5/4/05 Biol 473 lecture

Save this PDF as:

Size: px
Start display at page:

Download "5/4/05 Biol 473 lecture"


1 5/4/05 Biol 473 lecture animals shown: anomalocaris and hallucigenia 1

2 The Cambrian Explosion MYA THE BIG BANG OF ANIMAL EVOLUTION Cambrian explosion was characterized by the sudden and roughly simultaneous appearance in the fossil record of many diverse animal forms MYA. No other period in the history of life can match this remarkable burst of evolutionary creativity Marks the appearance of abundant life as recorded by an abundance of marine fossil life Marks the appearance of invertebrates with mineralized (calcium carbonate) skeletons [on formerly soft-bodied organisms] The Cambrian Explosion: Before and After What major adaptive features were in place before the Cambrian explosion? 2

3 What major adaptive features were in place before the Cambrian explosion? Before and after the event all life lived in the oceans The major adaptive features that were already present: 1. eukaryotic cell 2. sexual reproduction 3. multi-cellular organisms with soft bodies 3

4 No other period in the history of life can match this remarkable burst of evolutionary creativity BILATERAL ANIMALS WITH LIGHT SENSING ORGANS APPEARED Opabinia (lower right) has five eyestalks! 4

5 hallucigenia and Opabinia Animals appeared in the fossil record with a clearly distinguished front end and back end TRILOBITE The body plans of all major extant animal phyla arose during this time period. Many different lineages acquired complex anatomies and hard parts (the exoskeleton) at the same time 5

6 What factors triggered the Cambrian explosion? The Cambrian record of life is in sharp contrast with that of the preceeding eons The Cambrian appearance of fossils representing diverse phyla has inspired hypotheses about possible genetic or environmental catalysts of early animal evolution: The genetic toolkit hypothesis o The Cambrian explosion was ignited by the evolution of a modern genetic toolkit that was complex enough to facilitate elaborate diversification of body plans The environment/ecological hypothesis o The genetic toolkit was in place well before the Cambrian radiation (that is predated the Paleozoic Era) o The Cambrian explosion was triggered by environmental perturbations and amplified by ecological interactions within reorganized ecosystems 6

7 What is meant by the Genetic Toolkit? Housekeeping genes: genes that encode proteins that function in essential processes in all cells in the body Such as? Roomkeeping genes: Other genes encode proteins that carry out specialized functions in particular cells or issues Such as? The genetic toolkit: genes that govern the construction of the house Or in other words whose protein products determine the overall body plan and the number, identity and pattern of body parts How to identify such genes? What are the Old and new paradigms? 7

8 Old and new paradigms: 1. the geneticist: search for developmental monsters 2. the biochemist: reconstruct in vitro -- obvious problems here WHY? 3. molecular biologist: let some else do the bench work and use genomic sequence to find genes of interest in your organism of interest 8

9 Critical Features of the Toolkit OR What we know so far 1. The toolkit is composed of a small fraction of all genes 2. Most toolkit genes encode transcription factors or components of signaling pathways and act directly or indirectly to control the expression of other genes 3. The spatial expression of toolkit genes is often closely correlated with the region of the animal in which the gene functions 4. Toolkit genes can be classified according to the phenotypes caused by their mutation: o body axis specification o formation and identity of spatial fields o specification of a specific organ (such as the eye) 5. Many toolkit genes are widely conserved among different animal phyla 9

10 Many members of the genetic toolkit are homeobox or zinc finger genes Genome-wide analysis of DNA-binding motifs found in eukaryotic transcription factors 10

11 The homeobox family: a transcription factor family homeodomain is a ~60 amino acid sequence containing many basic residues forms a helix-turn-helix motif that binds specific sequences in DNA the homeodomain is coded for by the homeobox region of the gene Helix-3 contacts the major groove. The specific amino acid sequence of helix-3 determines the DNA binding specificity of the homeodomain protein Protein:DNA complexes: picture and movie gallery 11

12 Homeodomains are highly similar 60 amino acid regions of proteins made by all homeobox gene.. Deviations from the consensus are shown for four fly (top line) and mouse (bottom line) homeodomain proteins. A dash means the sequence matches that of the consensus. All homeobox genes contain the conserved homeobox region. Outside the homeobox, there may be very little sequence conservation between two homeobox genes 12

13 Homeotic genes homeobox originally named for Drosophila homeotic genes: mutations in these genes transform one body part into another genes with a homeobox often are involved as developmental regulators, but possession of a homeodomain does not guarantee a role in development not all mutants are homeotic bithorax mutant phenotype Homeotic genes are part of a hierarchy of regulators that define spatial location in the developing fly embryo If building an embryo, what are the first decisions that need to be made? 13

14 A subset of homeobox genes are called the HOX genes o found in linked clusters o role in specifying location along the AP axis AP/DV genes: homeobox genes, zinc fingers, signal transduction genes Segmentation genes: zinc fingers, homeobox genes HOX gene control the expression of each other and genes necessary for assembling the specialized structures and tissue in each segment 14

15 OK, so what does this tell us about the molecular definition of spatial identity in other animals such as vertebrates? 15

16 16

17 Remarkable observations: 1. Homeobox-containing genes have been found in all metazoan organisms examined as well as in yeast and plants 2. In all metazoans, a subset* of the homeobox genes are organized into gene clusters that are colinear with the Drosophila gene clusters (next figure). Thse clusters are called HOX complexes 3. The relative order of a gene within each vertebrate HOX complex is correlated with its spatial expression along the anteroposterior body axis (next figure) 4. *Orphan homeobox genes are not part of the HOX complex 17

18 In the mouse embryo, four complexes of HOX genes (39 genes in all) occur on four different chromosomes. Not every gene is represented in every complex. The HOX genes are expressed in distinct domains along the AP axis SEE also Watson Box

19 Homeodomain Consensus sequence at top of figure For each box: first line is a fly homeodomain and the second line is a mouse homeodomain. In each box, the homeodomains are more closely related in sequence to each other than they are to other homodomains from the same organism Numbering of mouse genes is different from the preceding figure 19

20 HOX genes are widely conserved among different animal phyla 20

21 The genetic toolkit: genes that govern the construction of the house: or in other words whose protein products determine the overall body plan and the number, identity and pattern of body parts Many toolkit genes are widely conserved among different animal phyla The striking correspondence between the gene clusters in flies and mammals and other animals suggests that they represent the descendants of an ancestral cluster of homeobox genes already present in the common ancestor of insects and vertebrates and other bilateral organisms -- which would have predated the Cambrian explosion 21

22 So what did the genetic toolkit look like for the last common ancestor of all bilaterally symmetric organisms? What other genes are shared by all descendants? Rebuilding Urbilateria: the hypothetical last common ancestor of all bilaterans 22

23 A plausible chronology for animal locomotory abilities, visual function and the occurrence of master control genes. The need for fast locomotion and vision are likely to have originated during the Cambrian explosion, whereas master control genes in general would have been needed much earlier. Bilaterally symmetric animals with priminent eyes appeared suddenly in the fossil record from the Cambrian explosion Eyes were image-forming and vision was binocular 23

Animal Origins and Evolution

Animal Origins and Evolution Animal Origins and Evolution Common Features of Animals multicellular heterotrophic motile Sexual reproduction, embryo Evolution of Animals All animals are multicellular and heterotrophic, which means

More information

8/23/2014. Introduction to Animal Diversity

8/23/2014. Introduction to Animal Diversity Introduction to Animal Diversity Chapter 32 Objectives List the characteristics that combine to define animals Summarize key events of the Paleozoic, Mesozoic, and Cenozoic eras Distinguish between the

More information

Lecture 7. Development of the Fruit Fly Drosophila

Lecture 7. Development of the Fruit Fly Drosophila BIOLOGY 205/SECTION 7 DEVELOPMENT- LILJEGREN Lecture 7 Development of the Fruit Fly Drosophila 1. The fruit fly- a highly successful, specialized organism a. Quick life cycle includes three larval stages

More information

Chapter Study Guide Section 17-1 The Fossil Record (pages )

Chapter Study Guide Section 17-1 The Fossil Record (pages ) Name Class Date Chapter Study Guide Section 17-1 The Fossil Record (pages 417-422) Key Concepts What is the fossil record? What information do relative dating and radioactive dating provide about fossils?

More information

SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology

SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of

More information

Evidence of Evolution. Lesson Overview. Lesson Overview Evidence of Evolution

Evidence of Evolution. Lesson Overview. Lesson Overview Evidence of Evolution Lesson Overview Lesson Overview 16.4 THINK ABOUT IT Scientists in some fields, including geology, physics, paleontology, chemistry, and embryology, did not have the technology or understanding to test

More information

Evolution and diversity of organisms

Evolution and diversity of organisms Evolution and diversity of organisms Competency Levels - 7 3.1.1 Uses the theories of origin of life and natural selection to analyze the process of evolution of life 3.2.1 Constructs hierarchy of taxa

More information

The History of Life. Fossils and Ancient Life (page 417) How Fossils Form (page 418) Interpreting Fossil Evidence (pages ) Chapter 17

The History of Life. Fossils and Ancient Life (page 417) How Fossils Form (page 418) Interpreting Fossil Evidence (pages ) Chapter 17 Chapter 17 The History of Life Section 17 1 The Fossil Record (pages 417 422) This section explains how fossils form and how they can be interpreted. It also describes the geologic time scale that is used

More information

16.4 Evidence of Evolution

16.4 Evidence of Evolution 16.4 Evidence of Evolution Lesson Objectives Explain how geologic distribution of species relates to their evolutionary history. Explain how fossils and the fossil record document the descent of modern

More information

Why Flies? stages of embryogenesis. The Fly in History

Why Flies? stages of embryogenesis. The Fly in History The Fly in History 1859 Darwin 1866 Mendel c. 1890 Driesch, Roux (experimental embryology) 1900 rediscovery of Mendel (birth of genetics) 1910 first mutant (white) (Morgan) 1913 first genetic map (Sturtevant

More information


MOLECULAR CONTROL OF EMBRYONIC PATTERN FORMATION MOLECULAR CONTROL OF EMBRYONIC PATTERN FORMATION Drosophila is the best understood of all developmental systems, especially at the genetic level, and although it is an invertebrate it has had an enormous

More information

Big Idea 1: The process of evolution drives the diversity and unity of life.

Big Idea 1: The process of evolution drives the diversity and unity of life. Big Idea 1: The process of evolution drives the diversity and unity of life. understanding 1.A: Change in the genetic makeup of a population over time is evolution. 1.A.1: Natural selection is a major

More information

I. Molecules & Cells. A. Unit One: The Nature of Science. B. Unit Two: The Chemistry of Life. C. Unit Three: The Biology of the Cell.

I. Molecules & Cells. A. Unit One: The Nature of Science. B. Unit Two: The Chemistry of Life. C. Unit Three: The Biology of the Cell. I. Molecules & Cells A. Unit One: The Nature of Science a. How is the scientific method used to solve problems? b. What is the importance of controls? c. How does Darwin s theory of evolution illustrate

More information

Evolutionary change. Evolution and Diversity. Two British naturalists, one revolutionary idea. Darwin observed organisms in many environments

Evolutionary change. Evolution and Diversity. Two British naturalists, one revolutionary idea. Darwin observed organisms in many environments Evolutionary change Evolution and Diversity Ch 13 How populations evolve Organisms change over time In baby steps Species (including humans) are descended from other species Two British naturalists, one

More information

Chapter 1 Biology: Exploring Life

Chapter 1 Biology: Exploring Life Chapter 1 Biology: Exploring Life PowerPoint Lectures for Campbell Biology: Concepts & Connections, Seventh Edition Reece, Taylor, Simon, and Dickey Lecture by Edward J. Zalisko Figure 1.0_1 Chapter 1:

More information

Classification and Phylogeny

Classification and Phylogeny Classification and Phylogeny The diversity it of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme

More information

Genes, Development, and Evolution

Genes, Development, and Evolution 14 Genes, Development, and Evolution Chapter 14 Genes, Development, and Evolution Key Concepts 14.1 Development Involves Distinct but Overlapping Processes 14.2 Changes in Gene Expression Underlie Cell

More information

Evolution Common Assessment 1

Evolution Common Assessment 1 Evolution Common Assessment 1 1. The field of biology that includes the study of the origin of new species through time is known as 5. A. biochemistry B. evolution C. ecology D. embryology 2. Evidence

More information

Chapter 27: Evolutionary Genetics

Chapter 27: Evolutionary Genetics Chapter 27: Evolutionary Genetics Student Learning Objectives Upon completion of this chapter you should be able to: 1. Understand what the term species means to biology. 2. Recognize the various patterns

More information

Evidence for Evolution by Natural Selection Regents Biology

Evidence for Evolution by Natural Selection Regents Biology Evidence for Evolution by Natural Selection Objective: Determine the different types of evidence for proving evolution Evidence supporting evolution Fossil record shows change over time Comparative Anatomy

More information

Identify stages of plant life cycle Botany Oral/written pres, exams

Identify stages of plant life cycle Botany Oral/written pres, exams DPI Standards Biology Education (for students) 1. Characteristics of organisms Know Properties of living organisms, including: Acquire and use energy and materials Sense and respond to stimuli Reproduce

More information

Origins of Life. Fundamental Properties of Life. The Tree of Life. Chapter 26

Origins of Life. Fundamental Properties of Life. The Tree of Life. Chapter 26 Origins of Life The Tree of Life Cell is the basic unit of life Today all cells come from pre-existing cells Earth formed ~4.5 billion years ago (BYA) Chapter 26 As it cooled, chemically-rich oceans were

More information

Evolution of the Skeleton

Evolution of the Skeleton Evolution of the Skeleton Reading Benton Chapter 5 The Vertebrate Archetype (Richard Owen) Next week Tuesday (17 Sept): Paper Discussion Purnell, M. A. 2001. Scenarios, selection and the ecology of early

More information

16.4 The Evidence of Evolution. Adapted from following Materials; Biology,Miller & Levine (2010) Understanding Evolution (evolution.berkely.

16.4 The Evidence of Evolution. Adapted from following Materials; Biology,Miller & Levine (2010) Understanding Evolution (evolution.berkely. 16.4 The Evidence of Evolution Adapted from following Materials; Biology,Miller & Levine (2010) Understanding Evolution (evolution.berkely.edu) Guiding Question: What are the main lines of scientific evidence

More information

Computer Simulations on Evolution BiologyLabs On-line. Laboratory 1 for Section B. Laboratory 2 for Section A

Computer Simulations on Evolution BiologyLabs On-line. Laboratory 1 for Section B. Laboratory 2 for Section A Computer Simulations on Evolution BiologyLabs On-line Laboratory 1 for Section B Laboratory 2 for Section A The following was taken from http://www.biologylabsonline.com/protected/evolutionlab/ Introduction

More information

Vocab Darwin & Evolution (Chap 15)

Vocab Darwin & Evolution (Chap 15) Vocab Darwin & Evolution (Chap 15) 1. Evolution 2. Theory 3. Charles Darwin 4. Fossil 5. Species 6. Natural variation 7. Artificial selection 8. Struggle for existence 9. Fitness 10.Adaptation 11.Survival

More information

The Characteristics of Life. AP Biology Notes: #1

The Characteristics of Life. AP Biology Notes: #1 The Characteristics of Life AP Biology Notes: #1 Life s Diversity & Unity Life has extensive diversity. Despite its diversity, all living things are composed of the same chemical elements that make-up

More information

AP Biology Notes Outline Enduring Understanding 1.C. Big Idea 1: The process of evolution drives the diversity and unity of life.

AP Biology Notes Outline Enduring Understanding 1.C. Big Idea 1: The process of evolution drives the diversity and unity of life. AP Biology Notes Outline Enduring Understanding 1.C Big Idea 1: The process of evolution drives the diversity and unity of life. Enduring Understanding 1.C: Life continues to evolve within a changing environment.

More information

McDougal Littell Science, Cells and Heredity MAZER PDF. IL Essential Lesson. IL Extend Lesson. Program Planning Guide LP page.

McDougal Littell Science, Cells and Heredity MAZER PDF. IL Essential Lesson. IL Extend Lesson. Program Planning Guide LP page. s7an-ppg-pc-il-002-012.indd 2 7/18/05 2:46:40 PM 2 McDougal Littell Science, Cells and Heredity Chapter 1: The Cell, pp. 6 37 1.1 The cell is the basic unit of living things. pp. 9 17 Explore: Activity

More information

Biology 2. Lecture Material. For. Macroevolution. Systematics

Biology 2. Lecture Material. For. Macroevolution. Systematics Biology 2 Macroevolution & Systematics 1 Biology 2 Lecture Material For Macroevolution & Systematics Biology 2 Macroevolution & Systematics 2 Microevolution: Biological Species: Two Patterns of Evolutionary

More information

GSBHSRSBRSRRk IZTI/^Q. LlML. I Iv^O IV I I I FROM GENES TO GENOMES ^^^H*" ^^^^J*^ ill! BQPIP. illt. goidbkc. itip31. li4»twlil FIFTH EDITION

GSBHSRSBRSRRk IZTI/^Q. LlML. I Iv^O IV I I I FROM GENES TO GENOMES ^^^H* ^^^^J*^ ill! BQPIP. illt. goidbkc. itip31. li4»twlil FIFTH EDITION FIFTH EDITION IV I ^HHk ^ttm IZTI/^Q i I II MPHBBMWBBIHB '-llwmpbi^hbwm^^pfc ' GSBHSRSBRSRRk LlML I I \l 1MB ^HP'^^MMMP" jflp^^^^^^^^st I Iv^O FROM GENES TO GENOMES %^MiM^PM^^MWi99Mi$9i0^^ ^^^^^^^^^^^^^V^^^fii^^t^i^^^^^

More information

Evaluate evidence provided by data from many scientific disciplines to support biological evolution. [LO 1.9, SP 5.3]

Evaluate evidence provided by data from many scientific disciplines to support biological evolution. [LO 1.9, SP 5.3] Learning Objectives Evaluate evidence provided by data from many scientific disciplines to support biological evolution. [LO 1.9, SP 5.3] Refine evidence based on data from many scientific disciplines

More information

Class 10 Heredity and Evolution Gist of lesson

Class 10 Heredity and Evolution Gist of lesson Class 10 Heredity and Evolution Gist of lesson Genetics : Branch of science that deals with Heredity and variation. Heredity : It means the transmission of features / characters/ traits from one generation

More information

Origin of an idea about origins

Origin of an idea about origins Origin of an idea about origins Biological evolution is the process of change during the course of time because of the alteration of the genotype and the transfer of these altered genes to the next generation.

More information

Class Webpage. Forms of Diversity. biol170/biol170syl.htm

Class Webpage. Forms of Diversity.  biol170/biol170syl.htm Class Webpage http://userwww.sfsu.edu/~efc/classes/ biol170/biol170syl.htm What is an animal? While there are exceptions, five criteria distinguish animals from other life forms. (1)Animals are multicellular,

More information

Introduction: Themes in the Study of Life

Introduction: Themes in the Study of Life LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 1 Introduction: Themes in the Study

More information

Evidence of Evolution

Evidence of Evolution Evidence of Evolution Biogeography The Age of Earth and Fossils Ancient artiodactyl Modern whale Ancestors of Whales Ambulocetus could both swim in shallow water and walk on land. Rodhocetus probably spent

More information

Benchmark Modules: Science Grade 4

Benchmark Modules: Science Grade 4 The tables that follow are designed to provide information about the content each benchmark modular assessment by grade and subject. In the table you will find the name the benchmark module, a brief description

More information

Chapter 16: Evolutionary Theory

Chapter 16: Evolutionary Theory Chapter 16: Evolutionary Theory Section 1: Developing a Theory Evolution: Artificial Selection: Evolution: I. A Theory to Explain Change Over Time B. Charles Darwin C. Theory: D. Modern evolutionary theory

More information

Ch. 7 Evolution and the fossil record

Ch. 7 Evolution and the fossil record Ch. 7 Evolution and the fossil record Evolution (popular definition) = descent with modification Evolution (technical definition) = change in gene frequencies or gene combinations in a series of populations,

More information

Biology Assessment. Eligible Texas Essential Knowledge and Skills

Biology Assessment. Eligible Texas Essential Knowledge and Skills Biology Assessment Eligible Texas Essential Knowledge and Skills STAAR Biology Assessment Reporting Category 1: Cell Structure and Function The student will demonstrate an understanding of biomolecules

More information

CH_15_Evolution.notebook. February 28, Cellular Evolution. Jean Baptiste de Lamarck. Endosymbiont Theory. Charles Darwin

CH_15_Evolution.notebook. February 28, Cellular Evolution. Jean Baptiste de Lamarck. Endosymbiont Theory. Charles Darwin Cellular Evolution The first cells were prokaryotic They did not need oxygen (the atmosphere did not contain oxygen until 1.8 billion years ago) Eukaryotic cells were found in the fossil record about 2

More information

You are required to know all terms defined in lecture. EXPLORE THE COURSE WEB SITE 1/6/2010 MENDEL AND MODELS

You are required to know all terms defined in lecture. EXPLORE THE COURSE WEB SITE 1/6/2010 MENDEL AND MODELS 1/6/2010 MENDEL AND MODELS!!! GENETIC TERMINOLOGY!!! Essential to the mastery of genetics is a thorough knowledge and understanding of the vocabulary of this science. New terms will be introduced and defined

More information

AP Biology Notes Outline Enduring Understanding 1.B. Big Idea 1: The process of evolution drives the diversity and unity of life.

AP Biology Notes Outline Enduring Understanding 1.B. Big Idea 1: The process of evolution drives the diversity and unity of life. AP Biology Notes Outline Enduring Understanding 1.B Big Idea 1: The process of evolution drives the diversity and unity of life. Enduring Understanding 1.B: Organisms are linked by lines of descent from

More information

Biology Eighth Edition Neil Campbell and Jane Reece

Biology Eighth Edition Neil Campbell and Jane Reece BIG IDEA I The process of evolution drives the diversity and unity of life. Enduring Understanding 1.C Life continues to evolve within a changing environment. Essential Knowledge 1.C.1 Speciation and extinction

More information

Introduction to Biology

Introduction to Biology Introduction to Biology Course Description Introduction to Biology is an introductory course in the biological sciences. Topics included are biological macromolecules, cell biology and metabolism, DNA

More information

The History of Life, the Universe and Everything or What do you get when you multiply six by nine. Chapters 17 (skim) and 18

The History of Life, the Universe and Everything or What do you get when you multiply six by nine. Chapters 17 (skim) and 18 The History of Life, the Universe and Everything or What do you get when you multiply six by nine Chapters 17 (skim) and 18 The Origin of Life The problem: Life begets life. There must be a beginning,

More information

Where Do Bat Wings Come From?

Where Do Bat Wings Come From? Where o at Wings ome From? 1 ats are the only mammals that have evolved the power of flight. They can avoid obstacles and slip through tight spaces. Many species are nocturnal and use echolocation to guide

More information

Chapter 5 Evolution of Biodiversity. Monday, May 16, 16

Chapter 5 Evolution of Biodiversity. Monday, May 16, 16 Chapter 5 Evolution of Biodiversity Earth is home to a tremendous diversity of species Ecosystem diversity- the variety of ecosystems within a given region. Species diversity- the variety of species in

More information

Lowndes County Biology II Pacing Guide Approximate

Lowndes County Biology II Pacing Guide Approximate Lowndes County Biology II Pacing Guide 2009-2010 MS Frameworks Pacing Guide Worksheet Grade Level: Biology II Grading Period: 1 st 9 weeks Chapter/Unit Lesson Topic Objective Number 1 The Process of 1.

More information

2/17/17. B. Four scientists important in development of evolution theory

2/17/17. B. Four scientists important in development of evolution theory UNIT 4: EVOLUTION Chapter 10: Principles of Evolution I. Early Ideas about Evolution (10.1) A. Early scientists proposed ideas about evolution 1. Evolution- process of biological change by which descendants

More information

Correlations to Next Generation Science Standards. Life Sciences Disciplinary Core Ideas. LS-1 From Molecules to Organisms: Structures and Processes

Correlations to Next Generation Science Standards. Life Sciences Disciplinary Core Ideas. LS-1 From Molecules to Organisms: Structures and Processes Correlations to Next Generation Science Standards Life Sciences Disciplinary Core Ideas LS-1 From Molecules to Organisms: Structures and Processes LS1.A Structure and Function Systems of specialized cells

More information

EVOLUTION change in populations over time

EVOLUTION change in populations over time EVOLUTION change in populations over time HISTORY ideas that shaped the current theory James Hutton (1785) proposes that Earth is shaped by geological forces that took place over extremely long periods

More information

Name. Ecology & Evolutionary Biology 245 Exam 1 12 February 2008

Name. Ecology & Evolutionary Biology 245 Exam 1 12 February 2008 Name 1 Ecology & Evolutionary Biology 245 Exam 1 12 February 2008 1. Use the following list of fossil taxa to answer parts a through g below. (2 pts each) 2 Aegyptopithecus Australopithecus africanus Diacronis

More information


PHYLOGENY & THE TREE OF LIFE PHYLOGENY & THE TREE OF LIFE PREFACE In this powerpoint we learn how biologists distinguish and categorize the millions of species on earth. Early we looked at the process of evolution here we look at

More information

Evidence for Evolution. Professor Andrea Garrison Biology 3A Illustrations 2010 Pearson Education, Inc., unless otherwise noted

Evidence for Evolution. Professor Andrea Garrison Biology 3A Illustrations 2010 Pearson Education, Inc., unless otherwise noted Evidence for Evolution Professor Andrea Garrison Biology 3A Illustrations 2010 Pearson Education, Inc., unless otherwise noted Fossil Evidence Fossil record Fossils accepted as evidence of once-living

More information

13.1 Biological Classification - Kingdoms and Domains Modern species are divided into three large groups, or domains. Bacteria Archaea Eukarya

13.1 Biological Classification - Kingdoms and Domains Modern species are divided into three large groups, or domains. Bacteria Archaea Eukarya Chapter 13 Prospecting for Biological Gold Biodiversity and Classification 13.1 Biological Classification- How Many Species Exist? Biodiversity is the variety within and among living species Number of

More information

8/23/2014. Phylogeny and the Tree of Life

8/23/2014. Phylogeny and the Tree of Life Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major

More information

Face area (cm 2 ) Brain surface area (cm 2 ) Cranial capacity (cm 3 ) 1, Jaw Angle ( º )

Face area (cm 2 ) Brain surface area (cm 2 ) Cranial capacity (cm 3 ) 1, Jaw Angle ( º ) Honors Biology Test : Evolution GOOD LUCK! You ve learned so much! Multiple Choice: Identify the choice that best completes the statement or answers the question. (2 pts each) 1. As we move through the

More information

Lecture 18 June 2 nd, Gene Expression Regulation Mutations

Lecture 18 June 2 nd, Gene Expression Regulation Mutations Lecture 18 June 2 nd, 2016 Gene Expression Regulation Mutations From Gene to Protein Central Dogma Replication DNA RNA PROTEIN Transcription Translation RNA Viruses: genome is RNA Reverse Transcriptase

More information

2012 Univ Aguilera Lecture. Introduction to Molecular and Cell Biology

2012 Univ Aguilera Lecture. Introduction to Molecular and Cell Biology 2012 Univ. 1301 Aguilera Lecture Introduction to Molecular and Cell Biology Molecular biology seeks to understand the physical and chemical basis of life. and helps us answer the following? What is the

More information

Kentucky Core Content for Science Assessment Correlations

Kentucky Core Content for Science Assessment Correlations Kentucky Core Content for Science LIFE SCIENCE STANDARDS THE CELL 3.1.1: Cells have particular structures that underlie their function. Every cell is surrounded by a membrane that separates it from the

More information

Patterns of Evolution

Patterns of Evolution Patterns of Evolution A tree that represents an estimate (hypothesis) of evolutionary relatedness is a phylogeny Classifications can be based on groupings within a phylogeny Groupings can be categorized

More information

Miller & Levine Biology 2014

Miller & Levine Biology 2014 A Correlation of Miller & Levine Biology To the Essential Standards for Biology High School Introduction This document demonstrates how meets the North Carolina Essential Standards for Biology, grades

More information

11.6. Patterns in Evolution. Evolution through natural selection is not random.

11.6. Patterns in Evolution. Evolution through natural selection is not random. 11.6 Patterns in Evolution VOCABULARY convergent evolution divergent evolution coevolution extinction punctuated equilibrium adaptive radiation > Key Concept Evolution occurs in patterns. MAIN IDEAS Evolution

More information


THE EVIDENCE FOR EVOLUTION Unit 37 THE EVIDENCE FOR EVOLUTION LEARNING OBJECTIVES 1. Understand the meaning of the term evolution. 2. Learn about fossil evidence including how fossils are formed. 3. Learn how comparative anatomy

More information

Lecture Materials are available on the 321 web site

Lecture Materials are available on the 321 web site MENDEL AND MODELS Explore the Course Web Site http://fire.biol.wwu.edu/trent/trent/biol321index.html Lecture Materials are available on the 321 web site http://fire.biol.wwu.edu/trent/trent/321lectureindex.html

More information

Classifications can be based on groupings g within a phylogeny

Classifications can be based on groupings g within a phylogeny Patterns of Evolution A tree that represents an estimate (hypothesis) of evolutionary relatedness is a phylogeny Classifications can be based on groupings g within a phylogeny y Groupings can be categorized

More information


PACING GUIDE ADVANCED PLACEMENT BIOLOGY PACING GUIDE ADVANCED PLACEMENT BIOLOGY BIG IDEAS: 1: The process of evolution drives the diversity and unity of life. 2: Biological systems utilize free energy and molecular building blocks to grow, to

More information

Introduction: Themes in the Study of Life

Introduction: Themes in the Study of Life Chapter 1 Introduction: Themes in the Study of Life Edited by Shawn Lester PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by

More information

Classification and Viruses Practice Test

Classification and Viruses Practice Test Classification and Viruses Practice Test Multiple Choice Identify the choice that best completes the statement or answers the question. 1. Biologists use a classification system to group organisms in part

More information

Thomas Malthus ( ) was an English economist. He wrote an essay titled On Population.

Thomas Malthus ( ) was an English economist. He wrote an essay titled On Population. THEORY OF EVOLUTION History of Evolutionary Thought The Idea of Evolution Evolution is the process of change in the inherited characteristics within populations over generations such that new types of

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

UNIT 4: EVOLUTION Chapter 10: Principles of Evolution. I. Early Ideas about Evolution (10.1) A. Early scientists proposed ideas about evolution

UNIT 4: EVOLUTION Chapter 10: Principles of Evolution. I. Early Ideas about Evolution (10.1) A. Early scientists proposed ideas about evolution UNIT IV Chapter 10 Principles of Evolution UNIT 4: EVOLUTION Chapter 10: Principles of Evolution I. Early Ideas about Evolution (10.1) A. Early scientists proposed ideas about evolution 1. Evolution- process

More information

Theory of Evolution. Evolution The process of change over time. Specifically, a change in the frequency of a gene or allele in a population over time

Theory of Evolution. Evolution The process of change over time. Specifically, a change in the frequency of a gene or allele in a population over time Theory of Evolution Learning Goals Define "Evolution" & "Natural Selection". Describe the 4 steps of Natural Selection, giving an example of each. Explain the importance of "Variation". Does Natural Selection

More information

The Origin of Species

The Origin of Species The Origin of Species Chapter 24 Both in space and time, we seem to be brought somewhere near to that great fact the mystery of mysteries-the first appearance of beings on Earth. Darwin from his diary

More information

Cellular Genetics, Structure and Function of DNA in Cells, Genetic Mechanisms and Inheritance, Mutations, Modern genetics 6-7 weeks

Cellular Genetics, Structure and Function of DNA in Cells, Genetic Mechanisms and Inheritance, Mutations, Modern genetics 6-7 weeks Biology Curriculum Map Each unit is allocated an approximate number of weeks using a traditional period schedule. Teachers should adjust these timeframes as needed based on student mastery and formative

More information


BIOLOGY COURSES (BIOL) Biology Courses (BIOL) 1 BIOLOGY COURSES (BIOL) Courses BIOL 101 SURVEY OF BIOLOGY A one-semester course in the general concepts of biology providing the nonmajor with an overview of the living world and

More information

Section 17-1 The Fossil Record (pages )

Section 17-1 The Fossil Record (pages ) Name Class Date Section 17-1 The Fossil Record (pages 417-422) Key Concepts What is the fossil record? What information do relative dating and radioactive dating provide about fossils? What are the main

More information

Chapter 1 Molecules, Cells, and Model Organisms

Chapter 1 Molecules, Cells, and Model Organisms Chapter 1 Molecules, Cells, and Model Organisms 1.1 The Molecules of Life 1.2 Prokaryotic Cell Structure and Function 1.3 Eukaryotic Cell Structure and Function 1.4 Unicellular Eukaryotic Model Organisms

More information

In a way, organisms determine who belongs to their species by choosing with whom they will! MODERN EVOLUTIONARY CLASSIFICATION 18-2 MATE

In a way, organisms determine who belongs to their species by choosing with whom they will! MODERN EVOLUTIONARY CLASSIFICATION 18-2 MATE MODERN EVOLUTIONARY CLASSIFICATION 18-2 In a way, organisms determine who belongs to their species by choosing with whom they will! MATE Taxonomic groups are invented by scientists to group organisms with

More information

Bundle at a Glance Biology 2015/16

Bundle at a Glance Biology 2015/16 Introduction: Scientific Investigation and Reasoning Skills (3 A/B days) Biology Process TEKS: 1A demonstrate safe practices during laboratory and field investigations. 1B demonstrate an understanding

More information

Bio 1M: The evolution of apes. 1 Example. 2 Patterns of evolution. Similarities and differences. History

Bio 1M: The evolution of apes. 1 Example. 2 Patterns of evolution. Similarities and differences. History Bio 1M: The evolution of apes 1 Example Humans are an example of a biological species that has evolved Possibly of interest, since many of your friends are probably humans Humans seem unique: How do they

More information


THE CELL CYCLE EOC QUIZ THE CELL CYCLE EOC QUIZ This quiz is composed of 8 EOC type questions Each question is followed by the same question with the correct answer highlighted Therefore, Read the questions and the choices, &

More information

CLASS SET DO NOT WRITE ON THIS TEST! Please do not cross off answers, circle answers, or mark on this test in any way. Thank you!

CLASS SET DO NOT WRITE ON THIS TEST! Please do not cross off answers, circle answers, or mark on this test in any way. Thank you! CLASS SET DO NOT WRITE ON THIS TEST! Please do not cross off answers, circle answers, or mark on this test in any way. Thank you! 1) Unlike mitosis, meiosis in male mammals results in the formation of

More information

Lecture 10: Cyclins, cyclin kinases and cell division

Lecture 10: Cyclins, cyclin kinases and cell division Chem*3560 Lecture 10: Cyclins, cyclin kinases and cell division The eukaryotic cell cycle Actively growing mammalian cells divide roughly every 24 hours, and follow a precise sequence of events know as

More information

Chapter 13 Meiosis and Sexual Reproduction

Chapter 13 Meiosis and Sexual Reproduction Biology 110 Sec. 11 J. Greg Doheny Chapter 13 Meiosis and Sexual Reproduction Quiz Questions: 1. What word do you use to describe a chromosome or gene allele that we inherit from our Mother? From our Father?

More information

Chapter 26 Phylogeny and the Tree of Life

Chapter 26 Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence

More information

Biology Keystone (PA Core) Quiz Theory of Evolution - (BIO.B ) Theory Of Evolution, (BIO.B ) Scientific Terms

Biology Keystone (PA Core) Quiz Theory of Evolution - (BIO.B ) Theory Of Evolution, (BIO.B ) Scientific Terms Biology Keystone (PA Core) Quiz Theory of Evolution - (BIO.B.3.2.1 ) Theory Of Evolution, (BIO.B.3.3.1 ) Scientific Terms Student Name: Teacher Name: Jared George Date: Score: 1) Evidence for evolution

More information

Evolution = descent with modification

Evolution = descent with modification Chapter 21: Evidence for Evolution I. Evolution & Darwin II. Artificial Selection III. Fossil Record IV. Comparative Anatomy V. Embryology VI. Genetic Analysis VII. Biogeographical Evidence VIII. Conclusions

More information

Objective 3.01 (DNA, RNA and Protein Synthesis)

Objective 3.01 (DNA, RNA and Protein Synthesis) Objective 3.01 (DNA, RNA and Protein Synthesis) DNA Structure o Discovered by Watson and Crick o Double-stranded o Shape is a double helix (twisted ladder) o Made of chains of nucleotides: o Has four types

More information

5/23/2017. XAVIER RECYCLES! Please place recyclable material in the common area recycling containers

5/23/2017. XAVIER RECYCLES! Please place recyclable material in the common area recycling containers YES: paper, cardboard, and empty plastic containers NO: cans, glass, liquid, garbage, food waste XAVIER RECYCLES! Please place recyclable material in the common area recycling containers Topics Biodiversity

More information

Cladistics and Bioinformatics Questions 2013

Cladistics and Bioinformatics Questions 2013 AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species

More information

7A Evidence of Evolution

7A Evidence of Evolution 7A Evidence of Evolution Fossil Evidence & Biogeography 7A analyze and evaluate how evidence of common ancestry among groups is provided by the fossil record, biogeography, and homologies, including anatomical,

More information

What is Evolution? Study of how things change over time

What is Evolution? Study of how things change over time 10.2 15 Darwin s Theory Observations of Evolution What is Evolution? Study of how things change over time 10.2 15 Darwin s Theory Observations of Evolution Theories of Evolution - Lamarck Jean Baptiste

More information

Classification, Phylogeny yand Evolutionary History

Classification, Phylogeny yand Evolutionary History Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize

More information

Gene Control Mechanisms at Transcription and Translation Levels

Gene Control Mechanisms at Transcription and Translation Levels Gene Control Mechanisms at Transcription and Translation Levels Dr. M. Vijayalakshmi School of Chemical and Biotechnology SASTRA University Joint Initiative of IITs and IISc Funded by MHRD Page 1 of 9

More information