Outline Classes of diversity measures. Species Divergence and the Measurement of Microbial Diversity. How do we describe and compare diversity?
|
|
- Sharlene Reeves
- 5 years ago
- Views:
Transcription
1 Species Divergence and the Measurement of Microbial Diversity Cathy Lozupone University of Colorado, Boulder. Washington University, St Louis. Outline Classes of diversity measures α vs β diversity Quantitative vs Qualitative Divergence/phylogenetic-based diversity vs Taxon/species Phylogenetic diversity measures that: Compare the total amount of diversity between samples. e.g. Is a polluted lake less diverse than pristine? Test if samples have significantly different membership. e.g. Do gut samples from HIV positive people have different microbes than those from healthy people? Identify environmental variables associated with differences between many samples. e.g. Does ph, organic carbon, soil type, etc correlate with variability across many soils? These measures are not just for microbes! Lozupone, C.A. and R. Knight (2008) Species divergence and the measurement of microbial diversity. FEMS Microbiol Rev How do we describe and compare diversity? α Diversity: How many species are in a sample? (e.g. 6 colors in A and 6 in B) e.g.: Are polluted environments less diverse than pristine? β Diversity: How many species are shared between samples? (e.g. 2 shared colors between A and B) e.g.: Does the microbiota differ with different disease states? A B Quantitative versus Qualitative measures Qualitative: Considers presence absence only α: How many species are in a sample? e.g.: 6 colors in both A and B. β: How many species are shared between samples? e.g.: A and B are identical because the same colors are present in both. Quantitative: Also considers relative abundance. α: Accounts for evenness : e.g. B, where the population is evenly distributed across the 6 species, is more diverse than A, where all species are present but red dominates. β: Samples will be considered more similar if the same species are numerically dominant versus rare. e.g. B and A no longer look identical because of differences in abundance. A B 1
2 What is a phylogenetic diversity measure? α Diversity: Taxon: How many species are in a sample? Phylogenetic: How much phylogenetic divergence is in a sample? (e.g. B more individually diverse than A - more divergent colors) β Diversity: Taxon: How many species are shared between samples? Phylogenetic: How much phylogenetic distance is shared between samples? (only related colors from B are in A) A B Advantages of phylogenetic techniques. Phylogenetically related organisms are more likely to have similar roles in a community. Taxon-based methods assume a star phylogeny, where all relationships between taxa are ignored. Easily applied to microbial community sequence data. Most (>99%) microbes cannot be cultured. 1. Extract DNA from environmental samples. 3. Generate Sequences: Sanger Pyrosequencing 4. Diversity evaluation. Taxon (Species)-based: Group sequences into OTUs based on % identity. 97% id for species. Phylogeny-based: Majority of phylogenetic diversity is microbial. 2. PCR amplify SSU rrna gene. Adapted from Pace 1997 Science 276:
3 Phylogenetic Diversity Measures α Diversity Phylogenetic Diversity (PD) Compare the total amount of diversity between samples. β Diversity Test if samples have significantly different membership. UniFrac Significance P test LibShuff Identify environmental variables associated with differences between many samples. Unweighted and Weighted UniFrac DPCoA Compare local and regional diversity Gain in PD (G) NRI-NTI Phylogenetic Diversity (PD) Sum of branches leading to sequences in a sample. Qualitative α diversity. Sample with taxa spanning the most branch length in this tree represents the most phylogenetically and perhaps functionally divergent community. Faith, D.P. (1992) Conservation evaluation and phylogenetic diversity. Biological Conservation 61, PD Rarefaction Phylogenetic β diversity: How is diversity partitioned among samples? Plot the amount of branch length against the # of observations. Shape of curve allows for estimating how far we are from sampling all of the phylogenetic diversity. Allows for comparison of phylogenetic diversity between samples. Eckburg, P.B., et al. (2005) Diversity of the human intestinal microbial flora. Science 308, Do two samples contain significantly different microbial populations? Can we see broad trends that relate many samples and explain them in terms of environmental factors? 3
4 Unique Fraction (UniFrac) metric Qualitative phylogenetic β diversity. Distance = fraction of the total branch length that is unique to any particular environment. Phylogenetic (P) Test The number of changes between states (samples) required to explain the distribution of sequences on the tree (Fitch parsimony). Sensitive to tree topology but not to branch lengths. Lozupone and Knight, 2005, Appl Environ Microbiol 71:8228 Martin, A.P. (2002) Phylogenetic approaches for describing and comparing the diversity of microbial communities. Appl Environ Microbiol 68, Is the phylogenetic diversity significantly different between samples? Monte Carlo simulations: randomly permute the data (environment assignments) and determine how often the random data has a more extreme value than the real data. P-values: P-test: fraction of random trees that have less parsimony changes than the real tree. UniFrac: fraction of random trees that have more Unique branch length than the real tree. UniFrac Website: //bmf.colorado.edu/unifrac/ LibShuff CX: fraction of sequences in X that are not singletons after grouping through range of sequence distances. CXY: fraction in X that are also in Y Cramer-von Mises statistic: distance between 2 curves. Significance with Monte Carlo. Comparison of Bacteria in two beetles species. Singleton DR, Furlong MA, Rathbun SL & Whitman WB (2001). Appl Environ Microbiol 67:
5 Clustering with the UniFrac Algorithm Can we see broad trends that relate many samples and explain them in terms of environmental factors? What types of environments have similar phylogenetic diversity? ph Temperature C Pressure 1-12 Nutrient Availability Oligotrophic Eutrophic atm Lozupone CA & Knight R (2007) Global patterns in bacterial diversity. Proc Natl Acad Sci U S A 104: Salinity is the most important factor Hierarchical clustering (UPGMA) of the same UniFrac distance matrix PCoA of UniFrac Distance Matrix 5
6 Qualitative vs Quantitative measures of Phylogenetic β Diversity Qualitative: Unweighted UniFrac Detects factors restrictive for microbial growth. High temperature, low ph, founder effects. Quantitative: Weighted UniFrac, DPCoA. Detects transient changes. Seasonal changes, nutrient availability, response to pollution. Yield different, complementary results and applying both to same data can provide insight into nature of community changes. Weighted UniFrac Qualitative Quantitative Lozupone et al., Appl Environ Microbiol 73:1576 Mice heterozygous for mutation in Leptin gene interbreed. 16S gene sequenced for bacteria in gut of mothers and offspring. Obesity and Gut Microbiota Unweighted UniFrac Clustering of Mouse Data Weighted UniFrac Ley et al., (2005)Obesity Alters Gut Microbiota, PNAS Vol 102: pp Mice cluster perfectly by mother No obvious effects of obesity Robust to sampling effort Obese mice mostly cluster together Not robust to sampling effort 6
7 Unweighted UniFrac Weighted UniFrac Comparison of human stool and mucosal microbes Unweighted: all samples cluster by individual. Weighted: stool looks different. Eckburg, P.B., et al. (2005) Diversity of the human intestinal microbial flora. Science 308, Measures in the same class cluster the data similarly Double principal coordinates analysis (DPCoA) Another quantitative β diversity measure. A matrix of species distances is first used to ordinate the species using PCoA. The position of the communities in coordinate space is the average position of the species that they contain, weighted by relative abundances. Produces same results as weighted UniFrac. Short reads (pyrosequencing) can recapture the result. UW UniFrac clustering with Arb parsimony insertion of 100 bp reads extending from primer R357. Assignment of short reads to an existing phylogeny (e.g. greengenes coreset) allows for the analysis of very large datasets. Liu Z, Lozupone C, Hamady M, Bushman FD & Knight R (2007) Short pyrosequencing reads suffice for accurate microbial community analysis. Nucleic Acids Res 35: e120. Comparison of Local Diversity to Regional Diversity β-diversity measures can also relate diversity in a single community to the total diversity in a habitat type or globally. Net Relatedness Index (NRI) and Nearest Taxa Index (NTI) Webb CO (2000) Exploring the phylogenetic structure of ecological communities. Am Nat 156: Overdispersion of sequences in the tree: Competition important. Underdispersion of sequences: Habitat Filtering important. Gain in PD (G) 7
8 Gain in PD (G) Which communities contain the most unseen diversity? Branches leading only to sequences in a sample. Faith, D.P. (1992) Conservation evaluation and phylogenetic diversity. Biological Conservation 61, Correcting G for sampling effort Regression of G values vs # of OTUs detected in sample. Culture based studies (red) discovered little new diversity. Unique saline environments (e.g. hypersaline mats) discovered more. Lozupone CA & Knight R (2007) Global patterns in bacterial diversity. Proc Natl Acad Sci U S A 104: Summary Phylogenetic diversity measures can be more powerful than taxon based measures because they use information on how closely related taxa are to each other. Phylogenetic measures are available for both α diversity and β diversity. Quantitative and Qualitative beta diversity measures produce complementary insights into how communities are related. Although several different methods may exist for a particular class of diversity measure - these are likely to give similar results (e.g. DPCoA and Weighted UniFrac). Acknowledgments Rob Knight Micah Hamady Knight and Gordon Labs 8
Chad Burrus April 6, 2010
Chad Burrus April 6, 2010 1 Background What is UniFrac? Materials and Methods Results Discussion Questions 2 The vast majority of microbes cannot be cultured with current methods Only half (26) out of
More informationBacterial Community Variation in Human Body Habitats Across Space and Time
Bacterial Community Variation in Human Body Habitats Across Space and Time Elizabeth K. Costello, 1 Christian L. Lauber, 2 Micah Hamady, 3 Noah Fierer, 2,4 Jeffrey I. Gordon, 5 Rob Knight 1* 1 Department
More informationTitle ghost-tree: creating hybrid-gene phylogenetic trees for diversity analyses
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 Title ghost-tree: creating hybrid-gene phylogenetic trees for diversity analyses
More informationMicrobiota: Its Evolution and Essence. Hsin-Jung Joyce Wu "Microbiota and man: the story about us
Microbiota: Its Evolution and Essence Overview q Define microbiota q Learn the tool q Ecological and evolutionary forces in shaping gut microbiota q Gut microbiota versus free-living microbe communities
More informationOther resources. Greengenes (bacterial) Silva (bacteria, archaeal and eukarya)
General QIIME resources http://qiime.org/ Blog (news, updates): http://qiime.wordpress.com/ Support/forum: https://groups.google.com/forum/#!forum/qiimeforum Citing QIIME: Caporaso, J.G. et al., QIIME
More informationTaxonomy. Content. How to determine & classify a species. Phylogeny and evolution
Taxonomy Content Why Taxonomy? How to determine & classify a species Domains versus Kingdoms Phylogeny and evolution Why Taxonomy? Classification Arrangement in groups or taxa (taxon = group) Nomenclature
More informationPhylogenetic diversity and conservation
Phylogenetic diversity and conservation Dan Faith The Australian Museum Applied ecology and human dimensions in biological conservation Biota Program/ FAPESP Nov. 9-10, 2009 BioGENESIS Providing an evolutionary
More informationTaxonomy and Clustering of SSU rrna Tags. Susan Huse Josephine Bay Paul Center August 5, 2013
Taxonomy and Clustering of SSU rrna Tags Susan Huse Josephine Bay Paul Center August 5, 2013 Primary Methods of Taxonomic Assignment Bayesian Kmer Matching RDP http://rdp.cme.msu.edu Wang, et al (2007)
More informationLecture 2: Diversity, Distances, adonis. Lecture 2: Diversity, Distances, adonis. Alpha- Diversity. Alpha diversity definition(s)
Lecture 2: Diversity, Distances, adonis Lecture 2: Diversity, Distances, adonis Diversity - alpha, beta (, gamma) Beta- Diversity in practice: Ecological Distances Unsupervised Learning: Clustering, etc
More informationMicrobiome: 16S rrna Sequencing 3/30/2018
Microbiome: 16S rrna Sequencing 3/30/2018 Skills from Previous Lectures Central Dogma of Biology Lecture 3: Genetics and Genomics Lecture 4: Microarrays Lecture 12: ChIP-Seq Phylogenetics Lecture 13: Phylogenetics
More informationUsing Topological Data Analysis to find discrimination between microbial states in human microbiome data
Using Topological Data Analysis to find discrimination between microbial states in human microbiome data Mehrdad Yazdani 1,2, Larry Smarr 1,3 and Rob Knight 4 1 California Institute for Telecommunications
More informationProbing diversity in a hidden world: applications of NGS in microbial ecology
Probing diversity in a hidden world: applications of NGS in microbial ecology Guus Roeselers TNO, Microbiology & Systems Biology Group Symposium on Next Generation Sequencing October 21, 2013 Royal Museum
More informationExploring Microbes in the Sea. Alma Parada Postdoctoral Scholar Stanford University
Exploring Microbes in the Sea Alma Parada Postdoctoral Scholar Stanford University Cruising the ocean to get us some microbes It s all about the Microbe! Microbes = microorganisms an organism that requires
More informationAn Adaptive Association Test for Microbiome Data
An Adaptive Association Test for Microbiome Data Chong Wu 1, Jun Chen 2, Junghi 1 Kim and Wei Pan 1 1 Division of Biostatistics, School of Public Health, University of Minnesota; 2 Division of Biomedical
More informationMicrobes and you ON THE LATEST HUMAN MICROBIOME DISCOVERIES, COMPUTATIONAL QUESTIONS AND SOME SOLUTIONS. Elizabeth Tseng
Microbes and you ON THE LATEST HUMAN MICROBIOME DISCOVERIES, COMPUTATIONAL QUESTIONS AND SOME SOLUTIONS Elizabeth Tseng Dept. of CSE, University of Washington Johanna Lampe Lab, Fred Hutchinson Cancer
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1. Detailed overview of the primer-free full-length SSU rrna library preparation.
Supplementary Figure 1 Detailed overview of the primer-free full-length SSU rrna library preparation. Detailed overview of the primer-free full-length SSU rrna library preparation. Supplementary Figure
More informationMicrobial Taxonomy and the Evolution of Diversity
19 Microbial Taxonomy and the Evolution of Diversity Copyright McGraw-Hill Global Education Holdings, LLC. Permission required for reproduction or display. 1 Taxonomy Introduction to Microbial Taxonomy
More information"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200 Spring 2014 University of California, Berkeley
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200 Spring 2014 University of California, Berkeley D.D. Ackerly April 16, 2014. Community Ecology and Phylogenetics Readings: Cavender-Bares,
More informationThe biogenesis-atbc2012 Training workshop "Evolutionary Approaches to Biodiversity Science" June 2012, Bonito, Brazil
The biogenesis-atbc2012 Training workshop "Evolutionary Approaches to Biodiversity Science" 16-18 June 2012, Bonito, Brazil Phylogenetic and functional diversity (including PD) and phylogenetic conservation
More informationFIG S1: Rarefaction analysis of observed richness within Drosophila. All calculations were
Page 1 of 14 FIG S1: Rarefaction analysis of observed richness within Drosophila. All calculations were performed using mothur (2). OTUs were defined at the 3% divergence threshold using the average neighbor
More informationII. Deep insight into plant habitats
II. Deep insight into plant habitats Sugar Beet The seed microbiome project (ACIB) Christin Zachow, Henry Müller Ralf Tilcher (KWS SAAT AG) Cultivar-specific microbiomes Experimental design Genetic pool
More informationAn introduction to the picante package
An introduction to the picante package Steven Kembel (steve.kembel@gmail.com) April 2010 Contents 1 Installing picante 1 2 Data formats in picante 2 2.1 Phylogenies................................ 2 2.2
More informationMiGA: The Microbial Genome Atlas
December 12 th 2017 MiGA: The Microbial Genome Atlas Jim Cole Center for Microbial Ecology Dept. of Plant, Soil & Microbial Sciences Michigan State University East Lansing, Michigan U.S.A. Where I m From
More informationWhole Genome Alignment. Adam Phillippy University of Maryland, Fall 2012
Whole Genome Alignment Adam Phillippy University of Maryland, Fall 2012 Motivation cancergenome.nih.gov Breast cancer karyotypes www.path.cam.ac.uk Goal of whole-genome alignment } For two genomes, A and
More informationMicrobial Taxonomy. Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible.
Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional
More informationBacterial Communities in Women with Bacterial Vaginosis: High Resolution Phylogenetic Analyses Reveal Relationships of Microbiota to Clinical Criteria
Bacterial Communities in Women with Bacterial Vaginosis: High Resolution Phylogenetic Analyses Reveal Relationships of Microbiota to Clinical Criteria Seminar presentation Pierre Barbera Supervised by:
More informationAmplicon Sequencing. Dr. Orla O Sullivan SIRG Research Fellow Teagasc
Amplicon Sequencing Dr. Orla O Sullivan SIRG Research Fellow Teagasc What is Amplicon Sequencing? Sequencing of target genes (are regions of ) obtained by PCR using gene specific primers. Why do we do
More informationSUPPLEMENTARY INFORMATION
City of origin as a confounding variable. The original study was designed such that the city where sampling was performed was perfectly confounded with where the DNA extractions and sequencing was performed.
More informationPhylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
More informationA (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
More informationA biogeographic distribution of magnetotactic bacteria influenced by salinity
(2012) 6, 475 479 & 2012 International Society for Microbial Ecology All rights reserved 1751-7362/12 www.nature.com/ismej SHORT COMMUNICATION A biogeographic distribution of magnetotactic bacteria influenced
More informationA comprehensive survey of soil acidobacterial diversity using pyrosequencing and clone library analyses
(2009) 3, 442 453 & 2009 International Society for Microbial Ecology All rights reserved 1751-7362/09 $32.00 www.nature.com/ismej ORIGINAL ARTICLE A comprehensive survey of soil acidobacterial diversity
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
More informationPhylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
More informationChapter 5. Evolution of Biodiversity
Chapter 5. Evolution of Biodiversity I. Earth s tremendous diversity A. life comes in many forms B. Recall 1. we can think of biodiversity in three ways a) genetic diversity b) species diversity c) ecosystem
More informationBacterial growth efficiency: do consumer and resource diversity influence the fate of carbon in aquatic ecosystems?
Bacterial growth efficiency: do consumer and resource diversity influence the fate of carbon in aquatic ecosystems? Muscarella M.E. & Lennon J.T. Department of Biology, Indiana University, USA Join the
More informationMicrobes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible.
Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional
More informationMicrobial Taxonomy. Slowly evolving molecules (e.g., rrna) used for large-scale structure; "fast- clock" molecules for fine-structure.
Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional
More informationEVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
More informationHow to quantify biological diversity: taxonomical, functional and evolutionary aspects. Hanna Tuomisto, University of Turku
How to quantify biological diversity: taxonomical, functional and evolutionary aspects Hanna Tuomisto, University of Turku Why quantify biological diversity? understanding the structure and function of
More informationOutline. Classification of Living Things
Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics
More informationInterpreting the Molecular Tree of Life: What Happened in Early Evolution? Norm Pace MCD Biology University of Colorado-Boulder
Interpreting the Molecular Tree of Life: What Happened in Early Evolution? Norm Pace MCD Biology University of Colorado-Boulder nrpace@colorado.edu Outline What is the Tree of Life? -- Historical Conceptually
More information"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
More informationHabitat Adaptation and Genome Evolution in the Gut Microbiome
University of Colorado, Boulder CU Scholar Molecular, Cellular, and Developmental Biology Graduate Theses & Dissertations Molecular, Cellular, and Developmental Biology Spring 1-1-2011 Habitat Adaptation
More informationLecture 5: Ecological distance metrics; Principal Coordinates Analysis. Univariate testing vs. community analysis
Lecture 5: Ecological distance metrics; Principal Coordinates Analysis Univariate testing vs. community analysis Univariate testing deals with hypotheses concerning individual taxa Is this taxon differentially
More informationRank-abundance. Geometric series: found in very communities such as the
Rank-abundance Geometric series: found in very communities such as the Log series: group of species that occur _ time are the most frequent. Useful for calculating a diversity metric (Fisher s alpha) Most
More informationLecture 5: Ecological distance metrics; Principal Coordinates Analysis. Univariate testing vs. community analysis
Lecture 5: Ecological distance metrics; Principal Coordinates Analysis Univariate testing vs. community analysis Univariate testing deals with hypotheses concerning individual taxa Is this taxon differentially
More informationPhylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
More informationHomework Assignment, Evolutionary Systems Biology, Spring Homework Part I: Phylogenetics:
Homework Assignment, Evolutionary Systems Biology, Spring 2009. Homework Part I: Phylogenetics: Introduction. The objective of this assignment is to understand the basics of phylogenetic relationships
More informationPhylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
More informationMicrobes and mountains: metagenetics on Mount Fuji, Japan. Jonathan Adams, Biology Department, SNU, Korea
Microbes and mountains: metagenetics on Mount Fuji, Japan Jonathan Adams, Biology Department, SNU, Korea jonadams@snu.ac.kr Until about a decade ago, culturing could only yield 8,000 described species
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationPhylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
More informationCompositional data methods for microbiome studies
Compositional data methods for microbiome studies M.Luz Calle Dept. of Biosciences, UVic-UCC http://mon.uvic.cat/bms/ http://mon.uvic.cat/master-omics/ 1 Important role of the microbiome in human health
More informationLetter to the Editor. Department of Biology, Arizona State University
Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationChapter 5 Evolution of Biodiversity. Sunday, October 1, 17
Chapter 5 Evolution of Biodiversity CHAPTER INTRO: The Dung of the Devil Read and Answer Questions Provided Module 14 The Biodiversity of Earth After reading this module you should be able to understand
More informationCommunity phylogenetics review/quiz
Community phylogenetics review/quiz A. This pattern represents and is a consequent of. Most likely to observe this at phylogenetic scales. B. This pattern represents and is a consequent of. Most likely
More informationCulturing captures members of the soil rare biosphereemi_
bs_bs_banner Environmental Microbiology (2012) doi:10.1111/j.1462-2920.2012.02817.x Correspondence Culturing captures members of the soil rare biosphereemi_2817 1..6 Ashley Shade, 1 Clifford S. Hogan,
More informationWhat is the range of a taxon? A scaling problem at three levels: Spa9al scale Phylogene9c depth Time
What is the range of a taxon? A scaling problem at three levels: Spa9al scale Phylogene9c depth Time 1 5 0.25 0.15 5 0.05 0.05 0.10 2 0.10 0.10 0.20 4 Reminder of what a range-weighted tree is Actual Tree
More information8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationEvolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
More informationChapter 27: Evolutionary Genetics
Chapter 27: Evolutionary Genetics Student Learning Objectives Upon completion of this chapter you should be able to: 1. Understand what the term species means to biology. 2. Recognize the various patterns
More informationIstituto di Microbiologia. Università Cattolica del Sacro Cuore, Roma. Gut Microbiota assessment and the Meta-HIT program.
Istituto di Microbiologia Università Cattolica del Sacro Cuore, Roma Gut Microbiota assessment and the Meta-HIT program Giovanni Delogu 1 Most of the bacteria species living in the gut cannot be cultivated
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationPOPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
More informationUoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)
- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the
More informationSPECIATION. REPRODUCTIVE BARRIERS PREZYGOTIC: Barriers that prevent fertilization. Habitat isolation Populations can t get together
SPECIATION Origin of new species=speciation -Process by which one species splits into two or more species, accounts for both the unity and diversity of life SPECIES BIOLOGICAL CONCEPT Population or groups
More informationHow the host sees and responds to pathogens
How the host sees and responds to pathogens David A. Relman, Stanford University IOM Forum on Microbial Threats March 17, 2005 Issues Pathogens and commensals: conserved patterns and pathways Sources of
More informationComparing Prokaryotic and Eukaryotic Cells
A prokaryotic cell Basic unit of living organisms is the cell; the smallest unit capable of life. Features found in all cells: Ribosomes Cell Membrane Genetic Material Cytoplasm ATP Energy External Stimuli
More informationStructure, function and host control of rhizosphere microbiome
Structure, function and host control of rhizosphere microbiome Davide Bulgarelli PhD, Microbiome AgBioTech Europe London, September 21st, 2017 Outline The rhizosphere microbiome Barley as a model to study
More informationPhylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
More informationMolecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
More informationImpact of training sets on classification of high-throughput bacterial 16s rrna gene surveys
(2012) 6, 94 103 & 2012 International Society for Microbial Ecology All rights reserved 1751-7362/12 www.nature.com/ismej ORIGINAL ARTICLE Impact of training sets on classification of high-throughput bacterial
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationMETHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
More informationMicrobial Diversity and Assessment (II) Spring, 2007 Guangyi Wang, Ph.D. POST103B
Microbial Diversity and Assessment (II) Spring, 007 Guangyi Wang, Ph.D. POST03B guangyi@hawaii.edu http://www.soest.hawaii.edu/marinefungi/ocn403webpage.htm General introduction and overview Taxonomy [Greek
More informationEffects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
More informationBioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony
ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),
More information9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
More informationConsistency Index (CI)
Consistency Index (CI) minimum number of changes divided by the number required on the tree. CI=1 if there is no homoplasy negatively correlated with the number of species sampled Retention Index (RI)
More informationBiology 211 (2) Week 1 KEY!
Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of
More informationCarlo Vittorio Cannistraci. Minimum Curvilinear Embedding unveils nonlinear patterns in 16S metagenomic data
Carlo Vittorio Cannistraci Minimum Curvilinear Embedding unveils nonlinear patterns in 16S metagenomic data Biomedical Cybernetics Group Biotechnology Center (BIOTEC) Technische Universität Dresden (TUD)
More informationBergey s Manual Classification Scheme. Vertical inheritance and evolutionary mechanisms
Bergey s Manual Classification Scheme Gram + Gram - No wall Funny wall Vertical inheritance and evolutionary mechanisms a b c d e * * a b c d e * a b c d e a b c d e * a b c d e Accumulation of neutral
More informationSupplemental Online Results:
Supplemental Online Results: Functional, phylogenetic, and computational determinants of prediction accuracy using reference genomes A series of tests determined the relationship between PICRUSt s prediction
More informationConstructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
More informationCommon Ground: soil biodiversity for humanity and ecosystems
Common Ground: soil biodiversity for humanity and ecosystems Diana H. Wall, School of Global Environmental Sustainability, Colorado State University World Day of Soils 2016 NRC Washington, DC The head
More informationAssigning Taxonomy to Marker Genes. Susan Huse Brown University August 7, 2014
Assigning Taxonomy to Marker Genes Susan Huse Brown University August 7, 2014 In a nutshell Taxonomy is assigned by comparing your DNA sequences against a database of DNA sequences from known taxa Marker
More informationSCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
More informationMultivariate analysis of genetic data: an introduction
Multivariate analysis of genetic data: an introduction Thibaut Jombart MRC Centre for Outbreak Analysis and Modelling Imperial College London XXIV Simposio Internacional De Estadística Bogotá, 25th July
More informationREVIEW 6: EVOLUTION. 1. Define evolution: Was not the first to think of evolution, but he did figure out how it works (mostly).
Name: REVIEW 6: EVOLUTION 1. Define evolution: 2. Modern Theory of Evolution: a. Charles Darwin: Was not the first to think of evolution, but he did figure out how it works (mostly). However, Darwin didn
More information"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2009 University of California, Berkeley
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2009 University of California, Berkeley B.D. Mishler Jan. 22, 2009. Trees I. Summary of previous lecture: Hennigian
More informationPHYLOGENY AND SYSTEMATICS
AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study
More informationBootstrapping and Tree reliability. Biol4230 Tues, March 13, 2018 Bill Pearson Pinn 6-057
Bootstrapping and Tree reliability Biol4230 Tues, March 13, 2018 Bill Pearson wrp@virginia.edu 4-2818 Pinn 6-057 Rooting trees (outgroups) Bootstrapping given a set of sequences sample positions randomly,
More informationPhylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
More informationEstimating Evolutionary Trees. Phylogenetic Methods
Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent
More informationCampbell Essential Biology, 5e (Simon/Yeh) Chapter 1 Introduction: Biology Today. Multiple-Choice Questions
Campbell Essential Biology, 5e (Simon/Yeh) Chapter 1 Introduction: Biology Today Multiple-Choice Questions 1) In what way(s) is the science of biology influencing and changing our culture? A) by helping
More informationTopic outline: Review: evolution and natural selection. Evolution 1. Geologic processes 2. Climate change 3. Catastrophes. Niche.
Topic outline: Review: evolution and natural selection Evolution 1. Geologic processes 2. Climate change 3. Catastrophes Niche Speciation Extinction Biodiversity Genetic engineering http://www.cengage.com/cgi-wadsworth/course_products_wp.pl?fid=m20b&product_isbn_issn=9780495015987&discipline_number=22
More informationChapter 19. Microbial Taxonomy
Chapter 19 Microbial Taxonomy 12-17-2008 Taxonomy science of biological classification consists of three separate but interrelated parts classification arrangement of organisms into groups (taxa; s.,taxon)
More information