
- 6 years ago
- Views:
Transcription
1 CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1
2 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2
3 Protein Conformational Structures Hydrophobicity (lack affinity to water), hydrogen bonding, handedness, and tension between hierarchy and interactions (electrostatic and van der Waals), a protein structure is a complex geometric pattern of polypeptide, side chains, and the solvent environment. The protein in solvent has the conformation of minimum free energy. Molecular dynamics of the potential energy with some nonlinear force terms gives the conformation structure. 8/19/2005 Su-Shing Chen, CISE 3
4 Bond Distance d O C Bond Angle Φ (Carbonyl) Φ Cα (α Carbon) H Torsion Angle Ψ N (Nitrogen) d Ψ (Hydrogen) Geometric Features C n-1 O n-1 Cα n-1 8/19/2005 Su-Shing Chen, CISE 4
5 COOH (Carbonyl group) H 2 N Cα H (amino group) R (side chain) Basic structure of an amino acid 8/19/2005 Su-Shing Chen, CISE 5
6 Secondary Structures Alpha helix repeated curvature (bond) and torsion φ, ψ angles, repeating patterns of hydrogen bonding between CO of residue n and NH of residue n+4. Beta sheet repeating patterns of hydrogen bonding between distant parts of the backbone. Random coil 8/19/2005 Su-Shing Chen, CISE 6
7 Secondary Structures 8/19/2005 Su-Shing Chen, CISE 7
8 Structure Databases 3-D biomolecular structures of protein amino acid sequences. 3-D structures are determined by X-ray crystallography and nuclear magnetic resonance (NMR). Protein folding is a grand challenge problem: A primary protein sequence determines its 3-D structure Anfinsen et al /19/2005 Su-Shing Chen, CISE 8
9 How to Form 3-D Structures Start from the NH 2 terminus, we identify each amino acid side chain by comparing the atomic structure of each residue with the chemical structure of the 20 amino acids. Each atom has x,y,z coordinate, together a ball-and-stick structure is formed. A chemical graph of chemical data associated with the ball-and-stick model. 8/19/2005 Su-Shing Chen, CISE 9
10 Atoms, Bonds and Energy The bond length: average length of a stable X-X bond is about? angstroms. The bond (curvature) angle Φ = κ The torsion angle Ψ=τ Potential Energy = (1/2) Σ c d (d-d 0 ) 2 + (1/2) Σ c κ (κ κ 0 ) 2 + (1/2) Σ c τ (1+cos(nτδ) + Σ (Α/r 12 Β/r 6 + q 1 q 2 /Dr). 8/19/2005 Su-Shing Chen, CISE 10
11 RMSE (Root Mean Square Error) Similarity measure of 3-D structures. X = {(x 1, y 1, z 1 ),, (x n, y n, z n )} X = {(x 1, y 1, z 1 ),, (x n, y n, z n )} R(X,X ) = squareroot Σ (x i -x i ) 2 +(y i - y i ) 2 +(z i -z i ) 2 R(X,X ) = squareroot Σ (d i -d i ) 2 +(κ i -κ i ) 2 +(τ i -τ i ) 2 8/19/2005 Su-Shing Chen, CISE 11
12 Inverse Protein Folding - Threading Find amino acid sequences folding into a known 3-D structure. Sequence similarities > 30 %. Profile method: Compatible environments: area of buried residue inaccessible to solvent, side chains of polar O, N atoms, local secondary structures. 8/19/2005 Su-Shing Chen, CISE 12
13 Protein Superfamilies & Domain Superfolds Many protein structures are similar. Protein domains of more than 30% sequence similarity adopt the same fold structure. Some proteins with statistically insignificant sequence similarity have similar fold. Dayhoff: Families > 50% similarity, superfamilies > 30-40% similarity. 8/19/2005 Su-Shing Chen, CISE 13
14 8/19/2005 Su-Shing Chen, CISE 14
15 Geometric Features of Proteins S. Chen, Characterizing and learning of protein conformations, A set of points P(i) on the backbone. A right handed orthonormal basis.{ti, Ni, Bi}. Ti is the (tangent) vector P(i)P(i+1). The binormal vector is Bi=Ti-1xTi/ Ti- 1xTi, normal to the plane P(i-1), P(i), P(i+1). The normal is Ni=BiXTi. The curvature ki is the angle between Ti-1 and Ti. The torsion is Bi and Bi+1. 8/19/2005 Su-Shing Chen, CISE 15
16 P(i+1) Ti P(i) Ti+1 P(i+2) Ni+1 Bi+1 8/19/2005 Su-Shing Chen, CISE 16
17 Motivations to Study Protein Structures Proteins are interesting to look at! Gene-sequencing projects are accumulating gene data and protein sequences at a rapid rate. However information about their structure is available for only a small fraction. Understanding them might help reduce this gap. 8/19/2005 Su-Shing Chen, CISE 17
18 Secondary Structures Prediction Protein structure prediction is one of the most significant tasks tackled in computational structural biology. It has the aim of determining the threedimensional structure of proteins from their amino acid sequences. In more formal terms, this is the prediction of protein tertiary structure from primary structure. Protein structure is a valuable resource in drug design and is an highly active field of research. The output of experimentally determined protein structures, typically by time-consuming and relatively expensive X-ray crystallography or NMR spectroscopy, is lagging far behind the output of protein sequences 8/19/2005 Su-Shing Chen, CISE 18
19 Chou-Fasman Based on frequencies of residues in alpha helices, beta sheets and turns. Accuracy 50-60% 8/19/2005 Su-Shing Chen, CISE 19
20 Chou-Fasman 8/19/2005 Su-Shing Chen, CISE 20
21 Chou-Fasman Assign Pij values 1. Assign all of the residues the appropriate set of parameters T S P T A E L M R S T G P(H) P(E) P(turn) /19/2005 Su-Shing Chen, CISE 21
22 Chou-Fasman Scan peptide for α helix regions Identify regions where 4/6 have a P(H) >100 alpha-helix nucleus T S P T A E L M R S T G P(H) T S P T A E L M R S T G P(H) /19/2005 Su-Shing Chen, CISE 22
23 Chou-Fasman Extend α-helix nucleus Extend helix in both directions until a set of four residues have an average P(H) <100. Repeat steps 1 3 for entire peptide T S P T A E L M R S T G P(H) /19/2005 Su-Shing Chen, CISE 23
24 Chou-Fasman Scan peptide for β-sheet regions Identify regions where 3/5 have a P(E) >100 b-sheet nucleus Extend b-sheet until 4 continuous residues an have an average P(E) < 100 T S P T A E L M R S T G P(H) P(E) If region average > 105 and the average P(E) > average P(H) then b-sheet 8/19/2005 Su-Shing Chen, CISE 24
25 Chou-Fasman To identify a bend at residue number j, calculate the following value p(t) = f(j)f(j+1)f(j+2)f(j+3) where the f(j+1) value for the j+1 residue is used, the f(j+2) value for the j+2 residue is used and the f(j+3) value for the j+3 residue is used. If: (1) p(t) > ; (2) the average value for P(turn) > 1.00 in the tetrapeptide; and (3) the averages for the tetrapeptide obey the inequality P(a-helix) < P(turn) > P(bsheet), then a beta-turn is predicted at that location 8/19/2005 Su-Shing Chen, CISE 25
26 Comparative (homolog) Modeling Homology modeling is based on the reasonable assumption that two homologous proteins will share very similar structures. Given the amino acid sequence of a unknown structure and the solved structure of a homologous protein, each amino acid in the solved structure is mutated, computationally, into the corresponding amino acid from the unknown structure. 8/19/2005 Su-Shing Chen, CISE 26
27 Comparative (homology) Modeling 8/19/2005 Su-Shing Chen, CISE 27
28 Homology Modeling In homology modeling the over all fold of a protein is known. The goal is to try to predict the detailed conformation of a protein given a homologous protein Comparative ("homology") modeling approximates the 3D structure of a target protein for which only the sequence is available, provided an empirical 3D "template" structure is available with >30% sequence identity Suppose you want to know the 3D structure of a target protein that has not been solved empirically by X-ray crystallography or NMR. You have only the sequence. If an empirically determined 3D structure is available for a sufficiently similar protein (50% or better sequence identity would be good), you can use software that arranges the backbone of your sequence identically to this template. This is called "comparative modeling" or "homology modeling". It is, at best, moderately accurate for the positions of alpha carbons in the 3D structure, in regions where the sequence identity is high. It is inaccurate for the details of sidechain positions, and for inserted loops with no matching sequence in the solved structure. 8/19/2005 Su-Shing Chen, CISE 28
29 SWISS-PDB Viewer 8/19/2005 Su-Shing Chen, CISE 29
30 Protein Threading Protein threading scans the amino acid sequence of a unknown structure against a database of solved structures. In each case, a scoring function is used to assess the compatibility of the sequence to the structure, thus yielding possible three-dimensional models. Its possible that two protein have less than 25% pairwise sequence identity but however have similar protein structure. In these cases remote homology modelling is required. 8/19/2005 Su-Shing Chen, CISE 30
31 Protein Threading The algorithm starts with target protein sequence aligned with SWISS-PORT protein sequences. The resulting multiple sequence is converted into a 1D structural profile. So the amino acid sequences now been translated into a 1D string of structure symbols. Now the idea is to find a 3D fold that is similar to our structure. Finally, predicted and observed 1D structure profiles were optimally aligned by a dynamic programming algorithm The best hit of the alignment procedure is recorded and a 3D model is build from there. 8/19/2005 Su-Shing Chen, CISE 31
32 Protein Threading 8/19/2005 Su-Shing Chen, CISE 32
33 Protein Threading 8/19/2005 Su-Shing Chen, CISE 33
34 Ab Intito Folding Researchers have pursued the problem of predicting three-dimensional protein structure only from the amino acid sequence Ab initio folding is based on the global optimization of a potential energy function and in general does not use knowledge of experimentally determined protein structures. Present ab initio folding methods require intense and exhaustive computing time, which increases as a function of the length of the protein. This limitation is due in part to the assumption that the initial condition for the ab initio folding protein is the linear sequence of residues comprising the protein as encoded by the gene. It is also due to optimizing based on all atom potential energy functions and the use of suboptimal global optimization techniques 8/19/2005 Su-Shing Chen, CISE 34
35 Prediction of transmembrane proteins transmembrane proteins - the polypeptide chain actually traverses the lipid bilayer. 8/19/2005 Su-Shing Chen, CISE 35
36 Why are they important Membrane proteins are important for several processes and functions in all biological systems Receptors for neurotransmitters or hormones Form ion channels Serve as the respiratory chain Nearly 30% of known proteins are membrane bound 8/19/2005 Su-Shing Chen, CISE 36
37 Why Is Prediction Of Transmembrane Regions Important? Bad News Even though X-Ray crystallography is becoming more popular transmembrane proteins are very difficult to crystallize Good News It is commonly accepted that topology prediction of transmembrane proteins is easier and yields higher accuracy than the prediction of the secondary structure of globular proteins 8/19/2005 Su-Shing Chen, CISE 37
38 Properties Of A Membrane Protein Traverses the lipid bi-layer once or several times Generally possess sequences of hydrophobic residues α-helical transmembrane structure Typically 17 to 25 residues in length 8/19/2005 Su-Shing Chen, CISE 38
39 Brief Transmembrane Prediction History Cell membrane is a lipid nonpolor layer First attempts used this information to label sequences of non-polar residues as potential transmembrane regions Accuracy was increased by considering the charge distribution between inside the cell and outside the cell segments Environment in the cell different from outside the cell Prediction using neural nets Using HMM (Hidden Markov Model) 8/19/2005 Su-Shing Chen, CISE 39
40 Polar and nonpolar amino acids 8/19/2005 Su-Shing Chen, CISE 40
41 Neural Networks The network attempts to determine the next state given the current state and input. This approach is recursive because the state calculated is used in the next step as the previous state for the network. The choice of neural networks as the empirical learning system on which to build was made for a couple of reasons. One basic reason is that networks provide a very general mechanism for representing concepts. A neural network, given the proper number of hidden units and hidden layers, can learn almost any type of concept. A second reason for using neural networks is that they generally deal very well with noisy and incorrect data. limitations of neural networks, one basic problem is how to go about selecting the topology of the network 8/19/2005 Su-Shing Chen, CISE 41
42 Example 8/19/2005 Su-Shing Chen, CISE 42
43 Neural Network for Protein Structure Prediction 8/19/2005 Su-Shing Chen, CISE 43
44 Hidden Markov Model Widely used in bioinformatics Sequence alignment, generating profiles for protein families and database searching Can be tailored to particular problems Any known structural knowledge can be incorporated into the models architecture in order to obtain a more accurate prediction A set of states, rules for changing states, and probabilities of state transitions 8/19/2005 Su-Shing Chen, CISE 44
45 HMM Architecture 8/19/2005 Su-Shing Chen, CISE 45
46 Parameters Of The Model Fixed Length Sequences Helix Length Min 17 and Max 25 residues Tail Length Min 1 and Max 15 Residues Train HMM 8/19/2005 Su-Shing Chen, CISE 46
47 HMM By defining states for transmembrane helix residues and other states for residues in loops, residues on either side of the membrane, and connecting them in a cycle, we can produce a model that in architecture closely resembles the biological system we are modelling. If the model parameters are tuned to capture the biological reality, the path of a protein sequence through the states with the highest probability should be able to predict the true topology. 8/19/2005 Su-Shing Chen, CISE 47
48 HMM Results 8/19/2005 Su-Shing Chen, CISE 48
49 Problem Studied in Earlier Classes 8/19/2005 Su-Shing Chen, CISE 49
50 No structures for Cellulose Synthase 8/19/2005 Su-Shing Chen, CISE 50
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationStatistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics
Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia
More informationProtein Structures. 11/19/2002 Lecture 24 1
Protein Structures 11/19/2002 Lecture 24 1 All 3 figures are cartoons of an amino acid residue. 11/19/2002 Lecture 24 2 Peptide bonds in chains of residues 11/19/2002 Lecture 24 3 Angles φ and ψ in the
More informationNeural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha
Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this
More informationMolecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007
Molecular Modeling Prediction of Protein 3D Structure from Sequence Vimalkumar Velayudhan Jain Institute of Vocational and Advanced Studies May 21, 2007 Vimalkumar Velayudhan Molecular Modeling 1/23 Outline
More informationHIV protease inhibitor. Certain level of function can be found without structure. But a structure is a key to understand the detailed mechanism.
Proteins are linear polypeptide chains (one or more) Building blocks: 20 types of amino acids. Range from a few 10s-1000s They fold into varying three-dimensional shapes structure medicine Certain level
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationCopyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years.
Structure Determination and Sequence Analysis The vast majority of the experimentally determined three-dimensional protein structures have been solved by one of two methods: X-ray diffraction and Nuclear
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More informationALL LECTURES IN SB Introduction
1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL
More informationProcheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics.
Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics Iosif Vaisman Email: ivaisman@gmu.edu ----------------------------------------------------------------- Bond
More informationRNA and Protein Structure Prediction
RNA and Protein Structure Prediction Bioinformatics: Issues and Algorithms CSE 308-408 Spring 2007 Lecture 18-1- Outline Multi-Dimensional Nature of Life RNA Secondary Structure Prediction Protein Structure
More informationProtein Secondary Structure Prediction
Protein Secondary Structure Prediction Doug Brutlag & Scott C. Schmidler Overview Goals and problem definition Existing approaches Classic methods Recent successful approaches Evaluating prediction algorithms
More informationAnalysis and Prediction of Protein Structure (I)
Analysis and Prediction of Protein Structure (I) Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 2006 Free for academic use. Copyright @ Jianlin Cheng
More informationFrom Amino Acids to Proteins - in 4 Easy Steps
From Amino Acids to Proteins - in 4 Easy Steps Although protein structure appears to be overwhelmingly complex, you can provide your students with a basic understanding of how proteins fold by focusing
More informationProtein Structure Analysis and Verification. Course S Basics for Biosystems of the Cell exercise work. Maija Nevala, BIO, 67485U 16.1.
Protein Structure Analysis and Verification Course S-114.2500 Basics for Biosystems of the Cell exercise work Maija Nevala, BIO, 67485U 16.1.2008 1. Preface When faced with an unknown protein, scientists
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationProtein Structures: Experiments and Modeling. Patrice Koehl
Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:
More informationWeek 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
More informationExamples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE
Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationProtein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods
Cell communication channel Bioinformatics Methods Iosif Vaisman Email: ivaisman@gmu.edu SEQUENCE STRUCTURE DNA Sequence Protein Sequence Protein Structure Protein structure ATGAAATTTGGAAACTTCCTTCTCACTTATCAGCCACCT...
More informationHMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder
HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding
More informationBioinformatics. Macromolecular structure
Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure Structure analysis Structure alignment Domain
More informationDesign of a Novel Globular Protein Fold with Atomic-Level Accuracy
Design of a Novel Globular Protein Fold with Atomic-Level Accuracy Brian Kuhlman, Gautam Dantas, Gregory C. Ireton, Gabriele Varani, Barry L. Stoddard, David Baker Presented by Kate Stafford 4 May 05 Protein
More informationCOMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University
COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018
More informationTemplate Free Protein Structure Modeling Jianlin Cheng, PhD
Template Free Protein Structure Modeling Jianlin Cheng, PhD Professor Department of EECS Informatics Institute University of Missouri, Columbia 2018 Protein Energy Landscape & Free Sampling http://pubs.acs.org/subscribe/archive/mdd/v03/i09/html/willis.html
More informationProtein Structure Prediction Using Multiple Artificial Neural Network Classifier *
Protein Structure Prediction Using Multiple Artificial Neural Network Classifier * Hemashree Bordoloi and Kandarpa Kumar Sarma Abstract. Protein secondary structure prediction is the method of extracting
More informationBiochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture - 06 Protein Structure IV
Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur Lecture - 06 Protein Structure IV We complete our discussion on Protein Structures today. And just to recap
More informationProtein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror
Protein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror Please interrupt if you have questions, and especially if you re confused! Assignment
More informationProtein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1
Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2
More informationTHE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION
THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION AND CALIBRATION Calculation of turn and beta intrinsic propensities. A statistical analysis of a protein structure
More informationGetting To Know Your Protein
Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research
More informationMolecular Modeling lecture 2
Molecular Modeling 2018 -- lecture 2 Topics 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction 4. Where do protein structures come from? X-ray crystallography
More informationProtein Structure Prediction
Page 1 Protein Structure Prediction Russ B. Altman BMI 214 CS 274 Protein Folding is different from structure prediction --Folding is concerned with the process of taking the 3D shape, usually based on
More informationProtein Structure Basics
Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes
More informationAmino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1
Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings
More informationHOMOLOGY MODELING. The sequence alignment and template structure are then used to produce a structural model of the target.
HOMOLOGY MODELING Homology modeling, also known as comparative modeling of protein refers to constructing an atomic-resolution model of the "target" protein from its amino acid sequence and an experimental
More informationSecondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure
Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted
More informationProtein Secondary Structure Prediction
part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 the goal is the prediction of the secondary structure conformation which is local each amino
More informationBioinformatics: Secondary Structure Prediction
Bioinformatics: Secondary Structure Prediction Prof. David Jones d.jones@cs.ucl.ac.uk LMLSTQNPALLKRNIIYWNNVALLWEAGSD The greatest unsolved problem in molecular biology:the Protein Folding Problem? Entries
More informationMotif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
More informationIntroduction to Computational Structural Biology
Introduction to Computational Structural Biology Part I 1. Introduction The disciplinary character of Computational Structural Biology The mathematical background required and the topics covered Bibliography
More informationConformational Geometry of Peptides and Proteins:
Conformational Geometry of Peptides and Proteins: Before discussing secondary structure, it is important to appreciate the conformational plasticity of proteins. Each residue in a polypeptide has three
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationLecture 2-3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability
Lecture 2-3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Part I. Review of forces Covalent bonds Non-covalent Interactions Van der Waals Interactions
More informationBiochemistry,530:,, Introduc5on,to,Structural,Biology, Autumn,Quarter,2015,
Biochemistry,530:,, Introduc5on,to,Structural,Biology, Autumn,Quarter,2015, Course,Informa5on, BIOC%530% GraduateAlevel,discussion,of,the,structure,,func5on,,and,chemistry,of,proteins,and, nucleic,acids,,control,of,enzyma5c,reac5ons.,please,see,the,course,syllabus,and,
More informationProtein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds
Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino
More informationSyllabus of BIOINF 528 (2017 Fall, Bioinformatics Program)
Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program) Course Name: Structural Bioinformatics Course Description: Instructor: This course introduces fundamental concepts and methods for structural
More informationUseful background reading
Overview of lecture * General comment on peptide bond * Discussion of backbone dihedral angles * Discussion of Ramachandran plots * Description of helix types. * Description of structures * NMR patterns
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationProtein Structure Determination
Protein Structure Determination Given a protein sequence, determine its 3D structure 1 MIKLGIVMDP IANINIKKDS SFAMLLEAQR RGYELHYMEM GDLYLINGEA 51 RAHTRTLNVK QNYEEWFSFV GEQDLPLADL DVILMRKDPP FDTEFIYATY 101
More informationProtein Structure Prediction and Display
Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each
More informationPrinciples of Physical Biochemistry
Principles of Physical Biochemistry Kensal E. van Hold e W. Curtis Johnso n P. Shing Ho Preface x i PART 1 MACROMOLECULAR STRUCTURE AND DYNAMICS 1 1 Biological Macromolecules 2 1.1 General Principles
More informationMajor Types of Association of Proteins with Cell Membranes. From Alberts et al
Major Types of Association of Proteins with Cell Membranes From Alberts et al Proteins Are Polymers of Amino Acids Peptide Bond Formation Amino Acid central carbon atom to which are attached amino group
More informationOrientational degeneracy in the presence of one alignment tensor.
Orientational degeneracy in the presence of one alignment tensor. Rotation about the x, y and z axes can be performed in the aligned mode of the program to examine the four degenerate orientations of two
More informationMolecular Modeling Lecture 7. Homology modeling insertions/deletions manual realignment
Molecular Modeling 2018-- Lecture 7 Homology modeling insertions/deletions manual realignment Homology modeling also called comparative modeling Sequences that have similar sequence have similar structure.
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationINDEXING METHODS FOR PROTEIN TERTIARY AND PREDICTED STRUCTURES
INDEXING METHODS FOR PROTEIN TERTIARY AND PREDICTED STRUCTURES By Feng Gao A Thesis Submitted to the Graduate Faculty of Rensselaer Polytechnic Institute in Partial Fulfillment of the Requirements for
More informationBioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction. Sepp Hochreiter
Bioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction Institute of Bioinformatics Johannes Kepler University, Linz, Austria Chapter 4 Protein Secondary
More informationSCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like
SCOP all-β class 4-helical cytokines T4 endonuclease V all-α class, 3 different folds Globin-like TIM-barrel fold α/β class Profilin-like fold α+β class http://scop.mrc-lmb.cam.ac.uk/scop CATH Class, Architecture,
More informationAnnouncements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure
Announcements TA Office Hours: Brian Eckenroth Monday 3-4 pm Thursday 11 am-12 pm Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Margaret Daugherty Fall 2003 Homework II posted
More informationPROTEIN SECONDARY STRUCTURE PREDICTION: AN APPLICATION OF CHOU-FASMAN ALGORITHM IN A HYPOTHETICAL PROTEIN OF SARS VIRUS
Int. J. LifeSc. Bt & Pharm. Res. 2012 Kaladhar, 2012 Research Paper ISSN 2250-3137 www.ijlbpr.com Vol.1, Issue. 1, January 2012 2012 IJLBPR. All Rights Reserved PROTEIN SECONDARY STRUCTURE PREDICTION:
More informationProtein structure alignments
Protein structure alignments Proteins that fold in the same way, i.e. have the same fold are often homologs. Structure evolves slower than sequence Sequence is less conserved than structure If BLAST gives
More informationThe Structure and Functions of Proteins
Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science and Engineering 2003 The Structure and Functions of Proteins Dan E. Krane Wright State University
More informationProtein Structure: Data Bases and Classification Ingo Ruczinski
Protein Structure: Data Bases and Classification Ingo Ruczinski Department of Biostatistics, Johns Hopkins University Reference Bourne and Weissig Structural Bioinformatics Wiley, 2003 More References
More informationF. Piazza Center for Molecular Biophysics and University of Orléans, France. Selected topic in Physical Biology. Lecture 1
Zhou Pei-Yuan Centre for Applied Mathematics, Tsinghua University November 2013 F. Piazza Center for Molecular Biophysics and University of Orléans, France Selected topic in Physical Biology Lecture 1
More informationCS273: Algorithms for Structure Handout # 2 and Motion in Biology Stanford University Thursday, 1 April 2004
CS273: Algorithms for Structure Handout # 2 and Motion in Biology Stanford University Thursday, 1 April 2004 Lecture #2: 1 April 2004 Topics: Kinematics : Concepts and Results Kinematics of Ligands and
More informationAP Biology. Proteins. AP Biology. Proteins. Multipurpose molecules
Proteins Proteins Multipurpose molecules 2008-2009 1 Proteins Most structurally & functionally diverse group Function: involved in almost everything u enzymes (pepsin, DNA polymerase) u structure (keratin,
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction
CMPS 6630: Introduction to Computational Biology and Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2004 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure
More informationLecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability
Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Part I. Review of forces Covalent bonds Non-covalent Interactions: Van der Waals Interactions
More informationCHAPTER 29 HW: AMINO ACIDS + PROTEINS
CAPTER 29 W: AMI ACIDS + PRTEIS For all problems, consult the table of 20 Amino Acids provided in lecture if an amino acid structure is needed; these will be given on exams. Use natural amino acids (L)
More informationBuilding 3D models of proteins
Building 3D models of proteins Why make a structural model for your protein? The structure can provide clues to the function through structural similarity with other proteins With a structure it is easier
More informationBME Engineering Molecular Cell Biology. Structure and Dynamics of Cellular Molecules. Basics of Cell Biology Literature Reading
BME 42-620 Engineering Molecular Cell Biology Lecture 05: Structure and Dynamics of Cellular Molecules Basics of Cell Biology Literature Reading BME42-620 Lecture 05, September 13, 2011 1 Outline Review:
More informationModel Mélange. Physical Models of Peptides and Proteins
Model Mélange Physical Models of Peptides and Proteins In the Model Mélange activity, you will visit four different stations each featuring a variety of different physical models of peptides or proteins.
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison
CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture
More informationHomology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB
Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded
More informationCMPS 3110: Bioinformatics. Tertiary Structure Prediction
CMPS 3110: Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the laws of physics! Conformation space is finite
More informationCh 3: Chemistry of Life. Chemistry Water Macromolecules Enzymes
Ch 3: Chemistry of Life Chemistry Water Macromolecules Enzymes Chemistry Atom = smallest unit of matter that cannot be broken down by chemical means Element = substances that have similar properties and
More informationSUPPLEMENTARY MATERIALS
SUPPLEMENTARY MATERIALS Enhanced Recognition of Transmembrane Protein Domains with Prediction-based Structural Profiles Baoqiang Cao, Aleksey Porollo, Rafal Adamczak, Mark Jarrell and Jaroslaw Meller Contact:
More informationBiological Macromolecules
Introduction for Chem 493 Chemistry of Biological Macromolecules Dr. L. Luyt January 2008 Dr. L. Luyt Chem 493-2008 1 Biological macromolecules are the molecules of life allow for organization serve a
More informationPacking of Secondary Structures
7.88 Lecture Notes - 4 7.24/7.88J/5.48J The Protein Folding and Human Disease Professor Gossard Retrieving, Viewing Protein Structures from the Protein Data Base Helix helix packing Packing of Secondary
More information7 Protein secondary structure
78 Grundlagen der Bioinformatik, SS 1, D. Huson, June 17, 21 7 Protein secondary structure Sources for this chapter, which are all recommended reading: Introduction to Protein Structure, Branden & Tooze,
More informationTemplate Free Protein Structure Modeling Jianlin Cheng, PhD
Template Free Protein Structure Modeling Jianlin Cheng, PhD Associate Professor Computer Science Department Informatics Institute University of Missouri, Columbia 2013 Protein Energy Landscape & Free Sampling
More informationBiomolecules: lecture 9
Biomolecules: lecture 9 - understanding further why amino acids are the building block for proteins - understanding the chemical properties amino acids bring to proteins - realizing that many proteins
More informationDetails of Protein Structure
Details of Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Anne Mølgaard, Kemisk Institut, Københavns Universitet Learning Objectives
More information8 Protein secondary structure
Grundlagen der Bioinformatik, SoSe 11, D. Huson, June 6, 211 13 8 Protein secondary structure Sources for this chapter, which are all recommended reading: Introduction to Protein Structure, Branden & Tooze,
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2003 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2014 1 HMM Lecture Notes Dannie Durand and Rose Hoberman November 6th Introduction In the last few lectures, we have focused on three problems related
More informationSTRUCTURAL BIOINFORMATICS. Barry Grant University of Michigan
STRUCTURAL BIOINFORMATICS Barry Grant University of Michigan www.thegrantlab.org bjgrant@umich.edu Bergen, Norway 28-Sep-2015 Objective: Provide an introduction to the practice of structural bioinformatics,
More informationNumber sequence representation of protein structures based on the second derivative of a folded tetrahedron sequence
Number sequence representation of protein structures based on the second derivative of a folded tetrahedron sequence Naoto Morikawa (nmorika@genocript.com) October 7, 2006. Abstract A protein is a sequence
More information114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009
114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009 9 Protein tertiary structure Sources for this chapter, which are all recommended reading: D.W. Mount. Bioinformatics: Sequences and Genome
More informationLS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor
LS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor Note: Adequate space is given for each answer. Questions that require a brief explanation should
More informationMolecular Modelling. part of Bioinformatik von RNA- und Proteinstrukturen. Sonja Prohaska. Leipzig, SS Computational EvoDevo University Leipzig
part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 Protein Structure levels or organization Primary structure: sequence of amino acids (from
More information