Genome Evolution Greg Lang, Department of Biological Sciences

Size: px
Start display at page:

Download "Genome Evolution Greg Lang, Department of Biological Sciences"

Transcription

1 Genome Evolution Greg Lang, Department of Biological Sciences BioS 010: Bioscience in the 21st Century

2 Mechanisms of genome evolution Gene Duplication Genome Rearrangement Whole Genome Duplication

3 Gene number varies between species Species Saccharomyces cerevisiae Neurospora crassa Drosophila melanogaster Caenorhabditis elegans Homo sapiens Takifugu rubripes Arabadopsis thaliana Oryza sativa Populus trichocarpa Gene # 6,294 10,082 13,600 19,000 20, ,000 27, ,000 45,555

4 Fates of duplicated genes Dosage Subfunctionalization Neofunctionalization

5 Human opsin genes and trichromatic vision (a) In Out A P A V Q S T E T K S V T T S 348 A E Q Q E 240 D Q S D A 330 A P M S G N A T K F L T III C 140 A R VIII P K L E Q VI R V K R V F T N H II V V IV K K I N Q T G K Y V V A N C T K R T VII M F M L F Y V T V N L P I E N E K E Q G H V L T L L L I Y A L M L V G M I A G Q L V R T E C C M I A L N W S C Y I Y F V M I P I N F W T P N F L D A V I A L F A V I V V E V L G G M V I F I L A I L M F G F M I S T L L I V L W I K G F F A G F P V Y M F F G F A A P L A V Y A T A A C H F I C L V A P A V L P Y P F A T T T L E G T M L G C F V M S I Q F S T Y L M N F A I I Y A V G F F T W Y L S F I P W F G P E G P H T G Y F Y R S V N E I Y H F P T T D A E G I D Y 200 N Q E G S C P L G H E Y M C S Q Y Q V V III VI IV VII II VIII I P A E F P S R V V G T K N S F P V Y F N P G E T G N M 20 1 Terakita. Genome Biol. 2005;6(3):213.

6 Duplication of opsin genes in old-world primates Dulai et al. Genome Res Jul;9(7):

7 Trichromatic vision in howler monkeys Gilad et al. PLoS Biol Jan;2(1):E5.

8 Mechanisms of genome evolution Gene Duplication Genome Rearrangement Whole Genome Duplication

9 Genomes rearrange during evolution Mouse Genome Human Genome U.S. Department of Energy Human Genome Program:

10 The missing human chromosome Human 23 Chromosomes Chimpanzee 24 Chromosomes Gorilla 24 Chromosomes Orangutan 24 Chromosomes

11 Human Chromosome 2 arose through fusion Human Human Chromosome 2 Chimpanzee Gorilla Orangutan Yunis and Prakash. Science Mar 19;215(4539):

12 Genome rearrangement in cancer Bcr-Abl Philadelphia Chromosome Wikimedia Commons

13 Genome rearrangements as a genetic barrier

14 Engineering evolution to study speciation in yeast Delneri et al. Nature Mar 6;422(6927):68-72.

15 Engineering evolution to study speciation in yeast S. cerevisiae 90.3% 0.6% 88.9% S. mikatae Delneri et al. Nature Mar 6;422(6927):68-72.

16 Engineering evolution to study speciation in yeast S. cerevisiae S. cerevisiae - translocation 90.3% 88.8% 0.6% 88.9% S. mikatae Delneri et al. Nature Mar 6;422(6927):68-72.

17 Engineering evolution to study speciation in yeast S. cerevisiae S. cerevisiae - translocation 90.3% 60.4% 88.8% 0.6% 20.0% 88.9% S. mikatae Delneri et al. Nature Mar 6;422(6927):68-72.

18 Mechanisms of genome evolution Gene Duplication Genome Rearrangement Whole Genome Duplication

19 Evidence of two WGDs in vertebrate Hox clusters Swalla. Heredity Sep;97(3):

20 Gene number varies between species Species Saccharomyces cerevisiae Neurospora crassa Drosophila melanogaster Caenorhabditis elegans Homo sapiens Takifugu rubripes Arabadopsis thaliana Oryza sativa Populus trichocarpa Gene # 6,294 10,082 13,600 19,000 20, ,000 27, ,000 45,555

21 Genome rearrangements as a genetic barrier

22 Evidence for a whole-genome duplication in yeast Kellis et al. Nature Apr 8;428(6983):

23 Evidence for a whole-genome duplication in yeast Kellis et al. Nature Apr 8;428(6983):

24 Analysis of the whole-genome duplication in yeast Kellis et al. Nature Apr 8;428(6983):

25 Fates of duplicated genes Dosage Subfunctionalization Neofunctionalization

26 Subfunctionalization following WGD Hittinger and Carroll. Nature Oct 11;449(7163):

27 Increase in metabolic flux following WGD HXT## Key WGD duplications Glucose transport by numerous WGD duplicates in all proteins see table I post-wgd species WGD duplicates in S. cerevisiae, Glucose but not all post-wgd species Other duplications HXK2 HXK1 GLK1 EMI2 Glucose-6-phosphate PGI1 Ethanol Ethanol Fructose-6-phosphate ADH2 ADH1 ADH3 Glycolysis Fructose-1-6-bisphosphate Glyceraldehyde-3- phosphate TDH2 TDH1 TDH3 PFK1 3-Phospho-Dglyceroyl-phosphate PFK2 FBA1 DHAP TPI1 PDC5 ADH5 Acetaldehyde ALD6 Acetate PDC6 ACS1 ADH4 Acetaldehyde ALD5 ALD4 Acetate PGK1 3-Phosphoglycerate GPM1 Fermentation PDC1 ACS2 Acetyl-CoA GPM2 GPM3 2-Phosphoglycerate ENO1 ENO2 Phosphoenolpyruvate PDH complex Lipoamide LDP1 YPL017C Dihydrolipoamide LAT1 CDC19 PYK2 S-ADLA Pyruvate Respiration PDB1 Pyruvate PDA1 CoA PYC1 PYC2 Acetyl-CoA Cytosol Mitochondrion Oxaloacetic acid Malate FUM1 Fumarate SDH1 SDH2 SDH3 Oxaloacetic acid MDH2 CIT3 CIT1 YJL045W YMR118C CIT2 Cytosol Citrate ACO1 Isocitrate IDH2 SDH4 YLR164W IDH1 Succinate 2-Oxoglutarate LSC1 KGD1 LSC2 Succinyl-CoA KGD2 Succinyl-lipoate Conant and Wolfe. Mol Syst Biol. 2007;3:129.

28 Mechanisms of genome evolution Gene Duplication Dosage Subfunctionalization Neofunctionalization Genome Rearrangement Human Chromosome 2 Philadelphia Chromosome Species barriers Whole Genome Duplication Twice in vertebrates 100 MYA in yeast lineage

Meeting report Evolution enters the genomic era David A Liberles

Meeting report Evolution enters the genomic era David A Liberles http://genomebiology.com/2001/2/11/reports/4026.1 Meeting report Evolution enters the genomic era David A Liberles Address: Department of Biochemistry and Biophysics and Stockholm Bioinformatics Center,

More information

Bioenergetics and high-energy compounds

Bioenergetics and high-energy compounds Bioenergetics and high-energy compounds Tomáš Kučera tomas.kucera@lfmotol.cuni.cz Department of Medical Chemistry and Clinical Biochemistry 2nd Faculty of Medicine, Charles University in Prague and Motol

More information

Characterization of the Metabolic Requirements in Yeast Meiosis

Characterization of the Metabolic Requirements in Yeast Meiosis Characterization of the Metabolic Requirements in Yeast Meiosis Debjit Ray 1,2, Ping Ye 1,3 * 1 School of Molecular Biosciences, Washington State University, Pullman, Washington, United States of America,

More information

Science histogram was a mistake. This mistake was corrected in this manuscript.

Science histogram was a mistake. This mistake was corrected in this manuscript. Supplementary Note When the two genes for alcohol dehydrogenase (Adh 1 and Adh 2) are aligned, and the nucleotides at the silent sites of the two fold redundant codon systems compared, one discovers that

More information

Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. Outer Glycolysis mitochondrial membrane Glucose ATP

Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. Outer Glycolysis mitochondrial membrane Glucose ATP Fig. 7.5 uter Glycolysis mitochondrial membrane Glucose Intermembrane space xidation Mitochondrial matrix Acetyl-oA Krebs FAD e NAD + FAD Inner mitochondrial membrane e Electron e Transport hain hemiosmosis

More information

Constraint-Based Workshops

Constraint-Based Workshops Constraint-Based Workshops 2. Reconstruction Databases November 29 th, 2007 Defining Metabolic Reactions ydbh hslj ldha 1st level: Primary metabolites LAC 2nd level: Neutral Formulas C 3 H 6 O 3 Charged

More information

Lecture 10. Proton Gradient-dependent ATP Synthesis. Oxidative. Photo-Phosphorylation

Lecture 10. Proton Gradient-dependent ATP Synthesis. Oxidative. Photo-Phosphorylation Lecture 10 Proton Gradient-dependent ATP Synthesis Oxidative Phosphorylation Photo-Phosphorylation Model of the Electron Transport Chain (ETC) Glycerol-3-P Shuttle Outer Mitochondrial Membrane G3P DHAP

More information

Bio-based route to the carbon-5 chemical glutaric acid and bio-polyamide PA6.5 using metabolically engineered Corynebacterium glutamicum

Bio-based route to the carbon-5 chemical glutaric acid and bio-polyamide PA6.5 using metabolically engineered Corynebacterium glutamicum Electronic Supplementary Material (ESI) for Green Chemistry. This journal is The Royal Society of Chemistry 2018 Online Supplementary Information to: Bio-based route to the carbon-5 chemical glutaric acid

More information

2015 AP Biology PRETEST Unit 3: Cellular Energetics Week of October

2015 AP Biology PRETEST Unit 3: Cellular Energetics Week of October Name: Class: _ Date: _ 2015 AP Biology PRETEST Unit 3: Cellular Energetics Week of 19-23 October Multiple Choice Identify the choice that best completes the statement or answers the question. 1) Which

More information

Change to Office Hours this Friday and next Monday. Tomorrow (Abel): 8:30 10:30 am. Monday (Katrina): Cancelled (05/04)

Change to Office Hours this Friday and next Monday. Tomorrow (Abel): 8:30 10:30 am. Monday (Katrina): Cancelled (05/04) Change to Office Hours this Friday and next Monday Tomorrow (Abel): 8:30 10:30 am Monday (Katrina): Cancelled (05/04) Lecture 10 Proton Gradient-dependent ATP Synthesis Oxidative Phosphorylation Photo-Phosphorylation

More information

BBS2710 Microbial Physiology. Module 5 - Energy and Metabolism

BBS2710 Microbial Physiology. Module 5 - Energy and Metabolism BBS2710 Microbial Physiology Module 5 - Energy and Metabolism Topics Energy production - an overview Fermentation Aerobic respiration Alternative approaches to respiration Photosynthesis Summary Introduction

More information

ECOL/MCB 320 and 320H Genetics

ECOL/MCB 320 and 320H Genetics ECOL/MCB 320 and 320H Genetics Instructors Dr. C. William Birky, Jr. Dept. of Ecology and Evolutionary Biology Lecturing on Molecular genetics Transmission genetics Population and evolutionary genetics

More information

Metabolic Adaptation after Whole Genome Duplication

Metabolic Adaptation after Whole Genome Duplication MBE Advance Access published July 22, 2009 Metabolic Adaptation after Whole Genome Duplication submission is intended as Research Article Milan J.A. van Hoek and Paulien Hogeweg. Affiliation where research

More information

MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question.

MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. AP Exam Chapters 9 and 10; Photosynthesis and Respiration Name MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. 1) Carbon dioxide (CO2) is released

More information

The Impact of Astrocyte Mitochondrial ATP Production on Neuroprotection After Stroke James D. Lechleiter, Ph.D., Professor

The Impact of Astrocyte Mitochondrial ATP Production on Neuroprotection After Stroke James D. Lechleiter, Ph.D., Professor The Impact of Astrocyte Mitochondrial Production The Impact of Astrocyte Mitochondrial Production 1 Dept. of Cellular & Structural Biology University of Texas Health Science Center at San Antonio San Antonio,

More information

CHEM-E3215 Advanced Biochemistry

CHEM-E3215 Advanced Biochemistry CHEM-E3215 Advanced Biochemistry 30. Jan. 2018 Prof. Silvan Scheller Lecture 10 Energy conservation general (some calculations) Energy conservation in anaerobes: e.g. methanogensis Life close to the thermodynamic

More information

1) What is the one letter and the three letter abbreviations for the poly peptide shown

1) What is the one letter and the three letter abbreviations for the poly peptide shown Lecture 1 Short problems 1) What is the one letter and the three letter abbreviations for the poly peptide shown 2) How many peptide bonds does this polypeptide possess? 3) Circle the peptide bonds 4)

More information

Towards integrated models of regulatory networks: the MetaGenoReg project

Towards integrated models of regulatory networks: the MetaGenoReg project Towards integrated models of regulatory networks: the MetaGenoReg project Hidde de Jong and Daniel Kahn INRIA Grenoble - Rhône-Alpes Hidde.de-Jong@inria.fr http://ibis.inrialpes.fr LBBE, Université de

More information

Comparing Genomes! Homologies and Families! Sequence Alignments!

Comparing Genomes! Homologies and Families! Sequence Alignments! Comparing Genomes! Homologies and Families! Sequence Alignments! Allows us to achieve a greater understanding of vertebrate evolution! Tells us what is common and what is unique between different species

More information

Constraint-based Metabolic Reconstructions & Analysis H. Scott Hinton. The Cobra Toolbox. Lesson: Cobra Toolbox

Constraint-based Metabolic Reconstructions & Analysis H. Scott Hinton. The Cobra Toolbox. Lesson: Cobra Toolbox 1 The Cobra Toolbox 2 Learning Objectives Each student should be able to: Explain the purpose of the Cobra Toolbox, Demonstrate basic operation of the Cobra Toolbox, Explain the BIGG Database, Explain

More information

Genetically Engineering Yeast to Understand Molecular Modes of Speciation

Genetically Engineering Yeast to Understand Molecular Modes of Speciation Genetically Engineering Yeast to Understand Molecular Modes of Speciation Mark Umbarger Biophysics 242 May 6, 2004 Abstract: An understanding of the molecular mechanisms of speciation (reproductive isolation)

More information

Procedure to Create NCBI KOGS

Procedure to Create NCBI KOGS Procedure to Create NCBI KOGS full details in: Tatusov et al (2003) BMC Bioinformatics 4:41. 1. Detect and mask typical repetitive domains Reason: masking prevents spurious lumping of non-orthologs based

More information

Subsystem: TCA Cycle. List of Functional roles. Olga Vassieva 1 and Rick Stevens 2 1. FIG, 2 Argonne National Laboratory and University of Chicago

Subsystem: TCA Cycle. List of Functional roles. Olga Vassieva 1 and Rick Stevens 2 1. FIG, 2 Argonne National Laboratory and University of Chicago Subsystem: TCA Cycle Olga Vassieva 1 and Rick Stevens 2 1 FIG, 2 Argonne National Laboratory and University of Chicago List of Functional roles Tricarboxylic acid cycle (TCA) oxidizes acetyl-coa to CO

More information

Virtual mitochondria : metabolic modelling and control.

Virtual mitochondria : metabolic modelling and control. Virtual mitochondria : metabolic modelling and control. Marie Aimar-Beurton 1,, Bernard Korzeniewski 3, Thierry Letellier 1, Stéphane Ludinard 1, Jean-erre Mazat 1 and Christine Nazaret (alphabetical order)

More information

BIOINFORMATICS LAB AP BIOLOGY

BIOINFORMATICS LAB AP BIOLOGY BIOINFORMATICS LAB AP BIOLOGY Bioinformatics is the science of collecting and analyzing complex biological data. Bioinformatics combines computer science, statistics and biology to allow scientists to

More information

State state describe

State state describe Warm-Up State the products of the light-dependent reaction of photosynthesis, state which product has chemical energy, and describe how that product is made. KREBS ETC FADH 2 Glucose Pyruvate H 2 O NADH

More information

Computational Structural Bioinformatics

Computational Structural Bioinformatics Computational Structural Bioinformatics ECS129 Instructor: Patrice Koehl http://koehllab.genomecenter.ucdavis.edu/teaching/ecs129 koehl@cs.ucdavis.edu Learning curve Math / CS Biology/ Chemistry Pre-requisite

More information

Glycolysis and Fermentation. Chapter 8

Glycolysis and Fermentation. Chapter 8 Glycolysis and Fermentation Chapter 8 Cellular Respiration and Photosynthesis 0 Things to know in these chapters 0 Names and order of the processes 0 Reactants and products of each process 0 How do they

More information

Supplementary Figure 3

Supplementary Figure 3 Supplementary Figure 3 a 1 (i) (ii) (iii) (iv) (v) log P gene Q group, % ~ ε nominal 2 1 1 8 6 5 A B C D D' G J L M P R U + + ε~ A C B D D G JL M P R U -1 1 ε~ (vi) Z group 2 1 1 (vii) (viii) Z module

More information

Supplementary Information

Supplementary Information 1 Steady State Analysis of Genetic Regulatory Network incorporating underlying Molecular Mechanisms for Anaerobic Metabolism in Escherichia coli Sumana Srinivasan and K. V. Venkatesh Department of Chemical

More information

Bio102 Problems Photosynthesis

Bio102 Problems Photosynthesis Bio102 Problems Photosynthesis 1. Why is it advantageous for chloroplasts to have a very large (in surface area) thylakoid membrane contained within the inner membrane? A. This limits the amount of stroma

More information

Related Courses He who asks is a fool for five minutes, but he who does not ask remains a fool forever.

Related Courses He who asks is a fool for five minutes, but he who does not ask remains a fool forever. CSE 527 Computational Biology http://www.cs.washington.edu/527 Lecture 1: Overview & Bio Review Autumn 2004 Larry Ruzzo Related Courses He who asks is a fool for five minutes, but he who does not ask remains

More information

METABOLISM CHAPTER 04 BIO 211: ANATOMY & PHYSIOLOGY I. Dr. Lawrence G. Altman Some illustrations are courtesy of McGraw-Hill.

METABOLISM CHAPTER 04 BIO 211: ANATOMY & PHYSIOLOGY I. Dr. Lawrence G. Altman  Some illustrations are courtesy of McGraw-Hill. BIO 211: ANATOMY & PHYSIOLOGY I CHAPTER 04 1 Please wait 20 seconds before starting slide show. Mouse click or Arrow keys to navigate. Hit ESCAPE Key to exit. CELLULAR METABOLISM Dr. Lawrence G. Altman

More information

CELL METABOLISM OVERVIEW Keep the big picture in mind as we discuss the particulars!

CELL METABOLISM OVERVIEW Keep the big picture in mind as we discuss the particulars! BIO 211: ANATOMY & PHYSIOLOGY I CHAPTER 04 CELLULAR METABOLISM 1 Please wait 20 seconds before starting slide show. Mouse click or Arrow keys to navigate. Hit ESCAPE Key to exit. Dr. Lawrence G. Altman

More information

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern

More information

DO NOT WRITE ON THIS. Evidence from Evolution Activity. The Fossilization Process. Types of Fossils

DO NOT WRITE ON THIS. Evidence from Evolution Activity. The Fossilization Process. Types of Fossils Evidence from Evolution Activity Part 1 - Fossils Use the diagrams on the next page to answer the following questions IN YOUR NOTEBOOK. 1. Describe how fossils form. 2. Describe the different types of

More information

respect to the wild type in the later stages of growth. Photograph showing representative plants after 5 and 10 weeks growth.

respect to the wild type in the later stages of growth. Photograph showing representative plants after 5 and 10 weeks growth. A Supplemental Data. Araújo et al. (211). Plant Cell 1.115/tpc.11.81224 C B.5 Supplemental Figure 1. Characterization and expression of tomato SDH2-2. (A) Dendogram of iron sulphur subunit of SDH. SDH2

More information

Cellular Metabolism and Reproduction: Mitosis and Meiosis

Cellular Metabolism and Reproduction: Mitosis and Meiosis C A T E R 4 Cellular Metabolism and Reproduction: Mitosis and Meiosis BJECTIVE After studying this chapter, you should be able to: 1. Define metabolism. 2. Describe the basic steps in glycolysis and indicate

More information

Lecture Series 9 Cellular Pathways That Harvest Chemical Energy

Lecture Series 9 Cellular Pathways That Harvest Chemical Energy Lecture Series 9 Cellular Pathways That Harvest Chemical Energy Reading Assignments Review Chapter 3 Energy, Catalysis, & Biosynthesis Read Chapter 13 How Cells obtain Energy from Food Read Chapter 14

More information

Genome-scale Gene Expression Analysis and Pathway Reconstruction in KEGG

Genome-scale Gene Expression Analysis and Pathway Reconstruction in KEGG Genome-scale Gene Expression Analysis and Pathway Reconstruction in KEGG Mitsuteru Nakao 1 Hidemasa Bono 1 Shuichi Kawashima 1 nakao@kuicr.kyoto-u.ac.jp bono@kuicr.kyoto-u.ac.jp shuichi@kuicr.kyoto-u.ac.jp

More information

System Reduction of Nonlinear Positive Systems by Linearization and Truncation

System Reduction of Nonlinear Positive Systems by Linearization and Truncation System Reduction of Nonlinear Positive Systems by Linearization and Truncation Hanna M. Härdin 1 and Jan H. van Schuppen 2 1 Department of Molecular Cell Physiology, Vrije Universiteit, De Boelelaan 1085,

More information

Description of the algorithm for computing elementary flux modes

Description of the algorithm for computing elementary flux modes Description of the algorithm for computing elementary flux modes by Stefan Schuster, Thomas Dandekar,, and David Fell Department of Bioinformatics, Max Delbrück Centre for Molecular Medicine D-9 Berlin-Buch,

More information

13. PG3 + ATP + NADH => GA3P + ADP + Pi + NAD +

13. PG3 + ATP + NADH => GA3P + ADP + Pi + NAD + Additional file 2. 1.1 Stochiometric model for P. pastoris containing some additional reactions from the 13 C model (section 1.2) Methanol metabolism 1. Metoh => Form 2. Form => FOR + NADH 3. FOR + NAD

More information

11/24/13. Science, then, and now. Computational Structural Bioinformatics. Learning curve. ECS129 Instructor: Patrice Koehl

11/24/13. Science, then, and now. Computational Structural Bioinformatics. Learning curve. ECS129 Instructor: Patrice Koehl Computational Structural Bioinformatics ECS129 Instructor: Patrice Koehl http://www.cs.ucdavis.edu/~koehl/teaching/ecs129/index.html koehl@cs.ucdavis.edu Learning curve Math / CS Biology/ Chemistry Pre-requisite

More information

Principles of transcriptional control in the metabolic network of Saccharomyces cerevisiae

Principles of transcriptional control in the metabolic network of Saccharomyces cerevisiae Principles of transcriptional control in the metabolic network of Saccharomyces cerevisiae Jan Ihmels 1,3,Ronen Levy 1,3 & Naama Barkai 1,2 Cellular networks are subject to extensive regulation, which

More information

All organisms require a constant expenditure of energy to maintain the living state - "LIFE".

All organisms require a constant expenditure of energy to maintain the living state - LIFE. CELLULAR RESPIRATION All organisms require a constant expenditure of energy to maintain the living state - "LIFE". Where does the energy come from and how is it made available for life? With rare exception,

More information

Part II => PROTEINS and ENZYMES. 2.5 Enzyme Properties 2.5a Enzyme Nomenclature 2.5b Transition State Theory

Part II => PROTEINS and ENZYMES. 2.5 Enzyme Properties 2.5a Enzyme Nomenclature 2.5b Transition State Theory Part II => PROTEINS and ENZYMES 2.5 Enzyme Properties 2.5a Enzyme Nomenclature 2.5b Transition State Theory Section 2.5a: Enzyme Nomenclature Synopsis 2.5a - Enzymes are biological catalysts they are almost

More information

Introduction of Biotechnology

Introduction of Biotechnology Handai Cyber University Introduction of Biotechnology No.5:Genome biotechnology and yeast Graduate School of Engineering, Osaka University Graduate School of Information Science, Osaka University 1 International

More information

Lectures by Kathleen Fitzpatrick

Lectures by Kathleen Fitzpatrick Chapter 10 Chemotrophic Energy Metabolism: Aerobic Respiration Lectures by Kathleen Fitzpatrick Simon Fraser University Figure 10-1 Figure 10-6 Conversion of pyruvate The conversion of pyruvate to acetyl

More information

Reconstruction and Analysis of Metabolic Networks

Reconstruction and Analysis of Metabolic Networks 1 Reconstruction and Analysis of Metabolic Networks 2 Outline What is a Reconstruction? Data Collection Interactions Between Network Components Special Considerations Applications Genome-scale Metabolic

More information

RESPIRATION AND FERMENTATION: AEROBIC AND ANAEROBIC OXIDATION OF ORGANIC MOLECULES. Bio 107 Week 6

RESPIRATION AND FERMENTATION: AEROBIC AND ANAEROBIC OXIDATION OF ORGANIC MOLECULES. Bio 107 Week 6 RESPIRATION AND FERMENTATION: AEROBIC AND ANAEROBIC OXIDATION OF ORGANIC MOLECULES Bio 107 Week 6 Procedure 7.2 Label test tubes well, including group name 1) Add solutions listed to small test tubes 2)

More information

NUCLEOTIDE SUBSTITUTIONS AND THE EVOLUTION OF DUPLICATE GENES

NUCLEOTIDE SUBSTITUTIONS AND THE EVOLUTION OF DUPLICATE GENES Conery, J.S. and Lynch, M. Nucleotide substitutions and evolution of duplicate genes. Pacific Symposium on Biocomputing 6:167-178 (2001). NUCLEOTIDE SUBSTITUTIONS AND THE EVOLUTION OF DUPLICATE GENES JOHN

More information

Homolog. Orthologue. Comparative Genomics. Paralog. What is Comparative Genomics. What is Comparative Genomics

Homolog. Orthologue. Comparative Genomics. Paralog. What is Comparative Genomics. What is Comparative Genomics Orthologue Orthologs are genes in different species that evolved from a common ancestral gene by speciation. Normally, orthologs retain the same function in the course of evolution. Identification of orthologs

More information

Chapter 5. The Chloroplast. 5.1 Matter and Energy Pathways in Living Systems. Photosynthesis & Cellular Respiration

Chapter 5. The Chloroplast. 5.1 Matter and Energy Pathways in Living Systems. Photosynthesis & Cellular Respiration Chapter 5 Photosynthesis & Cellular Respiration 5.1 Matter and Energy Pathways in Living Systems Both cellular respiration and photosynthesis are examples of biological processes that involve matter &

More information

Photosynthesis and cellular respirations

Photosynthesis and cellular respirations The Introduction of Biology Defining of life Basic chemistry, the chemistry of organic molecules Classification of living things History of cells and Cells structures and functions Photosynthesis and cellular

More information

letter Systematic screen for human disease genes in yeast a b c

letter Systematic screen for human disease genes in yeast a b c Systematic screen for human disease genes in yeast Lars M. Steinmetz,3 *, Curt Scharfe 2,3 *, Adam M. Deutschbauer, Dejana Mokranjac 4, Zelek S. Herman 3, Ted Jones 3, Angela M. Chu 2, Guri Giaever 3,

More information

Divergence Pattern of Duplicate Genes in Protein-Protein Interactions Follows the Power Law

Divergence Pattern of Duplicate Genes in Protein-Protein Interactions Follows the Power Law Divergence Pattern of Duplicate Genes in Protein-Protein Interactions Follows the Power Law Ze Zhang,* Z. W. Luo,* Hirohisa Kishino,à and Mike J. Kearsey *School of Biosciences, University of Birmingham,

More information

Impact of recurrent gene duplication on adaptation of plant genomes

Impact of recurrent gene duplication on adaptation of plant genomes Impact of recurrent gene duplication on adaptation of plant genomes Iris Fischer, Jacques Dainat, Vincent Ranwez, Sylvain Glémin, Jacques David, Jean-François Dufayard, Nathalie Chantret Plant Genomes

More information

Introduction to cells

Introduction to cells Almen Cellebiologi Introduction to cells 1. Unity and diversity of cells 2. Microscopes and visualization of cells 3. Prokaryotic cells, eubacteria and archaea 4. Eucaryotic cells, nucleus, mitochondria

More information

Photosynthesis and Cellular Respiration

Photosynthesis and Cellular Respiration Name Date Class CHAPTER 5 DIRECTED READING Photosynthesis and Cellular Respiration Section 5-1: Energy and Living Things Energy Flows Between Organisms in Living Systems In the space provided, write the

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

Phylogenetics in the Age of Genomics: Prospects and Challenges

Phylogenetics in the Age of Genomics: Prospects and Challenges Phylogenetics in the Age of Genomics: Prospects and Challenges Antonis Rokas Department of Biological Sciences, Vanderbilt University http://as.vanderbilt.edu/rokaslab http://pubmed2wordle.appspot.com/

More information

Lesson Topic Learning Goals

Lesson Topic Learning Goals Unit 2: Evolution Part B Lesson Topic Learning Goals 1 Lab Mechanisms of Evolution Cumulative Selection - Be able to describe evolutionary mechanisms such as genetic variations and key factors that lead

More information

ActiveNetworks Cross-Condition Analysis of Functional Genomic Data

ActiveNetworks Cross-Condition Analysis of Functional Genomic Data ActiveNetworks Cross-Condition Analysis of Functional Genomic Data T. M. Murali April 18, 2006 Motivation: Manual Systems Biology Biologists want to study a favourite stress, e.g., oxidative stress or

More information

Chapter 15 part 2. Biochemistry I Introduction to Metabolism Bioenergetics: Thermodynamics in Biochemistry. ATP 4- + H 2 O ADP 3- + P i + H +

Chapter 15 part 2. Biochemistry I Introduction to Metabolism Bioenergetics: Thermodynamics in Biochemistry. ATP 4- + H 2 O ADP 3- + P i + H + Biochemistry I Introduction to Metabolism Bioenergetics: Thermodynamics in Biochemistry ATP 4- + 2 ADP 3- + P i 2- + + Chapter 15 part 2 Dr. Ray 1 Energy flow in biological systems: Energy Transformations

More information

Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family

Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family Review: Gene Families Gene Families part 2 03 327/727 Lecture 8 What is a Case study: ian globin genes Gene trees and how they differ from species trees Homology, orthology, and paralogy Last tuesday 1

More information

You are required to know all terms defined in lecture. EXPLORE THE COURSE WEB SITE 1/6/2010 MENDEL AND MODELS

You are required to know all terms defined in lecture. EXPLORE THE COURSE WEB SITE 1/6/2010 MENDEL AND MODELS 1/6/2010 MENDEL AND MODELS!!! GENETIC TERMINOLOGY!!! Essential to the mastery of genetics is a thorough knowledge and understanding of the vocabulary of this science. New terms will be introduced and defined

More information

Whole-genome duplications and paleopolyploidy

Whole-genome duplications and paleopolyploidy Whole-genome duplications and paleopolyploidy Whole-genome duplications in protozoa Aury et al. (2006) analyzed the unicellular eukaryote Paramecium tetraurelia most of 40,000 genes arose through at least

More information

Chapter 2 Metabolic Networks and Their Evolution

Chapter 2 Metabolic Networks and Their Evolution Chapter 2 Metabolic Networks and Their Evolution Andreas Wagner Abstract Since the last decade of the twentieth century, systems biology has gained the ability to study the structure and function of genome-scale

More information

Quantitative Measurement of Genome-wide Protein Domain Co-occurrence of Transcription Factors

Quantitative Measurement of Genome-wide Protein Domain Co-occurrence of Transcription Factors Quantitative Measurement of Genome-wide Protein Domain Co-occurrence of Transcription Factors Arli Parikesit, Peter F. Stadler, Sonja J. Prohaska Bioinformatics Group Institute of Computer Science University

More information

Evidence for Evolution by Natural Selection. Raven Chapters 1 & 22

Evidence for Evolution by Natural Selection. Raven Chapters 1 & 22 Evidence for Evolution by Natural Selection Raven Chapters 1 & 22 2006-2007 Science happens within a culture What was the doctrine of the time? TINTORETTO The Creation of the Animals 1550 Then along comes

More information

Additions, Losses, and Rearrangements on the Evolutionary Route from a Reconstructed Ancestor to the Modern Saccharomyces cerevisiae Genome

Additions, Losses, and Rearrangements on the Evolutionary Route from a Reconstructed Ancestor to the Modern Saccharomyces cerevisiae Genome Additions, Losses, and Rearrangements on the Evolutionary Route from a Reconstructed Ancestor to the Modern Saccharomyces cerevisiae Genome Jonathan L. Gordon 1,2, Kevin P. Byrne 1, Kenneth H. Wolfe 1

More information

19/10/2015. Response to environmental manipulation. Its not as simple as it seems!

19/10/2015. Response to environmental manipulation. Its not as simple as it seems! Jackie Mitchell Department of Basic and Clinical Neuroscience - IoPPN Why do we need model genetic systems? What does it take to be a good model? Common in vivo model species Genetic manipulations (Lecture

More information

Cellular respiration. How do living things stay alive? Cellular Respiration Burning. Photosynthesis. Cellular Respiration

Cellular respiration. How do living things stay alive? Cellular Respiration Burning. Photosynthesis. Cellular Respiration How do living things stay alive? Cellular Respiration Burning Happens in ALL living things inside cells and has the main goal of producing ATP the fuel of life It does not matter whether the organisms

More information

2.A.2- Capture and Storage of Free Energy

2.A.2- Capture and Storage of Free Energy 2.A.2- Capture and Storage of Free Energy Big Idea 2: Biological systems utilize free energy and molecular building blocks to grow, to reproduce, and to maintain dynamic homeostasis. EU 2.A- Growth, reproduction

More information

Quantitative, scalable discrete event simulation of metabolic pathways

Quantitative, scalable discrete event simulation of metabolic pathways From: ISMB-99 Proceedings. Copyright 1999, AAAI (www.aaai.org). All rights reserved. Quantitative, scalable discrete event simulation of metabolic pathways Peter A. Meric Basser Department of Computer

More information

Biochemical Pathways

Biochemical Pathways Biochemical Pathways Living organisms can be divided into two large groups according to the chemical form in which they obtain carbon from the environment. Autotrophs can use carbon dioxide from the atmosphere

More information

GCE A level 1074/01 BIOLOGY BY4

GCE A level 1074/01 BIOLOGY BY4 Surname Centre Number Candidate Number Other Names 2 GCE A level 1074/01 BIOLOGY BY4 P.M. FRIDAY, 13 June 2014 1 hour 45 minutes For s use Question Maximum Mark Mark Awarded 1. 6 2. 7 1074 010001 3. 14

More information

Biological networks CS449 BIOINFORMATICS

Biological networks CS449 BIOINFORMATICS CS449 BIOINFORMATICS Biological networks Programming today is a race between software engineers striving to build bigger and better idiot-proof programs, and the Universe trying to produce bigger and better

More information

build stuff!! Stomates Warm-up Remember what it means to be a Photosynthesis: The Calvin Cycle Life from Air Autotrophs Light reactions

build stuff!! Stomates Warm-up Remember what it means to be a Photosynthesis: The Calvin Cycle Life from Air Autotrophs Light reactions Warm-up Objective: Describe how the chemical products of the light-trapping reactions couple to the synthesis of carbohydrates. Warm-up: What is the advantage of the light reaction producing H and ATP

More information

Giving you the energy you need!

Giving you the energy you need! Giving you the energy you need! Use your dominant hand Open and close the pin (with your thumb and forefinger) as many times as you can for 20 seconds while holding the other fingers straight out! Repeat

More information

Pyrobayes: an improved base caller for SNP discovery in pyrosequences

Pyrobayes: an improved base caller for SNP discovery in pyrosequences Pyrobayes: an improved base caller for SNP discovery in pyrosequences Aaron R Quinlan, Donald A Stewart, Michael P Strömberg & Gábor T Marth Supplementary figures and text: Supplementary Figure 1. The

More information

Oxidative Phosphorylation versus. Photophosphorylation

Oxidative Phosphorylation versus. Photophosphorylation Photosynthesis Oxidative Phosphorylation versus Photophosphorylation Oxidative Phosphorylation Electrons from the reduced cofactors NADH and FADH 2 are passed to proteins in the respiratory chain. In eukaryotes,

More information

Drosophila melanogaster and D. simulans, two fruit fly species that are nearly

Drosophila melanogaster and D. simulans, two fruit fly species that are nearly Comparative Genomics: Human versus chimpanzee 1. Introduction The chimpanzee is the closest living relative to humans. The two species are nearly identical in DNA sequence (>98% identity), yet vastly different

More information

Major Gene Families in Humans and Their Evolutionary History Prof. Yoshihito Niimura Prof. Masatoshi Nei

Major Gene Families in Humans and Their Evolutionary History Prof. Yoshihito Niimura Prof. Masatoshi Nei Major Gene Families in Humans Yoshihito Niimura Tokyo Medical and Dental University and Masatoshi Nei Pennsylvania State University 1 1. Multigene family Contents 2. Olfactory receptors (ORs) 3. OR genes

More information

BSC 4934: QʼBIC Capstone Workshop" Giri Narasimhan. ECS 254A; Phone: x3748

BSC 4934: QʼBIC Capstone Workshop Giri Narasimhan. ECS 254A; Phone: x3748 BSC 4934: QʼBIC Capstone Workshop" Giri Narasimhan ECS 254A; Phone: x3748 giri@cs.fiu.edu http://www.cs.fiu.edu/~giri/teach/bsc4934_su10.html July 2010 7/12/10 Q'BIC Bioinformatics 1 Overview of Course"

More information

Cellular Respiration. Mitochondria Rule! Mr. Kurt Kristensen

Cellular Respiration. Mitochondria Rule! Mr. Kurt Kristensen Cellular Respiration Mitochondria Rule! Mr. Kurt Kristensen Harvard Biovisions Mitochondria Summer Session Week 1: Cellular Respiration Students should. 1) Understand the locations, and functions of the

More information

WHERE DOES THE VARIATION COME FROM IN THE FIRST PLACE?

WHERE DOES THE VARIATION COME FROM IN THE FIRST PLACE? What factors contribute to phenotypic variation? The world s tallest man, Sultan Kosen (8 feet 1 inch) towers over the world s smallest, He Ping (2 feet 5 inches). WHERE DOES THE VARIATION COME FROM IN

More information

Be sure to understand:

Be sure to understand: Learning Targets & Focus Questions for Unit 6: Bioenergetics Chapter 8: Thermodynamics Chapter 9: Cell Resp Focus Q Ch. 10: Photosynthesis Chapter 8 (141-150) 1. I can explain how living systems adhere

More information

Applications of genome alignment

Applications of genome alignment Applications of genome alignment Comparing different genome assemblies Locating genome duplications and conserved segments Gene finding through comparative genomics Analyzing pathogenic bacteria against

More information

Networks in Biology. Protein-Protein-Interaction (PPI), Metabolic networks, Evolution

Networks in Biology. Protein-Protein-Interaction (PPI), Metabolic networks, Evolution Networks in Biology Protein-Protein-Interaction (PPI), Metabolic networks, Evolution Dr. Katja Nowick nowick@bioinf.uni-leipzig.de www.nowick-lab.info Summary last lecture TFs bind as monomers, homo-dimers,

More information

Alternative Pathways for CO 2 Assimilation in Photosynthetic Microorganisms

Alternative Pathways for CO 2 Assimilation in Photosynthetic Microorganisms Alternative Pathways for CO 2 Assimilation in Photosynthetic Microorganisms Robert E. Blankenship Washington University in St. Louis Departments of Biology and Chemistry Biological Capture & Utilization

More information

5/4/05 Biol 473 lecture

5/4/05 Biol 473 lecture 5/4/05 Biol 473 lecture animals shown: anomalocaris and hallucigenia 1 The Cambrian Explosion - 550 MYA THE BIG BANG OF ANIMAL EVOLUTION Cambrian explosion was characterized by the sudden and roughly simultaneous

More information

microrna Studies Chen-Hanson Ting SVFIG June 23, 2018

microrna Studies Chen-Hanson Ting SVFIG June 23, 2018 microrna Studies Chen-Hanson Ting SVFIG June 23, 2018 Summary MicroRNA (mirna) Species and organisms studied mirna in mitocondria Huge genome files mirna in human Chromosome 1 mirna in bacteria Tools used

More information

Formal TCA cycle description based on elementary actions

Formal TCA cycle description based on elementary actions Formal TCA cycle description based on elementary actions 145 Formal TCA cycle description based on elementary actions PIERRE MAZIÈRE 1,4, NICOLAS PARISEY 2,4, MARIE BEURTON-AIMAR 2,3,* and FRANCK MOLINA

More information

Introduction to Bioinformatics Integrated Science, 11/9/05

Introduction to Bioinformatics Integrated Science, 11/9/05 1 Introduction to Bioinformatics Integrated Science, 11/9/05 Morris Levy Biological Sciences Research: Evolutionary Ecology, Plant- Fungal Pathogen Interactions Coordinator: BIOL 495S/CS490B/STAT490B Introduction

More information

Lecture Materials are available on the 321 web site

Lecture Materials are available on the 321 web site MENDEL AND MODELS Explore the Course Web Site http://fire.biol.wwu.edu/trent/trent/biol321index.html Lecture Materials are available on the 321 web site http://fire.biol.wwu.edu/trent/trent/321lectureindex.html

More information

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Evaluation. Course Homepage.

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Evaluation. Course Homepage. CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 389; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs06.html 1/12/06 CAP5510/CGS5166 1 Evaluation

More information

Structural Analysis of Expanding Metabolic Networks

Structural Analysis of Expanding Metabolic Networks Genome Informatics 15(1): 35 45 (24) 35 Structural Analysis of Expanding Metabolic Networks Oliver Ebenhöh oliver.ebenhoeh@rz.hu-berlin.de Reinhart Heinrich reinhart.heinrich@rz.hu-berlin.de Thomas Handorf

More information

Transduction of Intracellular and Intercellular Dynamics in Yeast Glycolytic Oscillations

Transduction of Intracellular and Intercellular Dynamics in Yeast Glycolytic Oscillations Biophysical Journal Volume 78 March 2000 1145 1153 1145 Transduction of Intracellular and Intercellular Dynamics in Yeast Glycolytic Oscillations Jana Wolf,* Jutta Passarge,, Oscar J.G. Somsen, Jacky L.

More information