BCB 444/544 Fall 07 Dobbs 1
|
|
- Silas Wood
- 5 years ago
- Views:
Transcription
1 BCB 444/544 Lecture 21 Protein Structure Visualization, Classification & Comparison Secondary Structure #21_Oct10 Required Reading (before lecture) Mon Oct 8 - Lecture 20 Protein Secondary Structure Chp 14 - pp Wed Oct 10 - Lecture 21 Protein Tertiary Structure Chp 15 - pp Thurs Oct 11 & Fri Oct 12 - Lab 7 & Lecture 22 Protein Tertiary Structure Chp 15 - pp BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 1 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 2 Assignments & Announcements Seminars this Week - Thurs: ALL: HomeWork #3 Due: Mon Oct 8 by 5 PM HW544: HW544Extra #1 Due: Task Mon Oct 1 by noon Due: Task 1.2 & Task 2 - Fri Oct 12 by 5 PM 444 "Project-instead-of-Final" students should also submit: HW544Extra #1 Due: Task Mon Oct 8 by noon Due: Task Fri Oct 12 by 5 PM <Task 2 NOT required for BCB444 students> BCB List of URLs for Seminars related to Bioinformatics: Oct 11 Thurs Dr. Klaus Schulten (Univ of Illinois) - Baker Center Seminar The Computational Microscope 2:10 PM in E164 Lagomarcino Klaus_Schulten_Seminar.pdf Dr. Dan Gusfield (UC Davis) - Computer Science Colloquium ReCombinatorics: Combinatorial Algorithms for Studying History of Recombination in Populations 3:30 PM in Howe Hall Auditorium BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 3 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 4 Seminars this Week - Fri: Chp 12 - Protein Structure Basics BCB List of URLs for Seminars related to Bioinformatics: Oct 12 Fri Dr. Edward Yu (Physics/BBMB, ISU) - BCB Faculty Seminar TBA: "Structural Biology" (see URL below) 2:10 PM in 102 Sci wsfilefield_abstract/dr.-ed-yu.pdf Dr. Srinivas Aluru (ECprE, ISU) - GDCB Seminar Consensus Genetic Maps: A Graph Theoretic Approach 4:10 PM in 1414 MBB newsfilefield_abstract/dr.-srinivas-aluru.pdf Xiong: Chp 12 Protein Structure Basics Amino Acids Peptide Bond Formation Dihedral Angles Hierarchy Secondary Structures Tertiary Structures Determination of Protein 3-Dimensional Structure Protein Structure DataBank (PDB) BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 5 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 6 BCB 444/544 Fall 07 Dobbs 1
2 Protein Structure & Function 6 Main Classes of Protein Structure Protein structure - primarily determined by sequence Protein function - primarily determined by structure Globular proteins: compact hydrophobic core & hydrophilic surface Membrane proteins: special hydrophobic surfaces Folded proteins are only marginally stable Some proteins do not assume a stable "fold" until they bind to something = Intrinsically disordered Predicting protein structure and function can be very hard -- & fun! 1) α-domains Bundles of helices connected by loops 2) β-domains Mainly antiparallel sheets, usually 2 sheets forming sandwich 3) α/β Domains Mainly parallel sheets with intervening helices, mixed sheets 4) α+β Domains Mainly segregated helices and sheets 5) Multidomain (α & β) Containing domains from more than one class 6) Membrane & cell-surface proteins BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 7 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 8 Protein Structure Databases PDB (RCSB) - recently "remediated" PDB - Protein Data Bank (RCSB) - THE protein structure database MMDB - Molecular Modeling Database (NCBI Entrez) - has "added" value MSD - Molecular Structure Database Especially good for interactions & binding sites BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 9 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 10 Structure at NCBI MMDB at NCBI BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 11 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 12 BCB 444/544 Fall 07 Dobbs 2
3 MMDB: Molecular Modeling Data Base MSD: Molecular Structure Database Derived from PDB structure records "Value-added" to PDB records includes: Integration with other ENTREZ databases & tools Conversion to parseable ASN.1 data description language Data also available in mmcif & XML (also true for PDB now) Correction of numbering discrepancies in structure vs sequence Validation Explicit chemical graph information (covalent bonds) Integrated tool for identifying structural neighbors Vector Alignment Search Tool (VAST) BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 13 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 14 wwpdb: World Wide PDB Experimental Determination of 3D Structure 2 Major Methods to obtain high-resolution structures 1. X-ray Crystallography (most PDB structures) 2. Nuclear Magnetic Resonance (NMR) Spectroscopy Note Advantages & Limitations of each method (See your lecture notes & textbook) For more info: 3. Other methods (usually lower resolution, at present): Electron Paramagnetic Resonance (EPR - also called ESR, EMR) Electron microscopy (EM) Cryo-EM Scanning Probe Microscopies (AFM - Atomic Force Microscopy) Circular Dichroism (CD), several other spectroscopic methods BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 15 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 16 Chp 13 - Protein Structure Visualization, Comparison & Classification Xiong: Chp 13 Protein Structure Visualization, Comparison & Classification Protein Structural Visualization Protein Structure Comparison Protein Structure Classification Protein Structure Visualization RASMOL & decendents: PyMol, MolMol Cn3D - esp. good for structural alignments CHIME (Protein Explorer) MolviZ.Org Deep View = Swiss-PDB Viewer BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 17 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 18 BCB 444/544 Fall 07 Dobbs 3
4 #21 - Protein Secondary Structure Cn3D PyMol BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 19 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 20 Cn3D: Structural Alignments Cn3D : Displaying 3' Structures NADH Chloroquine BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 21 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure Protein Explorer (Chime) 22 Protein Structure Comparison Methods /frntdoor.htm We will skip this for now 3 Basic Approaches for Aligning Structures: 1. Intermolecular 2. Intramolecular 3. Combined DALI/FSSP (most commonly used) BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure BCB 444/544 Fall 07 Dobbs 23 Fully automated structure alignments DALI server DALI Database (fold classification) BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 24 4
5 Protein Structure Classification SCOP - Structure Classification SCOP = Structural Classification of Proteins Levels reflect both evolutionary and structural relationships CATH = Classification by Class, Architecture,Topology & Homology DALI - (recently moved to EBI & reorganized) DALI Database (fold classification) Each method has strengths & weaknesses. BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 25 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 26 CATH - Structure Classification Chp 14 - Secondary Structure Xiong: Chp 14 Protein Secondary Structure Secondary Structure for Globular Proteins Secondary Structure for Transmembrane Proteins Coiled-Coil BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 27 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 28 Secondary Structure Has become highly accurate in recent years (>85%) Usually 3 (or 4) state predictions: H = α-helix E = β-strand C = coil (or loop) (T = turn) Secondary Structure Methods 1st Generation methods Ab initio - used relatively small dataset of structures available Chou-Fasman - based on amino acid propensities (3-state) GOR - also propensity-based (4-state) 2nd Generation methods based on much larger datasets of structures now available GOR II, III, IV, SOPM 3rd Generation methods Homology-based & Neural network based PHD, PSIPRED, SSPRO, PROF, HMMSTR Meta-Servers combine several different methods Consensus & Ensemble based JPRED, PredictProtein BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 29 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 30 BCB 444/544 Fall 07 Dobbs 5
6 Secondary Structure Servers Consensus Data Mining (CDM) Evaluation? Q 3 score - % of residues correctly predicted (3-state) in cross-validation experiments Best results? Meta-servers (scroll for 2' structure prediction) JPred PredictProtein Best individual programs??? Rost, Columbia CDM Sen Jernigan, ISU GOR V Kloczkowsky Jernigan, ISU Developed by Jernigan Group at ISU Basic premise: combination of 2 complementary methods can enhance performance by harnessing distinct advantages of both methods; combines FDM & GOR V: FDM - Fragment Data Mining - exploits availability of sequencesimilar fragments in the PDB, which can lead to highly accurate prediction - much better than GOR V - for such fragments, but such fragments are not available for many cases GOR V - Garnier, Osguthorpe, Robson V - predicts secondary structure of less similar fragments with good performance; these are protein fragments for which FDM method cannot find suitable structures For references & additional details: BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 31 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 32 Secondary Structure : for Different Types of Proteins/Domains For Complete proteins: Globular Proteins - use methods previously described Transmembrane (TMM) Proteins - use special methods (next slides) For Structural Domains: many under development: Coiled-Coil Domains (Protein interaction domains) Zinc Finger Domains (DNA binding domains), others SS for Transmembrane Proteins Transmembrane (TM) Proteins Only a few in the PDB - but ~ 30% of cellular proteins are membrane-associated! Hard to determine experimentally, so prediction important TM domains are relatively 'easy' to predict! Why? constraints due to hydrophobic environment 2 main classes of TM proteins: α- helical β- barrel BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 33 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 34 SS for TM α-helices α-helical TM domains: Helices are amino acids long (span the membrane) Predominantly hydrophobic residues Helices oriented perpendicular to membrane Orientation can be predicted using "positive inside" rule Residues at cytosolic (inside or cytoplasmic) side of TM helix, near hydrophobic anchor are more positively charged than those on lumenal (inside an organelle in eukaryotes) or periplasmic side (space between inner & outer membrane in gram-negative bacteria) Alternating polar & hydrophobic residues provide clues to interactions among helices within membrane Servers? TMHMM or HMMTOP - 70% accuracy - confused by hydrophobic signal peptides (short hydrophobic sequences that target proteins to the endoplasmic reticulum, ER) Phobius - 94% accuracy - uses distinct HMM models for TM helices & signal peptide sequences SS for TM β-barrels β-barrel TM domains: β-strands are amphipathic (partly hydrophobic, partly hydrophilic) Strands are amino acids long Every 2nd residue is hydrophobic, facing lipid bilayer Other residues are hydrophilic, facing "pore" or opening Servers? Harder problem, fewer servers TBBPred - uses NN or SVM (more on these ML methods later) Accuracy? BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 35 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 36 BCB 444/544 Fall 07 Dobbs 6
7 of Coiled-Coil Domains Coiled-coils Superhelical protein motifs or domains, with two or more interacting α-helices that form a "bundle" Often mediate inter-protein (& intra-protein) interactions 'Easy' to detect in primary sequence: Internal repeat of 7 residues (heptad) 1 & 4 = hydrophobic (facing helical interface) 2,3,5,6,7 = hydrophilic (exposed to solvent) Helical wheel representation - can be used manually detect these, based on amino acid sequence Servers? Coils, Multicoil - probability-based methods 2Zip - for Leucine zippers = special type of CC in TFs: characterized by Leu-rich motif: L-X(6)-L-X(6)-L-X(6)-L Chp 15 - Tertiary Structure Xiong: Chp 15 Protein Tertiary Structure Methods Homology Modeling Threading and Fold Recognition Ab Initio Protein Structural CASP BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 37 BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure 38 BCB 444/544 Fall 07 Dobbs 7
Protein Structure Prediction 11/11/05
11/11/05 Protein Structure Prediction & Modeling Bioinformatics Seminars Nov 11 Fri 12:10 BCB Seminar in E164 Lago Building Supertrees Using Distances Steve Willson, Dept of Mathematics http://www.bcb.iastate.edu/courses/bcb691-f2005.html
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationD Dobbs ISU - BCB 444/544X 1
11/7/05 Protein Structure: Classification, Databases, Visualization Announcements BCB 544 Projects - Important Dates: Nov 2 Wed noon - Project proposals due to David/Drena Nov 4 Fri PM - Approvals/responses
More informationGetting To Know Your Protein
Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research
More informationSCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like
SCOP all-β class 4-helical cytokines T4 endonuclease V all-α class, 3 different folds Globin-like TIM-barrel fold α/β class Profilin-like fold α+β class http://scop.mrc-lmb.cam.ac.uk/scop CATH Class, Architecture,
More informationProtein structure alignments
Protein structure alignments Proteins that fold in the same way, i.e. have the same fold are often homologs. Structure evolves slower than sequence Sequence is less conserved than structure If BLAST gives
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More informationAnalysis and Prediction of Protein Structure (I)
Analysis and Prediction of Protein Structure (I) Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 2006 Free for academic use. Copyright @ Jianlin Cheng
More informationProtein Structure Prediction and Display
Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each
More information1. Protein Data Bank (PDB) 1. Protein Data Bank (PDB)
Protein structure databases; visualization; and classifications 1. Introduction to Protein Data Bank (PDB) 2. Free graphic software for 3D structure visualization 3. Hierarchical classification of protein
More informationProtein Structures: Experiments and Modeling. Patrice Koehl
Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:
More informationBioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing
Bioinformatics Proteins II. - Pattern, Profile, & Structure Database Searching Robert Latek, Ph.D. Bioinformatics, Biocomputing WIBR Bioinformatics Course, Whitehead Institute, 2002 1 Proteins I.-III.
More informationProtein Secondary Structure Prediction
Protein Secondary Structure Prediction Doug Brutlag & Scott C. Schmidler Overview Goals and problem definition Existing approaches Classic methods Recent successful approaches Evaluating prediction algorithms
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationALL LECTURES IN SB Introduction
1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL
More informationAmino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1
Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings
More informationProtein Structures. 11/19/2002 Lecture 24 1
Protein Structures 11/19/2002 Lecture 24 1 All 3 figures are cartoons of an amino acid residue. 11/19/2002 Lecture 24 2 Peptide bonds in chains of residues 11/19/2002 Lecture 24 3 Angles φ and ψ in the
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationProtein Secondary Structure Assignment and Prediction
1 Protein Secondary Structure Assignment and Prediction Defining SS features - Dihedral angles, alpha helix, beta stand (Hydrogen bonds) Assigned manually by crystallographers or Automatic DSSP (Kabsch
More informationSyllabus of BIOINF 528 (2017 Fall, Bioinformatics Program)
Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program) Course Name: Structural Bioinformatics Course Description: Instructor: This course introduces fundamental concepts and methods for structural
More informationStatistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics
Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More information1-D Predictions. Prediction of local features: Secondary structure & surface exposure
1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local
More informationBioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction. Sepp Hochreiter
Bioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction Institute of Bioinformatics Johannes Kepler University, Linz, Austria Chapter 4 Protein Secondary
More information#33 - Genomics 11/09/07
BCB 444/544 Required Reading (before lecture) Lecture 33 Mon Nov 5 - Lecture 31 Phylogenetics Parsimony and ML Chp 11 - pp 142 169 Genomics Wed Nov 7 - Lecture 32 Machine Learning Fri Nov 9 - Lecture 33
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationProtein Structure: Data Bases and Classification Ingo Ruczinski
Protein Structure: Data Bases and Classification Ingo Ruczinski Department of Biostatistics, Johns Hopkins University Reference Bourne and Weissig Structural Bioinformatics Wiley, 2003 More References
More informationCOMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University
COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018
More informationSteps in protein modelling. Structure prediction, fold recognition and homology modelling. Basic principles of protein structure
Structure prediction, fold recognition and homology modelling Marjolein Thunnissen Lund September 2012 Steps in protein modelling 3-D structure known Comparative Modelling Sequence of interest Similarity
More informationSUPPLEMENTARY MATERIALS
SUPPLEMENTARY MATERIALS Enhanced Recognition of Transmembrane Protein Domains with Prediction-based Structural Profiles Baoqiang Cao, Aleksey Porollo, Rafal Adamczak, Mark Jarrell and Jaroslaw Meller Contact:
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationCS612 - Algorithms in Bioinformatics
Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available
More information3D Structure. Prediction & Assessment Pt. 2. David Wishart 3-41 Athabasca Hall
3D Structure Prediction & Assessment Pt. 2 David Wishart 3-41 Athabasca Hall david.wishart@ualberta.ca Objectives Become familiar with methods and algorithms for secondary Structure Prediction Become familiar
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationProtein Secondary Structure Prediction
part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 the goal is the prediction of the secondary structure conformation which is local each amino
More informationReview. Membrane proteins. Membrane transport
Quiz 1 For problem set 11 Q1, you need the equation for the average lateral distance transversed (s) of a molecule in the membrane with respect to the diffusion constant (D) and time (t). s = (4 D t) 1/2
More informationBioinformatics. Macromolecular structure
Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure Structure analysis Structure alignment Domain
More informationDetails of Protein Structure
Details of Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Anne Mølgaard, Kemisk Institut, Københavns Universitet Learning Objectives
More informationNeural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha
Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More information2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity.
Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. A global picture of the protein universe will help us to understand
More informationSoftware and Databases for Protein Structure Classification. Some slides are modified from Kun Huang (OSU) and Doug Brutlag (Stanford)
Software and Databases for Protein Structure Classification Some slides are modified from Kun Huang (OSU) and Doug Brutlag (Stanford) Proteins If there is a job to be done in the molecular world of our
More informationCopyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years.
Structure Determination and Sequence Analysis The vast majority of the experimentally determined three-dimensional protein structures have been solved by one of two methods: X-ray diffraction and Nuclear
More informationSupersecondary Structures (structural motifs)
Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric
More informationPROTEIN SECONDARY STRUCTURE PREDICTION: AN APPLICATION OF CHOU-FASMAN ALGORITHM IN A HYPOTHETICAL PROTEIN OF SARS VIRUS
Int. J. LifeSc. Bt & Pharm. Res. 2012 Kaladhar, 2012 Research Paper ISSN 2250-3137 www.ijlbpr.com Vol.1, Issue. 1, January 2012 2012 IJLBPR. All Rights Reserved PROTEIN SECONDARY STRUCTURE PREDICTION:
More informationProteins: Structure & Function. Ulf Leser
Proteins: Structure & Function Ulf Leser This Lecture Proteins Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding
More informationVisualization of Macromolecular Structures
Visualization of Macromolecular Structures Present by: Qihang Li orig. author: O Donoghue, et al. Structural biology is rapidly accumulating a wealth of detailed information. Over 60,000 high-resolution
More informationBiophysics 101: Genomics & Computational Biology. Section 8: Protein Structure S T R U C T U R E P R O C E S S. Outline.
Biophysics 101: Genomics & Computational Biology Section 8: Protein Structure Faisal Reza Nov. 11 th, 2003 B101.pdb from PS5 shown at left with: animated ball and stick model, colored CPK H-bonds on, colored
More informationProtein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods
Cell communication channel Bioinformatics Methods Iosif Vaisman Email: ivaisman@gmu.edu SEQUENCE STRUCTURE DNA Sequence Protein Sequence Protein Structure Protein structure ATGAAATTTGGAAACTTCCTTCTCACTTATCAGCCACCT...
More informationBIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer Protein Structure Prediction I
BIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer 2013 9. Protein Structure Prediction I Structure Prediction Overview Overview of problem variants Secondary structure prediction
More informationBioinformatics: Secondary Structure Prediction
Bioinformatics: Secondary Structure Prediction Prof. David Jones d.jones@cs.ucl.ac.uk LMLSTQNPALLKRNIIYWNNVALLWEAGSD The greatest unsolved problem in molecular biology:the Protein Folding Problem? Entries
More informationBCB 444/544 Fall 07 Dobbs 1
BCB 444/544 Required Reading (before lecture) Lecture 25 Mon Oct 15 - Lecture 23 Protein Tertiary Structure Prediction Chp 15 - pp 214-230 More RNA Structure Wed Oct 17 & Thurs Oct 18 - Lecture 24 & Lab
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction
CMPS 6630: Introduction to Computational Biology and Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the
More informationProtein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds
Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino
More informationHMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder
HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding
More informationChapter 12: Intracellular sorting
Chapter 12: Intracellular sorting Principles of intracellular sorting Principles of intracellular sorting Cells have many distinct compartments (What are they? What do they do?) Specific mechanisms are
More informationCMPS 3110: Bioinformatics. Tertiary Structure Prediction
CMPS 3110: Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the laws of physics! Conformation space is finite
More informationProtein Structure & Motifs
& Motifs Biochemistry 201 Molecular Biology January 12, 2000 Doug Brutlag Introduction Proteins are more flexible than nucleic acids in structure because of both the larger number of types of residues
More informationComputational Molecular Modeling
Computational Molecular Modeling Lecture 1: Structure Models, Properties Chandrajit Bajaj Today s Outline Intro to atoms, bonds, structure, biomolecules, Geometry of Proteins, Nucleic Acids, Ribosomes,
More informationIntroduction to Computational Structural Biology
Introduction to Computational Structural Biology Part I 1. Introduction The disciplinary character of Computational Structural Biology The mathematical background required and the topics covered Bibliography
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationProtein Structure Prediction
Protein Structure Prediction Michael Feig MMTSB/CTBP 2006 Summer Workshop From Sequence to Structure SEALGDTIVKNA Ab initio Structure Prediction Protocol Amino Acid Sequence Conformational Sampling to
More informationBCB 444/544 Fall 07 Dobbs 1
BCB 444/544 Required Reading (before lecture) Lecture 23 Mon Oct 5 - Lecture 23 Protein Tertiary Structure Chp 5 - pp 24-230 Protein Tertiary Structure Wed Oct 7 & Thurs Oct 8 - Lecture 24 & Lab 8 RNA
More informationPROTEIN SECONDARY STRUCTURE PREDICTION USING NEURAL NETWORKS AND SUPPORT VECTOR MACHINES
PROTEIN SECONDARY STRUCTURE PREDICTION USING NEURAL NETWORKS AND SUPPORT VECTOR MACHINES by Lipontseng Cecilia Tsilo A thesis submitted to Rhodes University in partial fulfillment of the requirements for
More informationBioinformatics: Secondary Structure Prediction
Bioinformatics: Secondary Structure Prediction Prof. David Jones d.t.jones@ucl.ac.uk Possibly the greatest unsolved problem in molecular biology: The Protein Folding Problem MWMPPRPEEVARK LRRLGFVERMAKG
More informationProtein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1
Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2
More informationConditional Graphical Models
PhD Thesis Proposal Conditional Graphical Models for Protein Structure Prediction Yan Liu Language Technologies Institute University Thesis Committee Jaime Carbonell (Chair) John Lafferty Eric P. Xing
More informationAdvanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions
BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start
More informationProtein Structure Prediction using String Kernels. Technical Report
Protein Structure Prediction using String Kernels Technical Report Department of Computer Science and Engineering University of Minnesota 4-192 EECS Building 200 Union Street SE Minneapolis, MN 55455-0159
More informationProtein Structure Analysis and Verification. Course S Basics for Biosystems of the Cell exercise work. Maija Nevala, BIO, 67485U 16.1.
Protein Structure Analysis and Verification Course S-114.2500 Basics for Biosystems of the Cell exercise work Maija Nevala, BIO, 67485U 16.1.2008 1. Preface When faced with an unknown protein, scientists
More informationLecture 8: Protein structure analysis
Lecture 8: Protein structure analysis Torgeir R. Hvidsten Professor Norwegian University of Life Sciences Guest lecturer Umeå Plant Science Centre Computational Life Science Cluster (CLiC) Proteins play
More informationWhat is the central dogma of biology?
Bellringer What is the central dogma of biology? A. RNA DNA Protein B. DNA Protein Gene C. DNA Gene RNA D. DNA RNA Protein Review of DNA processes Replication (7.1) Transcription(7.2) Translation(7.3)
More informationBioinformatics Practical for Biochemists
Bioinformatics Practical for Biochemists Andrei Lupas, Birte Höcker, Steffen Schmidt WS 2013/14 03. Sequence Features Targeting proteins signal peptide targets proteins to the secretory pathway N-terminal
More informationBuilding 3D models of proteins
Building 3D models of proteins Why make a structural model for your protein? The structure can provide clues to the function through structural similarity with other proteins With a structure it is easier
More informationProtein structure prediction and conformational transitions
Graduate Theses and Dissertations Graduate College 2009 Protein structure prediction and conformational transitions Haitao Cheng Iowa State University Follow this and additional works at: http://lib.dr.iastate.edu/etd
More informationAlpha-helical Topology and Tertiary Structure Prediction of Globular Proteins Scott R. McAllister Christodoulos A. Floudas Princeton University
Alpha-helical Topology and Tertiary Structure Prediction of Globular Proteins Scott R. McAllister Christodoulos A. Floudas Princeton University Department of Chemical Engineering Program of Applied and
More informationYeast ORFan Gene Project: Module 5 Guide
Cellular Localization Data (Part 1) The tools described below will help you predict where your gene s product is most likely to be found in the cell, based on its sequence patterns. Each tool adds an additional
More informationImproved Protein Secondary Structure Prediction
Improved Protein Secondary Structure Prediction Secondary Structure Prediction! Given a protein sequence a 1 a 2 a N, secondary structure prediction aims at defining the state of each amino acid ai as
More informationOptimization of the Sliding Window Size for Protein Structure Prediction
Optimization of the Sliding Window Size for Protein Structure Prediction Ke Chen* 1, Lukasz Kurgan 1 and Jishou Ruan 2 1 University of Alberta, Department of Electrical and Computer Engineering, Edmonton,
More informationProtein Structure Prediction
Protein Structure Prediction Notes from Chapter 5 of Computational Biology an Application-Oriented View by A.P. Gultyaev 1 Protein Structure Prediction Primary Structure Secondary Structure Prediction
More informationCan protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU
Can protein model accuracy be identified? Morten Nielsen, CBS, BioCentrum, DTU NO! Identification of Protein-model accuracy Why is it important? What is accuracy RMSD, fraction correct, Protein model correctness/quality
More information"Omics" - Experimental Approachs 11/18/05
"Omics" - Experimental Approachs Bioinformatics Seminars "Omics" Experimental Approaches Nov 18 Fri 12:10 BCB Seminar in E164 Lago Using P-Values for the Planning and Analysis of Microarray Experiments
More informationMotif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
More informationProtein Secondary Structure Prediction using Feed-Forward Neural Network
COPYRIGHT 2010 JCIT, ISSN 2078-5828 (PRINT), ISSN 2218-5224 (ONLINE), VOLUME 01, ISSUE 01, MANUSCRIPT CODE: 100713 Protein Secondary Structure Prediction using Feed-Forward Neural Network M. A. Mottalib,
More informationAnnouncements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure
Announcements TA Office Hours: Brian Eckenroth Monday 3-4 pm Thursday 11 am-12 pm Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Margaret Daugherty Fall 2003 Homework II posted
More informationProtein Secondary Structure Prediction using Pattern Recognition Neural Network
Protein Secondary Structure Prediction using Pattern Recognition Neural Network P.V. Nageswara Rao 1 (nagesh@gitam.edu), T. Uma Devi 1, DSVGK Kaladhar 1, G.R. Sridhar 2, Allam Appa Rao 3 1 GITAM University,
More informationProtein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror
Protein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror Please interrupt if you have questions, and especially if you re confused! Assignment
More informationHIV protease inhibitor. Certain level of function can be found without structure. But a structure is a key to understand the detailed mechanism.
Proteins are linear polypeptide chains (one or more) Building blocks: 20 types of amino acids. Range from a few 10s-1000s They fold into varying three-dimensional shapes structure medicine Certain level
More informationSyllabus BINF Computational Biology Core Course
Course Description Syllabus BINF 701-702 Computational Biology Core Course BINF 701/702 is the Computational Biology core course developed at the KU Center for Computational Biology. The course is designed
More informationPresenter: She Zhang
Presenter: She Zhang Introduction Dr. David Baker Introduction Why design proteins de novo? It is not clear how non-covalent interactions favor one specific native structure over many other non-native
More informationMolecular Modeling lecture 2
Molecular Modeling 2018 -- lecture 2 Topics 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction 4. Where do protein structures come from? X-ray crystallography
More informationOrientational degeneracy in the presence of one alignment tensor.
Orientational degeneracy in the presence of one alignment tensor. Rotation about the x, y and z axes can be performed in the aligned mode of the program to examine the four degenerate orientations of two
More informationWeek 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
More informationLecture 7. Protein Secondary Structure Prediction. Secondary Structure DSSP. Master Course DNA/Protein Structurefunction.
C N T R F O R N T G R A T V B O N F O R M A T C S V U Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 7 Protein Secondary Structure Prediction Protein primary structure 20 amino
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationMajor Types of Association of Proteins with Cell Membranes. From Alberts et al
Major Types of Association of Proteins with Cell Membranes From Alberts et al Proteins Are Polymers of Amino Acids Peptide Bond Formation Amino Acid central carbon atom to which are attached amino group
More informationProtein Secondary Structure Prediction
C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 7 Protein Secondary Structure Prediction Protein primary
More informationProtein Structure Determination
Protein Structure Determination Given a protein sequence, determine its 3D structure 1 MIKLGIVMDP IANINIKKDS SFAMLLEAQR RGYELHYMEM GDLYLINGEA 51 RAHTRTLNVK QNYEEWFSFV GEQDLPLADL DVILMRKDPP FDTEFIYATY 101
More informationProtein Structure and Function Prediction using Kernel Methods.
Protein Structure and Function Prediction using Kernel Methods. A THESIS SUBMITTED TO THE FACULTY OF THE GRADUATE SCHOOL OF THE UNIVERSITY OF MINNESOTA BY Huzefa Rangwala IN PARTIAL FULFILLMENT OF THE
More information