Genome Evolution Greg Lang, Department of Biological Sciences
|
|
- Justin Henderson
- 6 years ago
- Views:
Transcription
1 Genome Evolution Greg Lang, Department of Biological Sciences BioS 010: Bioscience in the 21st Century
2 Mechanisms of genome evolution Gene Duplication Genome Rearrangement Whole Genome Duplication
3 Gene number varies between species Species Saccharomyces cerevisiae Neurospora crassa Drosophila melanogaster Caenorhabditis elegans Homo sapiens Takifugu rubripes Arabadopsis thaliana Oryza sativa Populus trichocarpa Gene # 6,294 10,082 13,600 19,000 20, ,000 27, ,000 45,555
4 Fates of duplicated genes Dosage Subfunctionalization Neofunctionalization
5 Human opsin genes and trichromatic vision (a) In Out A P A V Q S T E T K S V T T S 348 A E Q Q E 240 D Q S D A 330 A P M S G N A T K F L T III C 140 A R VIII P K L E Q VI R V K R V F T N H II V V IV K K I N Q T G K Y V V A N C T K R T VII M F M L F Y V T V N L P I E N E K E Q G H V L T L L L I Y A L M L V G M I A G Q L V R T E C C M I A L N W S C Y I Y F V M I P I N F W T P N F L D A V I A L F A V I V V E V L G G M V I F I L A I L M F G F M I S T L L I V L W I K G F F A G F P V Y M F F G F A A P L A V Y A T A A C H F I C L V A P A V L P Y P F A T T T L E G T M L G C F V M S I Q F S T Y L M N F A I I Y A V G F F T W Y L S F I P W F G P E G P H T G Y F Y R S V N E I Y H F P T T D A E G I D Y 200 N Q E G S C P L G H E Y M C S Q Y Q V V III VI IV VII II VIII I P A E F P S R V V G T K N S F P V Y F N P G E T G N M 20 1 Terakita. Genome Biol. 2005;6(3):213.
6 Duplication of opsin genes in old-world primates Dulai et al. Genome Res Jul;9(7):
7 Trichromatic vision in howler monkeys Gilad et al. PLoS Biol Jan;2(1):E5.
8 Mechanisms of genome evolution Gene Duplication Genome Rearrangement Whole Genome Duplication
9 Genomes rearrange during evolution Mouse Genome Human Genome U.S. Department of Energy Human Genome Program:
10 The missing human chromosome Human 23 Chromosomes Chimpanzee 24 Chromosomes Gorilla 24 Chromosomes Orangutan 24 Chromosomes
11 Human Chromosome 2 arose through fusion Human Human Chromosome 2 Chimpanzee Gorilla Orangutan Yunis and Prakash. Science Mar 19;215(4539):
12 Genome rearrangement in cancer Bcr-Abl Philadelphia Chromosome Wikimedia Commons
13 Genome rearrangements as a genetic barrier
14 Engineering evolution to study speciation in yeast Delneri et al. Nature Mar 6;422(6927):68-72.
15 Engineering evolution to study speciation in yeast S. cerevisiae 90.3% 0.6% 88.9% S. mikatae Delneri et al. Nature Mar 6;422(6927):68-72.
16 Engineering evolution to study speciation in yeast S. cerevisiae S. cerevisiae - translocation 90.3% 88.8% 0.6% 88.9% S. mikatae Delneri et al. Nature Mar 6;422(6927):68-72.
17 Engineering evolution to study speciation in yeast S. cerevisiae S. cerevisiae - translocation 90.3% 60.4% 88.8% 0.6% 20.0% 88.9% S. mikatae Delneri et al. Nature Mar 6;422(6927):68-72.
18 Mechanisms of genome evolution Gene Duplication Genome Rearrangement Whole Genome Duplication
19 Evidence of two WGDs in vertebrate Hox clusters Swalla. Heredity Sep;97(3):
20 Gene number varies between species Species Saccharomyces cerevisiae Neurospora crassa Drosophila melanogaster Caenorhabditis elegans Homo sapiens Takifugu rubripes Arabadopsis thaliana Oryza sativa Populus trichocarpa Gene # 6,294 10,082 13,600 19,000 20, ,000 27, ,000 45,555
21 Genome rearrangements as a genetic barrier
22 Evidence for a whole-genome duplication in yeast Kellis et al. Nature Apr 8;428(6983):
23 Evidence for a whole-genome duplication in yeast Kellis et al. Nature Apr 8;428(6983):
24 Analysis of the whole-genome duplication in yeast Kellis et al. Nature Apr 8;428(6983):
25 Fates of duplicated genes Dosage Subfunctionalization Neofunctionalization
26 Subfunctionalization following WGD Hittinger and Carroll. Nature Oct 11;449(7163):
27 Increase in metabolic flux following WGD HXT## Key WGD duplications Glucose transport by numerous WGD duplicates in all proteins see table I post-wgd species WGD duplicates in S. cerevisiae, Glucose but not all post-wgd species Other duplications HXK2 HXK1 GLK1 EMI2 Glucose-6-phosphate PGI1 Ethanol Ethanol Fructose-6-phosphate ADH2 ADH1 ADH3 Glycolysis Fructose-1-6-bisphosphate Glyceraldehyde-3- phosphate TDH2 TDH1 TDH3 PFK1 3-Phospho-Dglyceroyl-phosphate PFK2 FBA1 DHAP TPI1 PDC5 ADH5 Acetaldehyde ALD6 Acetate PDC6 ACS1 ADH4 Acetaldehyde ALD5 ALD4 Acetate PGK1 3-Phosphoglycerate GPM1 Fermentation PDC1 ACS2 Acetyl-CoA GPM2 GPM3 2-Phosphoglycerate ENO1 ENO2 Phosphoenolpyruvate PDH complex Lipoamide LDP1 YPL017C Dihydrolipoamide LAT1 CDC19 PYK2 S-ADLA Pyruvate Respiration PDB1 Pyruvate PDA1 CoA PYC1 PYC2 Acetyl-CoA Cytosol Mitochondrion Oxaloacetic acid Malate FUM1 Fumarate SDH1 SDH2 SDH3 Oxaloacetic acid MDH2 CIT3 CIT1 YJL045W YMR118C CIT2 Cytosol Citrate ACO1 Isocitrate IDH2 SDH4 YLR164W IDH1 Succinate 2-Oxoglutarate LSC1 KGD1 LSC2 Succinyl-CoA KGD2 Succinyl-lipoate Conant and Wolfe. Mol Syst Biol. 2007;3:129.
28 Mechanisms of genome evolution Gene Duplication Dosage Subfunctionalization Neofunctionalization Genome Rearrangement Human Chromosome 2 Philadelphia Chromosome Species barriers Whole Genome Duplication Twice in vertebrates 100 MYA in yeast lineage
Meeting report Evolution enters the genomic era David A Liberles
http://genomebiology.com/2001/2/11/reports/4026.1 Meeting report Evolution enters the genomic era David A Liberles Address: Department of Biochemistry and Biophysics and Stockholm Bioinformatics Center,
More informationBioenergetics and high-energy compounds
Bioenergetics and high-energy compounds Tomáš Kučera tomas.kucera@lfmotol.cuni.cz Department of Medical Chemistry and Clinical Biochemistry 2nd Faculty of Medicine, Charles University in Prague and Motol
More informationCharacterization of the Metabolic Requirements in Yeast Meiosis
Characterization of the Metabolic Requirements in Yeast Meiosis Debjit Ray 1,2, Ping Ye 1,3 * 1 School of Molecular Biosciences, Washington State University, Pullman, Washington, United States of America,
More informationScience histogram was a mistake. This mistake was corrected in this manuscript.
Supplementary Note When the two genes for alcohol dehydrogenase (Adh 1 and Adh 2) are aligned, and the nucleotides at the silent sites of the two fold redundant codon systems compared, one discovers that
More informationCopyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. Outer Glycolysis mitochondrial membrane Glucose ATP
Fig. 7.5 uter Glycolysis mitochondrial membrane Glucose Intermembrane space xidation Mitochondrial matrix Acetyl-oA Krebs FAD e NAD + FAD Inner mitochondrial membrane e Electron e Transport hain hemiosmosis
More informationConstraint-Based Workshops
Constraint-Based Workshops 2. Reconstruction Databases November 29 th, 2007 Defining Metabolic Reactions ydbh hslj ldha 1st level: Primary metabolites LAC 2nd level: Neutral Formulas C 3 H 6 O 3 Charged
More informationLecture 10. Proton Gradient-dependent ATP Synthesis. Oxidative. Photo-Phosphorylation
Lecture 10 Proton Gradient-dependent ATP Synthesis Oxidative Phosphorylation Photo-Phosphorylation Model of the Electron Transport Chain (ETC) Glycerol-3-P Shuttle Outer Mitochondrial Membrane G3P DHAP
More informationBio-based route to the carbon-5 chemical glutaric acid and bio-polyamide PA6.5 using metabolically engineered Corynebacterium glutamicum
Electronic Supplementary Material (ESI) for Green Chemistry. This journal is The Royal Society of Chemistry 2018 Online Supplementary Information to: Bio-based route to the carbon-5 chemical glutaric acid
More information2015 AP Biology PRETEST Unit 3: Cellular Energetics Week of October
Name: Class: _ Date: _ 2015 AP Biology PRETEST Unit 3: Cellular Energetics Week of 19-23 October Multiple Choice Identify the choice that best completes the statement or answers the question. 1) Which
More informationChange to Office Hours this Friday and next Monday. Tomorrow (Abel): 8:30 10:30 am. Monday (Katrina): Cancelled (05/04)
Change to Office Hours this Friday and next Monday Tomorrow (Abel): 8:30 10:30 am Monday (Katrina): Cancelled (05/04) Lecture 10 Proton Gradient-dependent ATP Synthesis Oxidative Phosphorylation Photo-Phosphorylation
More informationBBS2710 Microbial Physiology. Module 5 - Energy and Metabolism
BBS2710 Microbial Physiology Module 5 - Energy and Metabolism Topics Energy production - an overview Fermentation Aerobic respiration Alternative approaches to respiration Photosynthesis Summary Introduction
More informationECOL/MCB 320 and 320H Genetics
ECOL/MCB 320 and 320H Genetics Instructors Dr. C. William Birky, Jr. Dept. of Ecology and Evolutionary Biology Lecturing on Molecular genetics Transmission genetics Population and evolutionary genetics
More informationMetabolic Adaptation after Whole Genome Duplication
MBE Advance Access published July 22, 2009 Metabolic Adaptation after Whole Genome Duplication submission is intended as Research Article Milan J.A. van Hoek and Paulien Hogeweg. Affiliation where research
More informationMULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question.
AP Exam Chapters 9 and 10; Photosynthesis and Respiration Name MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. 1) Carbon dioxide (CO2) is released
More informationThe Impact of Astrocyte Mitochondrial ATP Production on Neuroprotection After Stroke James D. Lechleiter, Ph.D., Professor
The Impact of Astrocyte Mitochondrial Production The Impact of Astrocyte Mitochondrial Production 1 Dept. of Cellular & Structural Biology University of Texas Health Science Center at San Antonio San Antonio,
More informationCHEM-E3215 Advanced Biochemistry
CHEM-E3215 Advanced Biochemistry 30. Jan. 2018 Prof. Silvan Scheller Lecture 10 Energy conservation general (some calculations) Energy conservation in anaerobes: e.g. methanogensis Life close to the thermodynamic
More information1) What is the one letter and the three letter abbreviations for the poly peptide shown
Lecture 1 Short problems 1) What is the one letter and the three letter abbreviations for the poly peptide shown 2) How many peptide bonds does this polypeptide possess? 3) Circle the peptide bonds 4)
More informationTowards integrated models of regulatory networks: the MetaGenoReg project
Towards integrated models of regulatory networks: the MetaGenoReg project Hidde de Jong and Daniel Kahn INRIA Grenoble - Rhône-Alpes Hidde.de-Jong@inria.fr http://ibis.inrialpes.fr LBBE, Université de
More informationComparing Genomes! Homologies and Families! Sequence Alignments!
Comparing Genomes! Homologies and Families! Sequence Alignments! Allows us to achieve a greater understanding of vertebrate evolution! Tells us what is common and what is unique between different species
More informationConstraint-based Metabolic Reconstructions & Analysis H. Scott Hinton. The Cobra Toolbox. Lesson: Cobra Toolbox
1 The Cobra Toolbox 2 Learning Objectives Each student should be able to: Explain the purpose of the Cobra Toolbox, Demonstrate basic operation of the Cobra Toolbox, Explain the BIGG Database, Explain
More informationGenetically Engineering Yeast to Understand Molecular Modes of Speciation
Genetically Engineering Yeast to Understand Molecular Modes of Speciation Mark Umbarger Biophysics 242 May 6, 2004 Abstract: An understanding of the molecular mechanisms of speciation (reproductive isolation)
More informationProcedure to Create NCBI KOGS
Procedure to Create NCBI KOGS full details in: Tatusov et al (2003) BMC Bioinformatics 4:41. 1. Detect and mask typical repetitive domains Reason: masking prevents spurious lumping of non-orthologs based
More informationSubsystem: TCA Cycle. List of Functional roles. Olga Vassieva 1 and Rick Stevens 2 1. FIG, 2 Argonne National Laboratory and University of Chicago
Subsystem: TCA Cycle Olga Vassieva 1 and Rick Stevens 2 1 FIG, 2 Argonne National Laboratory and University of Chicago List of Functional roles Tricarboxylic acid cycle (TCA) oxidizes acetyl-coa to CO
More informationVirtual mitochondria : metabolic modelling and control.
Virtual mitochondria : metabolic modelling and control. Marie Aimar-Beurton 1,, Bernard Korzeniewski 3, Thierry Letellier 1, Stéphane Ludinard 1, Jean-erre Mazat 1 and Christine Nazaret (alphabetical order)
More informationBIOINFORMATICS LAB AP BIOLOGY
BIOINFORMATICS LAB AP BIOLOGY Bioinformatics is the science of collecting and analyzing complex biological data. Bioinformatics combines computer science, statistics and biology to allow scientists to
More informationState state describe
Warm-Up State the products of the light-dependent reaction of photosynthesis, state which product has chemical energy, and describe how that product is made. KREBS ETC FADH 2 Glucose Pyruvate H 2 O NADH
More informationComputational Structural Bioinformatics
Computational Structural Bioinformatics ECS129 Instructor: Patrice Koehl http://koehllab.genomecenter.ucdavis.edu/teaching/ecs129 koehl@cs.ucdavis.edu Learning curve Math / CS Biology/ Chemistry Pre-requisite
More informationGlycolysis and Fermentation. Chapter 8
Glycolysis and Fermentation Chapter 8 Cellular Respiration and Photosynthesis 0 Things to know in these chapters 0 Names and order of the processes 0 Reactants and products of each process 0 How do they
More informationSupplementary Figure 3
Supplementary Figure 3 a 1 (i) (ii) (iii) (iv) (v) log P gene Q group, % ~ ε nominal 2 1 1 8 6 5 A B C D D' G J L M P R U + + ε~ A C B D D G JL M P R U -1 1 ε~ (vi) Z group 2 1 1 (vii) (viii) Z module
More informationSupplementary Information
1 Steady State Analysis of Genetic Regulatory Network incorporating underlying Molecular Mechanisms for Anaerobic Metabolism in Escherichia coli Sumana Srinivasan and K. V. Venkatesh Department of Chemical
More informationBio102 Problems Photosynthesis
Bio102 Problems Photosynthesis 1. Why is it advantageous for chloroplasts to have a very large (in surface area) thylakoid membrane contained within the inner membrane? A. This limits the amount of stroma
More informationRelated Courses He who asks is a fool for five minutes, but he who does not ask remains a fool forever.
CSE 527 Computational Biology http://www.cs.washington.edu/527 Lecture 1: Overview & Bio Review Autumn 2004 Larry Ruzzo Related Courses He who asks is a fool for five minutes, but he who does not ask remains
More informationMETABOLISM CHAPTER 04 BIO 211: ANATOMY & PHYSIOLOGY I. Dr. Lawrence G. Altman Some illustrations are courtesy of McGraw-Hill.
BIO 211: ANATOMY & PHYSIOLOGY I CHAPTER 04 1 Please wait 20 seconds before starting slide show. Mouse click or Arrow keys to navigate. Hit ESCAPE Key to exit. CELLULAR METABOLISM Dr. Lawrence G. Altman
More informationCELL METABOLISM OVERVIEW Keep the big picture in mind as we discuss the particulars!
BIO 211: ANATOMY & PHYSIOLOGY I CHAPTER 04 CELLULAR METABOLISM 1 Please wait 20 seconds before starting slide show. Mouse click or Arrow keys to navigate. Hit ESCAPE Key to exit. Dr. Lawrence G. Altman
More informationMETHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
More informationDO NOT WRITE ON THIS. Evidence from Evolution Activity. The Fossilization Process. Types of Fossils
Evidence from Evolution Activity Part 1 - Fossils Use the diagrams on the next page to answer the following questions IN YOUR NOTEBOOK. 1. Describe how fossils form. 2. Describe the different types of
More informationrespect to the wild type in the later stages of growth. Photograph showing representative plants after 5 and 10 weeks growth.
A Supplemental Data. Araújo et al. (211). Plant Cell 1.115/tpc.11.81224 C B.5 Supplemental Figure 1. Characterization and expression of tomato SDH2-2. (A) Dendogram of iron sulphur subunit of SDH. SDH2
More informationCellular Metabolism and Reproduction: Mitosis and Meiosis
C A T E R 4 Cellular Metabolism and Reproduction: Mitosis and Meiosis BJECTIVE After studying this chapter, you should be able to: 1. Define metabolism. 2. Describe the basic steps in glycolysis and indicate
More informationLecture Series 9 Cellular Pathways That Harvest Chemical Energy
Lecture Series 9 Cellular Pathways That Harvest Chemical Energy Reading Assignments Review Chapter 3 Energy, Catalysis, & Biosynthesis Read Chapter 13 How Cells obtain Energy from Food Read Chapter 14
More informationGenome-scale Gene Expression Analysis and Pathway Reconstruction in KEGG
Genome-scale Gene Expression Analysis and Pathway Reconstruction in KEGG Mitsuteru Nakao 1 Hidemasa Bono 1 Shuichi Kawashima 1 nakao@kuicr.kyoto-u.ac.jp bono@kuicr.kyoto-u.ac.jp shuichi@kuicr.kyoto-u.ac.jp
More informationSystem Reduction of Nonlinear Positive Systems by Linearization and Truncation
System Reduction of Nonlinear Positive Systems by Linearization and Truncation Hanna M. Härdin 1 and Jan H. van Schuppen 2 1 Department of Molecular Cell Physiology, Vrije Universiteit, De Boelelaan 1085,
More informationDescription of the algorithm for computing elementary flux modes
Description of the algorithm for computing elementary flux modes by Stefan Schuster, Thomas Dandekar,, and David Fell Department of Bioinformatics, Max Delbrück Centre for Molecular Medicine D-9 Berlin-Buch,
More information13. PG3 + ATP + NADH => GA3P + ADP + Pi + NAD +
Additional file 2. 1.1 Stochiometric model for P. pastoris containing some additional reactions from the 13 C model (section 1.2) Methanol metabolism 1. Metoh => Form 2. Form => FOR + NADH 3. FOR + NAD
More information11/24/13. Science, then, and now. Computational Structural Bioinformatics. Learning curve. ECS129 Instructor: Patrice Koehl
Computational Structural Bioinformatics ECS129 Instructor: Patrice Koehl http://www.cs.ucdavis.edu/~koehl/teaching/ecs129/index.html koehl@cs.ucdavis.edu Learning curve Math / CS Biology/ Chemistry Pre-requisite
More informationPrinciples of transcriptional control in the metabolic network of Saccharomyces cerevisiae
Principles of transcriptional control in the metabolic network of Saccharomyces cerevisiae Jan Ihmels 1,3,Ronen Levy 1,3 & Naama Barkai 1,2 Cellular networks are subject to extensive regulation, which
More informationAll organisms require a constant expenditure of energy to maintain the living state - "LIFE".
CELLULAR RESPIRATION All organisms require a constant expenditure of energy to maintain the living state - "LIFE". Where does the energy come from and how is it made available for life? With rare exception,
More informationPart II => PROTEINS and ENZYMES. 2.5 Enzyme Properties 2.5a Enzyme Nomenclature 2.5b Transition State Theory
Part II => PROTEINS and ENZYMES 2.5 Enzyme Properties 2.5a Enzyme Nomenclature 2.5b Transition State Theory Section 2.5a: Enzyme Nomenclature Synopsis 2.5a - Enzymes are biological catalysts they are almost
More informationIntroduction of Biotechnology
Handai Cyber University Introduction of Biotechnology No.5:Genome biotechnology and yeast Graduate School of Engineering, Osaka University Graduate School of Information Science, Osaka University 1 International
More informationLectures by Kathleen Fitzpatrick
Chapter 10 Chemotrophic Energy Metabolism: Aerobic Respiration Lectures by Kathleen Fitzpatrick Simon Fraser University Figure 10-1 Figure 10-6 Conversion of pyruvate The conversion of pyruvate to acetyl
More informationReconstruction and Analysis of Metabolic Networks
1 Reconstruction and Analysis of Metabolic Networks 2 Outline What is a Reconstruction? Data Collection Interactions Between Network Components Special Considerations Applications Genome-scale Metabolic
More informationRESPIRATION AND FERMENTATION: AEROBIC AND ANAEROBIC OXIDATION OF ORGANIC MOLECULES. Bio 107 Week 6
RESPIRATION AND FERMENTATION: AEROBIC AND ANAEROBIC OXIDATION OF ORGANIC MOLECULES Bio 107 Week 6 Procedure 7.2 Label test tubes well, including group name 1) Add solutions listed to small test tubes 2)
More informationNUCLEOTIDE SUBSTITUTIONS AND THE EVOLUTION OF DUPLICATE GENES
Conery, J.S. and Lynch, M. Nucleotide substitutions and evolution of duplicate genes. Pacific Symposium on Biocomputing 6:167-178 (2001). NUCLEOTIDE SUBSTITUTIONS AND THE EVOLUTION OF DUPLICATE GENES JOHN
More informationHomolog. Orthologue. Comparative Genomics. Paralog. What is Comparative Genomics. What is Comparative Genomics
Orthologue Orthologs are genes in different species that evolved from a common ancestral gene by speciation. Normally, orthologs retain the same function in the course of evolution. Identification of orthologs
More informationChapter 5. The Chloroplast. 5.1 Matter and Energy Pathways in Living Systems. Photosynthesis & Cellular Respiration
Chapter 5 Photosynthesis & Cellular Respiration 5.1 Matter and Energy Pathways in Living Systems Both cellular respiration and photosynthesis are examples of biological processes that involve matter &
More informationPhotosynthesis and cellular respirations
The Introduction of Biology Defining of life Basic chemistry, the chemistry of organic molecules Classification of living things History of cells and Cells structures and functions Photosynthesis and cellular
More informationletter Systematic screen for human disease genes in yeast a b c
Systematic screen for human disease genes in yeast Lars M. Steinmetz,3 *, Curt Scharfe 2,3 *, Adam M. Deutschbauer, Dejana Mokranjac 4, Zelek S. Herman 3, Ted Jones 3, Angela M. Chu 2, Guri Giaever 3,
More informationDivergence Pattern of Duplicate Genes in Protein-Protein Interactions Follows the Power Law
Divergence Pattern of Duplicate Genes in Protein-Protein Interactions Follows the Power Law Ze Zhang,* Z. W. Luo,* Hirohisa Kishino,à and Mike J. Kearsey *School of Biosciences, University of Birmingham,
More informationImpact of recurrent gene duplication on adaptation of plant genomes
Impact of recurrent gene duplication on adaptation of plant genomes Iris Fischer, Jacques Dainat, Vincent Ranwez, Sylvain Glémin, Jacques David, Jean-François Dufayard, Nathalie Chantret Plant Genomes
More informationIntroduction to cells
Almen Cellebiologi Introduction to cells 1. Unity and diversity of cells 2. Microscopes and visualization of cells 3. Prokaryotic cells, eubacteria and archaea 4. Eucaryotic cells, nucleus, mitochondria
More informationPhotosynthesis and Cellular Respiration
Name Date Class CHAPTER 5 DIRECTED READING Photosynthesis and Cellular Respiration Section 5-1: Energy and Living Things Energy Flows Between Organisms in Living Systems In the space provided, write the
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationPhylogenetics in the Age of Genomics: Prospects and Challenges
Phylogenetics in the Age of Genomics: Prospects and Challenges Antonis Rokas Department of Biological Sciences, Vanderbilt University http://as.vanderbilt.edu/rokaslab http://pubmed2wordle.appspot.com/
More informationLesson Topic Learning Goals
Unit 2: Evolution Part B Lesson Topic Learning Goals 1 Lab Mechanisms of Evolution Cumulative Selection - Be able to describe evolutionary mechanisms such as genetic variations and key factors that lead
More informationActiveNetworks Cross-Condition Analysis of Functional Genomic Data
ActiveNetworks Cross-Condition Analysis of Functional Genomic Data T. M. Murali April 18, 2006 Motivation: Manual Systems Biology Biologists want to study a favourite stress, e.g., oxidative stress or
More informationChapter 15 part 2. Biochemistry I Introduction to Metabolism Bioenergetics: Thermodynamics in Biochemistry. ATP 4- + H 2 O ADP 3- + P i + H +
Biochemistry I Introduction to Metabolism Bioenergetics: Thermodynamics in Biochemistry ATP 4- + 2 ADP 3- + P i 2- + + Chapter 15 part 2 Dr. Ray 1 Energy flow in biological systems: Energy Transformations
More informationGene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family
Review: Gene Families Gene Families part 2 03 327/727 Lecture 8 What is a Case study: ian globin genes Gene trees and how they differ from species trees Homology, orthology, and paralogy Last tuesday 1
More informationYou are required to know all terms defined in lecture. EXPLORE THE COURSE WEB SITE 1/6/2010 MENDEL AND MODELS
1/6/2010 MENDEL AND MODELS!!! GENETIC TERMINOLOGY!!! Essential to the mastery of genetics is a thorough knowledge and understanding of the vocabulary of this science. New terms will be introduced and defined
More informationWhole-genome duplications and paleopolyploidy
Whole-genome duplications and paleopolyploidy Whole-genome duplications in protozoa Aury et al. (2006) analyzed the unicellular eukaryote Paramecium tetraurelia most of 40,000 genes arose through at least
More informationChapter 2 Metabolic Networks and Their Evolution
Chapter 2 Metabolic Networks and Their Evolution Andreas Wagner Abstract Since the last decade of the twentieth century, systems biology has gained the ability to study the structure and function of genome-scale
More informationQuantitative Measurement of Genome-wide Protein Domain Co-occurrence of Transcription Factors
Quantitative Measurement of Genome-wide Protein Domain Co-occurrence of Transcription Factors Arli Parikesit, Peter F. Stadler, Sonja J. Prohaska Bioinformatics Group Institute of Computer Science University
More informationEvidence for Evolution by Natural Selection. Raven Chapters 1 & 22
Evidence for Evolution by Natural Selection Raven Chapters 1 & 22 2006-2007 Science happens within a culture What was the doctrine of the time? TINTORETTO The Creation of the Animals 1550 Then along comes
More informationAdditions, Losses, and Rearrangements on the Evolutionary Route from a Reconstructed Ancestor to the Modern Saccharomyces cerevisiae Genome
Additions, Losses, and Rearrangements on the Evolutionary Route from a Reconstructed Ancestor to the Modern Saccharomyces cerevisiae Genome Jonathan L. Gordon 1,2, Kevin P. Byrne 1, Kenneth H. Wolfe 1
More information19/10/2015. Response to environmental manipulation. Its not as simple as it seems!
Jackie Mitchell Department of Basic and Clinical Neuroscience - IoPPN Why do we need model genetic systems? What does it take to be a good model? Common in vivo model species Genetic manipulations (Lecture
More informationCellular respiration. How do living things stay alive? Cellular Respiration Burning. Photosynthesis. Cellular Respiration
How do living things stay alive? Cellular Respiration Burning Happens in ALL living things inside cells and has the main goal of producing ATP the fuel of life It does not matter whether the organisms
More information2.A.2- Capture and Storage of Free Energy
2.A.2- Capture and Storage of Free Energy Big Idea 2: Biological systems utilize free energy and molecular building blocks to grow, to reproduce, and to maintain dynamic homeostasis. EU 2.A- Growth, reproduction
More informationQuantitative, scalable discrete event simulation of metabolic pathways
From: ISMB-99 Proceedings. Copyright 1999, AAAI (www.aaai.org). All rights reserved. Quantitative, scalable discrete event simulation of metabolic pathways Peter A. Meric Basser Department of Computer
More informationBiochemical Pathways
Biochemical Pathways Living organisms can be divided into two large groups according to the chemical form in which they obtain carbon from the environment. Autotrophs can use carbon dioxide from the atmosphere
More informationGCE A level 1074/01 BIOLOGY BY4
Surname Centre Number Candidate Number Other Names 2 GCE A level 1074/01 BIOLOGY BY4 P.M. FRIDAY, 13 June 2014 1 hour 45 minutes For s use Question Maximum Mark Mark Awarded 1. 6 2. 7 1074 010001 3. 14
More informationBiological networks CS449 BIOINFORMATICS
CS449 BIOINFORMATICS Biological networks Programming today is a race between software engineers striving to build bigger and better idiot-proof programs, and the Universe trying to produce bigger and better
More informationbuild stuff!! Stomates Warm-up Remember what it means to be a Photosynthesis: The Calvin Cycle Life from Air Autotrophs Light reactions
Warm-up Objective: Describe how the chemical products of the light-trapping reactions couple to the synthesis of carbohydrates. Warm-up: What is the advantage of the light reaction producing H and ATP
More informationGiving you the energy you need!
Giving you the energy you need! Use your dominant hand Open and close the pin (with your thumb and forefinger) as many times as you can for 20 seconds while holding the other fingers straight out! Repeat
More informationPyrobayes: an improved base caller for SNP discovery in pyrosequences
Pyrobayes: an improved base caller for SNP discovery in pyrosequences Aaron R Quinlan, Donald A Stewart, Michael P Strömberg & Gábor T Marth Supplementary figures and text: Supplementary Figure 1. The
More informationOxidative Phosphorylation versus. Photophosphorylation
Photosynthesis Oxidative Phosphorylation versus Photophosphorylation Oxidative Phosphorylation Electrons from the reduced cofactors NADH and FADH 2 are passed to proteins in the respiratory chain. In eukaryotes,
More informationDrosophila melanogaster and D. simulans, two fruit fly species that are nearly
Comparative Genomics: Human versus chimpanzee 1. Introduction The chimpanzee is the closest living relative to humans. The two species are nearly identical in DNA sequence (>98% identity), yet vastly different
More informationMajor Gene Families in Humans and Their Evolutionary History Prof. Yoshihito Niimura Prof. Masatoshi Nei
Major Gene Families in Humans Yoshihito Niimura Tokyo Medical and Dental University and Masatoshi Nei Pennsylvania State University 1 1. Multigene family Contents 2. Olfactory receptors (ORs) 3. OR genes
More informationBSC 4934: QʼBIC Capstone Workshop" Giri Narasimhan. ECS 254A; Phone: x3748
BSC 4934: QʼBIC Capstone Workshop" Giri Narasimhan ECS 254A; Phone: x3748 giri@cs.fiu.edu http://www.cs.fiu.edu/~giri/teach/bsc4934_su10.html July 2010 7/12/10 Q'BIC Bioinformatics 1 Overview of Course"
More informationCellular Respiration. Mitochondria Rule! Mr. Kurt Kristensen
Cellular Respiration Mitochondria Rule! Mr. Kurt Kristensen Harvard Biovisions Mitochondria Summer Session Week 1: Cellular Respiration Students should. 1) Understand the locations, and functions of the
More informationWHERE DOES THE VARIATION COME FROM IN THE FIRST PLACE?
What factors contribute to phenotypic variation? The world s tallest man, Sultan Kosen (8 feet 1 inch) towers over the world s smallest, He Ping (2 feet 5 inches). WHERE DOES THE VARIATION COME FROM IN
More informationBe sure to understand:
Learning Targets & Focus Questions for Unit 6: Bioenergetics Chapter 8: Thermodynamics Chapter 9: Cell Resp Focus Q Ch. 10: Photosynthesis Chapter 8 (141-150) 1. I can explain how living systems adhere
More informationApplications of genome alignment
Applications of genome alignment Comparing different genome assemblies Locating genome duplications and conserved segments Gene finding through comparative genomics Analyzing pathogenic bacteria against
More informationNetworks in Biology. Protein-Protein-Interaction (PPI), Metabolic networks, Evolution
Networks in Biology Protein-Protein-Interaction (PPI), Metabolic networks, Evolution Dr. Katja Nowick nowick@bioinf.uni-leipzig.de www.nowick-lab.info Summary last lecture TFs bind as monomers, homo-dimers,
More informationAlternative Pathways for CO 2 Assimilation in Photosynthetic Microorganisms
Alternative Pathways for CO 2 Assimilation in Photosynthetic Microorganisms Robert E. Blankenship Washington University in St. Louis Departments of Biology and Chemistry Biological Capture & Utilization
More information5/4/05 Biol 473 lecture
5/4/05 Biol 473 lecture animals shown: anomalocaris and hallucigenia 1 The Cambrian Explosion - 550 MYA THE BIG BANG OF ANIMAL EVOLUTION Cambrian explosion was characterized by the sudden and roughly simultaneous
More informationmicrorna Studies Chen-Hanson Ting SVFIG June 23, 2018
microrna Studies Chen-Hanson Ting SVFIG June 23, 2018 Summary MicroRNA (mirna) Species and organisms studied mirna in mitocondria Huge genome files mirna in human Chromosome 1 mirna in bacteria Tools used
More informationFormal TCA cycle description based on elementary actions
Formal TCA cycle description based on elementary actions 145 Formal TCA cycle description based on elementary actions PIERRE MAZIÈRE 1,4, NICOLAS PARISEY 2,4, MARIE BEURTON-AIMAR 2,3,* and FRANCK MOLINA
More informationIntroduction to Bioinformatics Integrated Science, 11/9/05
1 Introduction to Bioinformatics Integrated Science, 11/9/05 Morris Levy Biological Sciences Research: Evolutionary Ecology, Plant- Fungal Pathogen Interactions Coordinator: BIOL 495S/CS490B/STAT490B Introduction
More informationLecture Materials are available on the 321 web site
MENDEL AND MODELS Explore the Course Web Site http://fire.biol.wwu.edu/trent/trent/biol321index.html Lecture Materials are available on the 321 web site http://fire.biol.wwu.edu/trent/trent/321lectureindex.html
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Evaluation. Course Homepage.
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 389; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs06.html 1/12/06 CAP5510/CGS5166 1 Evaluation
More informationStructural Analysis of Expanding Metabolic Networks
Genome Informatics 15(1): 35 45 (24) 35 Structural Analysis of Expanding Metabolic Networks Oliver Ebenhöh oliver.ebenhoeh@rz.hu-berlin.de Reinhart Heinrich reinhart.heinrich@rz.hu-berlin.de Thomas Handorf
More informationTransduction of Intracellular and Intercellular Dynamics in Yeast Glycolytic Oscillations
Biophysical Journal Volume 78 March 2000 1145 1153 1145 Transduction of Intracellular and Intercellular Dynamics in Yeast Glycolytic Oscillations Jana Wolf,* Jutta Passarge,, Oscar J.G. Somsen, Jacky L.
More information