Figure S1: Phylogenetic tree of Pseudomonas and related bacteria. Phylogenetic trees were generated using parsimony, neighbor-joining and maximum

Nature Biotechnology: doi: /nbt Supplementary Figure 1. Detailed overview of the primer-free full-length SSU rrna library preparation.

Supplementary Figure 1 Detailed overview of the primer-free full-length SSU rrna library preparation. Detailed overview of the primer-free full-length SSU rrna library preparation. Supplementary Figure

Phylogenetics: Building Phylogenetic Trees

1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should

Michael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D

7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University

Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

Calculus 3208 Derivative (18)

Calculus 3208 Derivative (8) Unit 4: Chapter # 2 Section 2. (Essential Calculus) Average and Instantaneous Slope Average and Instantaneous Slope A Concrete Example of a Rate of Change Average Rate of Change

Supporting Information

Supporting Information Das et al. 10.1073/pnas.1302500110 < SP >< LRRNT > < LRR1 > < LRRV1 > < LRRV2 Pm-VLRC M G F V V A L L V L G A W C G S C S A Q - R Q R A C V E A G K S D V C I C S S A T D S S P E

Phylogenetic analyses. Kirsi Kostamo

Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,

BINF6201/8201. Molecular phylogenetic methods

BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics

concentration ( mol l -1 )

concentration ( mol l -1 ) 8 10 0 20 40 60 80 100 120 140 160 180 methane sulfide ammonium oxygen sulfate (/10) b depth (m) 12 14 Supplementary Figure 1. Water column parameters from August 2011. Chemical

Cladistics and Bioinformatics Questions 2013

AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky

MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

A (short) introduction to phylogenetics

A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field

Honor pledge: I have neither given nor received unauthorized aid on this test. Name :

Midterm Exam #1 MB 451 : Microbial Diversity Honor pledge: I have neither given nor received unauthorized aid on this test. Signed : Date : Name : 1. What are the three primary evolutionary branches of

Consensus Methods. * You are only responsible for the first two

Consensus Trees * consensus trees reconcile clades from different trees * consensus is a conservative estimate of phylogeny that emphasizes points of agreement * philosophy: agreement among data sets is

Theory of Evolution Charles Darwin

Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties

Phylogenetic trees 07/10/13

Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share

Theory of Evolution. Charles Darwin

Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties

Chad Burrus April 6, 2010

Chad Burrus April 6, 2010 1 Background What is UniFrac? Materials and Methods Results Discussion Questions 2 The vast majority of microbes cannot be cultured with current methods Only half (26) out of

Phylogenetics: Bayesian Phylogenetic Analysis. COMP Spring 2015 Luay Nakhleh, Rice University

Phylogenetics: Bayesian Phylogenetic Analysis COMP 571 - Spring 2015 Luay Nakhleh, Rice University Bayes Rule P(X = x Y = y) = P(X = x, Y = y) P(Y = y) = P(X = x)p(y = y X = x) P x P(X = x 0 )P(Y = y X

Figure A1. Phylogenetic trees based on concatenated sequences of eight MLST loci. Phylogenetic trees were constructed based on concatenated sequences

A. B. Figure A1. Phylogenetic trees based on concatenated sequences of eight MLST loci. Phylogenetic trees were constructed based on concatenated sequences of eight housekeeping loci for 12 unique STs

Using Bioinformatics to Study Evolutionary Relationships Instructions

3 Using Bioinformatics to Study Evolutionary Relationships Instructions Student Researcher Background: Making and Using Multiple Sequence Alignments One of the primary tasks of genetic researchers is comparing

A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family

A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family Jieming Shen 1,2 and Hugh B. Nicholas, Jr. 3 1 Bioengineering and Bioinformatics Summer

Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes

Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes David DeCaprio, Ying Li, Hung Nguyen (sequenced Ascomycetes genomes courtesy of the Broad Institute) Phylogenomics Combining whole genome

MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS. Masatoshi Nei"

MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS Masatoshi Nei" Abstract: Phylogenetic trees: Recent advances in statistical methods for phylogenetic reconstruction and genetic diversity analysis were

Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016

Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,

Midterm Exam #1. MB 451 Microbial Diversity. Honor pledge: I have neither given nor received unauthorized aid on this test.

Midterm xam #1 M 451 Microbial iversity Honor pledge: I have neither given nor received unauthorized aid on this test. Signed : ate : Feb 5, 2007 Name : KY 1. What are the three primary evolutionary branches

Outline Classes of diversity measures. Species Divergence and the Measurement of Microbial Diversity. How do we describe and compare diversity?

Species Divergence and the Measurement of Microbial Diversity Cathy Lozupone University of Colorado, Boulder. Washington University, St Louis. Outline Classes of diversity measures α vs β diversity Quantitative

Supplemental Data. Perea-Resa et al. Plant Cell. (2012) /tpc

Supplemental Data. Perea-Resa et al. Plant Cell. (22)..5/tpc.2.3697 Sm Sm2 Supplemental Figure. Sequence alignment of Arabidopsis LSM proteins. Alignment of the eleven Arabidopsis LSM proteins. Sm and

DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi

DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :

Laboratory. Phylogenetics

Laboratory 11 Phylogenetics Biology 171L SP18 Lab 11: Phylogenetics Student Learning Outcomes 1. Discover Darwin s contribution to biology. 2. Understand the importance of evolution in the study of biology.

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega

BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments

Letter to the Editor. Department of Biology, Arizona State University

Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the

1. Can we use the CFN model for morphological traits?

1. Can we use the CFN model for morphological traits? 2. Can we use something like the GTR model for morphological traits? 3. Stochastic Dollo. 4. Continuous characters. Mk models k-state variants of the

Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT

Inferring phylogeny Constructing phylogenetic trees Tõnu Margus Contents What is phylogeny? How/why it is possible to infer it? Representing evolutionary relationships on trees What type questions questions

1 ATGGGTCTC 2 ATGAGTCTC

We need an optimality criterion to choose a best estimate (tree) Other optimality criteria used to choose a best estimate (tree) Parsimony: begins with the assumption that the simplest hypothesis that

Bioinformatics tools for phylogeny and visualization. Yanbin Yin

Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and

Outline. Classification of Living Things

Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics

Taxonomy. Content. How to determine & classify a species. Phylogeny and evolution

Taxonomy Content Why Taxonomy? How to determine & classify a species Domains versus Kingdoms Phylogeny and evolution Why Taxonomy? Classification Arrangement in groups or taxa (taxon = group) Nomenclature

I. Short Answer Questions DO ALL QUESTIONS

EVOLUTION 313 FINAL EXAM Part 1 Saturday, 7 May 2005 page 1 I. Short Answer Questions DO ALL QUESTIONS SAQ #1. Please state and BRIEFLY explain the major objectives of this course in evolution. Recall

Estimating Evolutionary Trees. Phylogenetic Methods

Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

Phylogenetic inference: from sequences to trees

W ESTFÄLISCHE W ESTFÄLISCHE W ILHELMS -U NIVERSITÄT NIVERSITÄT WILHELMS-U ÜNSTER MM ÜNSTER VOLUTIONARY FUNCTIONAL UNCTIONAL GENOMICS ENOMICS EVOLUTIONARY Bioinformatics 1 Phylogenetic inference: from sequences

8/23/2014. Phylogeny and the Tree of Life

Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major

Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony

ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),

Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki

Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:

Dr. Amira A. AL-Hosary

Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)

- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the

Genomic insights into the taxonomic status of the Bacillus cereus group. Laboratory of Marine Genetic Resources, Third Institute of Oceanography,

1 2 3 Genomic insights into the taxonomic status of the Bacillus cereus group Yang Liu 1, Qiliang Lai 1, Markus Göker 2, Jan P. Meier-Kolthoff 2, Meng Wang 3, Yamin Sun 3, Lei Wang 3 and Zongze Shao 1*

Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata.

Supplementary Note S2 Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Phylogenetic trees reconstructed by a variety of methods from either single-copy orthologous loci (Class

TheDisk-Covering MethodforTree Reconstruction

TheDisk-Covering MethodforTree Reconstruction Daniel Huson PACM, Princeton University Bonn, 1998 1 Copyright (c) 2008 Daniel Huson. Permission is granted to copy, distribute and/or modify this document

Introduction to Bioinformatics Introduction to Bioinformatics

Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence

A Contribution to the Phylogeny of the Ciidae and its Relationships with Other Cucujoid and Tenebrionoid Beetles (Coleoptera: Cucujiformia)

Arthropod Systematics & Phylogeny I 66 (2) Electronic Supplement Museum für Tierkunde Dresden, ISSN 1863-7221, 5.12.2008 A Contribution to the Phylogeny of the Ciidae and its Relationships with Other Cucujoid

Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny

Supplement of Distribution of PAHs and the PAH-degrading bacteria in the deep-sea sediments of the high-latitude Arctic Ocean

Supplement of Biogeosciences, 12, 2163 2177, 2015 http://www.biogeosciences.net/12/2163/2015/ doi:10.5194/bg-12-2163-2015-supplement Author(s) 2015. CC Attribution 3.0 License. Supplement of Distribution

Proteorhodopsin phototrophy in the ocean

Nature 411, 786-789 (14 June 2001) doi:10.1038/35081051; Received 3 January 2001; Accepted 26 March 2001 Proteorhodopsin phototrophy in the ocean Oded Béjà, Elena N. Spudich, John L. Spudich, Marion Leclerc

Evolutionary Tree Analysis. Overview

CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based

Coculture of two Developmental Stages of a Marine-derived Aspergillus alliaceus. Results in the Production of the Cytotoxic Bianthrone Allianthrone A

Coculture of two Developmental Stages of a Marine-derived Aspergillus alliaceus Results in the Production of the Cytotoxic Bianthrone Allianthrone A P. E. Mandelare, D. A. Adpressa, E. N. Kaweesa, L. N.

BMI/CS 776 Lecture #20 Alignment of whole genomes. Colin Dewey (with slides adapted from those by Mark Craven)

BMI/CS 776 Lecture #20 Alignment of whole genomes Colin Dewey (with slides adapted from those by Mark Craven) 2007.03.29 1 Multiple whole genome alignment Input set of whole genome sequences genomes diverged

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types

Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between

Lecture 6 Phylogenetic Inference

Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline

Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying

Algorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,

Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837

Supplementary Material. stress responsive genes providing protection of wheat from salinity stress

Supplementary Material Plant growth promoting rhizobacteria Dietzia natronolimnaea modulates the expression of stress responsive genes providing protection of wheat from salinity stress Nidhi Bharti, Shiv

Phylogeny of Mixture Models

Phylogeny of Mixture Models Daniel Štefankovič Department of Computer Science University of Rochester joint work with Eric Vigoda College of Computing Georgia Institute of Technology Outline Introduction

Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics

Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods

Biology 211 (2) Week 1 KEY!

Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of

The Phylogenetic Reconstruction of the Grass Family (Poaceae) Using matk Gene Sequences

The Phylogenetic Reconstruction of the Grass Family (Poaceae) Using matk Gene Sequences by Hongping Liang Dissertation submitted to the Faculty of the Virginia Polytechnic Institute and State University

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

Lecture 11 Friday, October 21, 2011

Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system

Additive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive.

Additive distances Let T be a tree on leaf set S and let w : E R + be an edge-weighting of T, and assume T has no nodes of degree two. Let D ij = e P ij w(e), where P ij is the path in T from i to j. Then

Molecular evidence for multiple origins of Insectivora and for a new order of endemic African insectivore mammals

Project Report Molecular evidence for multiple origins of Insectivora and for a new order of endemic African insectivore mammals By Shubhra Gupta CBS 598 Phylogenetic Biology and Analysis Life Science

HW #4. (mostly by) Salim Sarımurat. 1) Insert 6 2) Insert 8 3) Insert 30. 4) Insert S a.

HW #4 (mostly by) Salim Sarımurat 04.12.2009 S. 1. 1. a. 1) Insert 6 2) Insert 8 3) Insert 30 4) Insert 40 2 5) Insert 50 6) Insert 61 7) Insert 70 1. b. 1) Insert 12 2) Insert 29 3) Insert 30 4) Insert

BACTERIAL TOLERANCE TO HEAVY METALS UNDER THE INFLUENCE OF ph, TEMPERATURE AND SALINITY

BACTERIAL TOLERANCE TO HEAVY METALS UNDER THE INFLUENCE OF ph, TEMPERATURE AND SALINITY 1 J. JOONU, 2 KAVITHA.P, 3 SUGANYA.T 1, 2, 3 Department of Zoology, Bishop Heber College, Trichy 17, Tamilnadu. India

Evaluating phylogenetic hypotheses

Evaluating phylogenetic hypotheses Methods for evaluating topologies Topological comparisons: e.g., parametric bootstrapping, constrained searches Methods for evaluating nodes Resampling techniques: bootstrapping,

Algorithms in Bioinformatics

Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.

!! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory

Additional file 10. Classification of Pac sequences based on maximum-likelihood (ML) phylogenetic analyses. Analyses were performed on the same

Additional file 10. Classification of Pac sequences based on maximum-likelihood (ML) phylogenetic analyses. Analyses were performed on the same dataset alignments used for crucial Neighbor-joining trees

Page 1. Evolutionary Trees. Why build evolutionary tree? Outline

Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny

AP Biology. Cladistics

Cladistics Kingdom Summary Review slide Review slide Classification Old 5 Kingdom system Eukaryote Monera, Protists, Plants, Fungi, Animals New 3 Domain system reflects a greater understanding of evolution

CHAPTERS 24-25: Evidence for Evolution and Phylogeny

CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology

Problem: Data base too big to fit memory Disk reads are slow. Example: 1,000,000 records on disk Binary search might take 20 disk reads

B Trees Problem: Data base too big to fit memory Disk reads are slow Example: 1,000,000 records on disk Binary search might take 20 disk reads Disk reads are done in blocks Example: One block read can

Surprise! A New Hominin Fossil Changes Almost Nothing!

Surprise! A New Hominin Fossil Changes Almost Nothing! Author: Andrew J Petto Table 1: Brief Comparison of Australopithecus with early Homo fossils Species Apes (outgroup) Thanks to Louise S Mead for comments

Macroevolution Part I: Phylogenies

Macroevolution Part I: Phylogenies Taxonomy Classification originated with Carolus Linnaeus in the 18 th century. Based on structural (outward and inward) similarities Hierarchal scheme, the largest most

Phylogeny and Molecular Evolution. Introduction

Phylogeny and Molecular Evolution Introduction 1 2/62 3/62 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir,

Is the equal branch length model a parsimony model?

Table 1: n approximation of the probability of data patterns on the tree shown in figure?? made by dropping terms that do not have the minimal exponent for p. Terms that were dropped are shown in red;

Phylogenetic inference

Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

Sec$on 9. Evolu$onary Rela$onships

Sec$on 9 Evolu$onary Rela$onships Sec$on 9 Learning Goals Explain why the ribosomal 16S gene is a good marker for molecular phylogene$c comparisons. Be able to interpret a phylogene$c tree. Explain the

SUPPLEMENTARY INFORMATION

Supplementary information S3 (box) Methods Methods Genome weighting The currently available collection of archaeal and bacterial genomes has a highly biased distribution of isolates across taxa. For example,

Phylogenetic Analysis

Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

PHYLOGENY AND SYSTEMATICS

AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study

Phylogeny: building the tree of life

Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan

Phylogenetic Analysis

Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

Phylogenetic Analysis

Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

Phenotypic Evolution. and phylogenetic comparative methods. G562 Geometric Morphometrics. Department of Geological Sciences Indiana University

Phenotypic Evolution and phylogenetic comparative methods Phenotypic Evolution Change in the mean phenotype from generation to generation... Evolution = Mean(genetic variation * selection) + Mean(genetic

Phylogenetic study of Diploschistes (lichen-forming Ascomycota: Ostropales: Graphidaceae), based on morphological, chemical, and molecular data

Vol. 62 (2) April 2013 International Journal of Taxonomy, Phylogeny and Evolution Electronic Supplement to Phylogenetic study of Diploschistes (lichen-forming Ascomycota: Ostropales: Graphidaceae), based