Using Transcriptomics and Reverse Genetics to Understand Cnidarian-Dinoflagellate Symbiosis

Size: px
Start display at page:

Download "Using Transcriptomics and Reverse Genetics to Understand Cnidarian-Dinoflagellate Symbiosis"

Transcription

1 Using Transcriptomics and Reverse Genetics to Understand Cnidarian-Dinoflagellate Symbiosis Phillip Cleves Pringle Lab Department of Genetics, Stanford University

2 Corals differ in bleaching tolerance What coral genes help confer this tolerance?

3 Corals can be difficult to study in the lab. Inconvenient sizes Slow growing Difficult to maintain Hard calcareous skeleton Only seasonal access to larvae

4 Aiptasia as a model organism Aiptasia advantages Convenient sizes for experimentation Soft and hardy Large clonal populations Transcriptomic and genomic resources Symbiotic with similar types of Symbiodinium as corals Culturable in symbiotic and aposymbiotic states

5 Aiptasia bleach upon thermal stress Red Chlorophyll Fluorescence

6 Aiptasia bleach gradually at 34 o C Mean algal cells per µg protein (% of Day 0 Means) CC7 - SSB Days at 34 o C Clonal Aiptasiastrain CC7 harboring an axenic clade B Symbiodinium (SSB01).

7 What Aiptasia genes are involved in symbiosis and bleaching? We performed RNA- seq time courses on CC7- SSB01 and aposymbiotic CC7 anemones during heat stress.

8 A early heat- responsive gene cluster is up- regulated early in symbiotic and aposymbiotic anemones CC7 - APO CC7 - SSB01 Log 2 Fold Change Heat shock cognate 71 kda protein Heat shock 70 kda protein 1A Heat shock 70 kda protein XIAP associated factor 1 DnaJ homolog subfamily B member 4 DnaJ protein homolog 1 Predicted protein Predicted protein CD9 antigen Predicted protein Predicted protein Interferon regulatory factor 8 Caspase 7 predicted protein ETS domain containing protein Elk 1 NA Retrovirus related Pol polyprotein Retrovirus related Pol polyprotein Retrovirus related Pol polyprotein Krueppel like factor 5 Neuropeptide FF receptor 2 NA Uncharacterized protein Time (h)

9 Symbiosis genes change overtime as bleaching occurs in symbiotic animals Log 2 Fold Change Symbiotic - Aposymbiotic Transtition Genes CC7 - APO CC7 - SSB NPC2 Epididymal secretory protein E1 NA Equinatoxin 2 predicted protein Putative protein methyltransferase NA Vascular endothelial growth factor Sodium and chloride dependent GABA Ammonium transporter Rh type B Uncharacterized protein Cation transport regulator like protein Protransforming growth factor alpha Reticulocyte binding protein 2 homo

10 Which genes matter for symbiosis and bleaching? Establish genetic tools in Aiptasia and coral to functionally test candidate genes

11 Microinjection at the 1- cell stage yields viable larvae

12 Establish over-expression tools to functionally test candidate genes Microinject mrna into 1-cell zygotes Kaede mrna AAAAAAAA Photoconversion (358 nm) Kaede protein

13 Expression of Kaede protein from injected mrna into Aiptasia

14 How can we identify genes that are good targets for knock-down and knock-out?

15 FGF signaling is required for apical tuft formation in Nematostella (Rentzsch Technau, 2008)

16 FGF inhibitor (SU5402) blocks apical tuft formation in Aiptasia Larvae Anti- tubulin Phalloidin Wild- type 20 µm SU5402

17 FGF1a is expressed at the base of the apical tuft during development N = 88

18 Putative knockdown of FGF1a by morpholino microinjection Translation-blocking Morpholino Exon 1 FGF1a Exon 2

19 Putative knockdown of FGF1a by morpholino microinjection N = 88 N = 30 P < Percent larvae with apical tuft 100% 90% 80% 70% 60% 50% 40% 30% 20% 10% 0% Not Fluorescent Fluorescent

20 Can we modify the genomes of corals?

21 Microinjecting CRISPR/Cas9 complexes into Acropora millepora 1- cell zygotes

22 In vivo genome editing

23 Efficient genome editing

24 In vivo genome editing

25 Within larvae mutation rate

26 Genome editing in two paralogs of GFP with single sgrna Cleves et al, 2018 PNAS

27 Unified Approach to Understanding Cnidarian-Dinoflagellate Symbiosis Aiptasia + Coral Reverse Genetics

28 Thank You! Cory Krediet Postdoc Olivia Barry Lab Tech Ben Mason Postdoc John Pringle PI CRISPR/Cas9 in Coral Marie Strader Misha Matz Line Bay Arthur Grossman Steve Palumbi Mani Aranda

Supplementary Figure 1. Real time in vivo imaging of SG secretion. (a) SGs from Drosophila third instar larvae that express Sgs3-GFP (green) and

Supplementary Figure 1. Real time in vivo imaging of SG secretion. (a) SGs from Drosophila third instar larvae that express Sgs3-GFP (green) and Supplementary Figure 1. Real time in vivo imaging of SG secretion. (a) SGs from Drosophila third instar larvae that express Sgs3-GFP (green) and Lifeact-Ruby (red) were imaged in vivo to visualize secretion

More information

10-810: Advanced Algorithms and Models for Computational Biology. microrna and Whole Genome Comparison

10-810: Advanced Algorithms and Models for Computational Biology. microrna and Whole Genome Comparison 10-810: Advanced Algorithms and Models for Computational Biology microrna and Whole Genome Comparison Central Dogma: 90s Transcription factors DNA transcription mrna translation Proteins Central Dogma:

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Discussion Rationale for using maternal ythdf2 -/- mutants as study subject To study the genetic basis of the embryonic developmental delay that we observed, we crossed fish with different

More information

Introduction to Bioinformatics

Introduction to Bioinformatics CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics

More information

23-. Shoot and root development depend on ratio of IAA/CK

23-. Shoot and root development depend on ratio of IAA/CK Balance of Hormones regulate growth and development Environmental factors regulate hormone levels light- e.g. phototropism gravity- e.g. gravitropism temperature Mode of action of each hormone 1. Signal

More information

Cellular Neuroanatomy I The Prototypical Neuron: Soma. Reading: BCP Chapter 2

Cellular Neuroanatomy I The Prototypical Neuron: Soma. Reading: BCP Chapter 2 Cellular Neuroanatomy I The Prototypical Neuron: Soma Reading: BCP Chapter 2 Functional Unit of the Nervous System The functional unit of the nervous system is the neuron. Neurons are cells specialized

More information

Neural development its all connected

Neural development its all connected Neural development its all connected How do you build a complex nervous system? How do you build a complex nervous system? 1. Learn how tissue is instructed to become nervous system. Neural induction 2.

More information

Stochastic simulations

Stochastic simulations Stochastic simulations Application to molecular networks Literature overview Noise in genetic networks Origins How to measure and distinguish between the two types of noise (intrinsic vs extrinsic)? What

More information

Gene Control Mechanisms at Transcription and Translation Levels

Gene Control Mechanisms at Transcription and Translation Levels Gene Control Mechanisms at Transcription and Translation Levels Dr. M. Vijayalakshmi School of Chemical and Biotechnology SASTRA University Joint Initiative of IITs and IISc Funded by MHRD Page 1 of 9

More information

Similar specificities of symbiont uptake by adults and larvae in an anemone model system for coral biology

Similar specificities of symbiont uptake by adults and larvae in an anemone model system for coral biology First posted online on 13 February 2014 as 10.1242/jeb.095679 J Exp Biol Advance Access Online the most Articles. recent version First at posted http://jeb.biologists.org/lookup/doi/10.1242/jeb.095679

More information

Comparative Network Analysis

Comparative Network Analysis Comparative Network Analysis BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2016 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by

More information

Complete all warm up questions Focus on operon functioning we will be creating operon models on Monday

Complete all warm up questions Focus on operon functioning we will be creating operon models on Monday Complete all warm up questions Focus on operon functioning we will be creating operon models on Monday 1. What is the Central Dogma? 2. How does prokaryotic DNA compare to eukaryotic DNA? 3. How is DNA

More information

Translation Part 2 of Protein Synthesis

Translation Part 2 of Protein Synthesis Translation Part 2 of Protein Synthesis IN: How is transcription like making a jello mold? (be specific) What process does this diagram represent? A. Mutation B. Replication C.Transcription D.Translation

More information

Supplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1

Supplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1 Supplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1 F/F ;mir-17~92 F/F (Pkd1-miR-17~92KO) mice. (A) Q-PCR

More information

Nature Neuroscience: doi: /nn.2662

Nature Neuroscience: doi: /nn.2662 Supplementary Figure 1 Atlastin phylogeny and homology. (a) Maximum likelihood phylogenetic tree based on 18 Atlastin-1 sequences using the program Quicktree. Numbers at internal nodes correspond to bootstrap

More information

Evolutionary analysis of the well characterized endo16 promoter reveals substantial variation within functional sites

Evolutionary analysis of the well characterized endo16 promoter reveals substantial variation within functional sites Evolutionary analysis of the well characterized endo16 promoter reveals substantial variation within functional sites Paper by: James P. Balhoff and Gregory A. Wray Presentation by: Stephanie Lucas Reviewed

More information

Supplemental Information

Supplemental Information Molecular Cell, Volume 52 Supplemental Information The Translational Landscape of the Mammalian Cell Cycle Craig R. Stumpf, Melissa V. Moreno, Adam B. Olshen, Barry S. Taylor, and Davide Ruggero Supplemental

More information

The Role of Inorganic Carbon Transport and Accumulation in the CO 2 -Concentrating Mechanism and CO 2 Assimilation in Chlamydomonas

The Role of Inorganic Carbon Transport and Accumulation in the CO 2 -Concentrating Mechanism and CO 2 Assimilation in Chlamydomonas The Role of Inorganic Carbon Transport and Accumulation in the CO 2 -Concentrating Mechanism and CO 2 Assimilation in Chlamydomonas Is there a Role for the CCM in Increasing Biological CO 2 Capture? Generalized

More information

ENCODE DCC Antibody Validation Document

ENCODE DCC Antibody Validation Document ENCODE DCC Antibody Validation Document Date of Submission Name: Email: Lab Antibody Name: Target: Company/ Source: Catalog Number, database ID, laboratory Lot Number Antibody Description: Target Description:

More information

Lecture 18 June 2 nd, Gene Expression Regulation Mutations

Lecture 18 June 2 nd, Gene Expression Regulation Mutations Lecture 18 June 2 nd, 2016 Gene Expression Regulation Mutations From Gene to Protein Central Dogma Replication DNA RNA PROTEIN Transcription Translation RNA Viruses: genome is RNA Reverse Transcriptase

More information

Variation in the genetic response to high temperature in Montastraea faveolata from the Florida Keys & Mexico

Variation in the genetic response to high temperature in Montastraea faveolata from the Florida Keys & Mexico Variation in the genetic response to high temperature in Montastraea faveolata from the Florida Keys & Mexico Nicholas R. Polato 1, Christian R. Voolstra 2, Julia Schnetzer 3, Michael K. DeSalvo 4, Carly

More information

Bioinformatics. Transcriptome

Bioinformatics. Transcriptome Bioinformatics Transcriptome Jacques.van.Helden@ulb.ac.be Université Libre de Bruxelles, Belgique Laboratoire de Bioinformatique des Génomes et des Réseaux (BiGRe) http://www.bigre.ulb.ac.be/ Bioinformatics

More information

Gene networks in the wild: identifying transcriptional modules that. mediate coral resistance to experimental heat stress

Gene networks in the wild: identifying transcriptional modules that. mediate coral resistance to experimental heat stress Genome Biology and Evolution Advance Access published December 28, 2015 doi:10.1093/gbe/evv258 Gene networks in the wild: identifying transcriptional modules that mediate coral resistance to experimental

More information

Computational Biology: Basics & Interesting Problems

Computational Biology: Basics & Interesting Problems Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information

More information

Study of Cnidarian-Algal Symbiosis in the Omics Age

Study of Cnidarian-Algal Symbiosis in the Omics Age Reference: Biol. Bull. 223: 44 65. (August 2012) 2012 Marine Biological Laboratory Study of Cnidarian-Algal Symbiosis in the Omics Age ELI MEYER *, AND VIRGINIA M. WEIS * Department of Zoology, Oregon

More information

The geneticist s questions. Deleting yeast genes. Functional genomics. From Wikipedia, the free encyclopedia

The geneticist s questions. Deleting yeast genes. Functional genomics. From Wikipedia, the free encyclopedia From Wikipedia, the free encyclopedia Functional genomics..is a field of molecular biology that attempts to make use of the vast wealth of data produced by genomic projects (such as genome sequencing projects)

More information

Student Learning Outcomes: Nucleus distinguishes Eukaryotes from Prokaryotes

Student Learning Outcomes: Nucleus distinguishes Eukaryotes from Prokaryotes 9 The Nucleus Student Learning Outcomes: Nucleus distinguishes Eukaryotes from Prokaryotes Explain general structures of Nuclear Envelope, Nuclear Lamina, Nuclear Pore Complex Explain movement of proteins

More information

Evolutionary factors and synthetic biology

Evolutionary factors and synthetic biology Evolutionary factors and synthetic biology NAS Joint Session on Climate Change and Ecology Owain Edwards Group Leader, Environmental Synthetic Genomics, CSIRO, Perth, Australia Domain Leader, Biocontrol

More information

Fig. S1. Proliferation and cell cycle exit are affected by the med mutation. (A,B) M-phase nuclei are visualized by a-ph3 labeling in wild-type (A)

Fig. S1. Proliferation and cell cycle exit are affected by the med mutation. (A,B) M-phase nuclei are visualized by a-ph3 labeling in wild-type (A) Fig. S1. Proliferation and cell cycle exit are affected by the med mutation. (A,B) M-phase nuclei are visualized by a-ph3 labeling in wild-type (A) and mutant (B) 4 dpf retinae. The central retina of the

More information

The Research Plan. Functional Genomics Research Stream. Transcription Factors. Tuning In Is A Good Idea

The Research Plan. Functional Genomics Research Stream. Transcription Factors. Tuning In Is A Good Idea Functional Genomics Research Stream The Research Plan Tuning In Is A Good Idea Research Meeting: March 23, 2010 The Road to Publication Transcription Factors Protein that binds specific DNA sequences controlling

More information

REVIEW SESSION. Wednesday, September 15 5:30 PM SHANTZ 242 E

REVIEW SESSION. Wednesday, September 15 5:30 PM SHANTZ 242 E REVIEW SESSION Wednesday, September 15 5:30 PM SHANTZ 242 E Gene Regulation Gene Regulation Gene expression can be turned on, turned off, turned up or turned down! For example, as test time approaches,

More information

Chapter 15 Active Reading Guide Regulation of Gene Expression

Chapter 15 Active Reading Guide Regulation of Gene Expression Name: AP Biology Mr. Croft Chapter 15 Active Reading Guide Regulation of Gene Expression The overview for Chapter 15 introduces the idea that while all cells of an organism have all genes in the genome,

More information

Geert Geeven. April 14, 2010

Geert Geeven. April 14, 2010 iction of Gene Regulatory Interactions NDNS+ Workshop April 14, 2010 Today s talk - Outline Outline Biological Background Construction of Predictors The main aim of my project is to better understand the

More information

Gene regulation I Biochemistry 302. Bob Kelm February 25, 2005

Gene regulation I Biochemistry 302. Bob Kelm February 25, 2005 Gene regulation I Biochemistry 302 Bob Kelm February 25, 2005 Principles of gene regulation (cellular versus molecular level) Extracellular signals Chemical (e.g. hormones, growth factors) Environmental

More information

Nature Genetics: doi: /ng Supplementary Figure 1. Icm/Dot secretion system region I in 41 Legionella species.

Nature Genetics: doi: /ng Supplementary Figure 1. Icm/Dot secretion system region I in 41 Legionella species. Supplementary Figure 1 Icm/Dot secretion system region I in 41 Legionella species. Homologs of the effector-coding gene lega15 (orange) were found within Icm/Dot region I in 13 Legionella species. In four

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb3267 Supplementary Figure 1 A group of genes required for formation or orientation of annular F-actin bundles and aecm ridges: RNAi phenotypes and their validation by standard mutations.

More information

Visit to BPRC. Data is crucial! Case study: Evolution of AIRE protein 6/7/13

Visit to BPRC. Data is crucial! Case study: Evolution of AIRE protein 6/7/13 Visit to BPRC Adres: Lange Kleiweg 161, 2288 GJ Rijswijk Utrecht CS à Den Haag CS 9:44 Spoor 9a, arrival 10:22 Den Haag CS à Delft 10:28 Spoor 1, arrival 10:44 10:48 Delft Voorzijde à Bushalte TNO/Lange

More information

The Microbial World. Chapter 5

The Microbial World. Chapter 5 The Microbial World Chapter 5 Viruses Non-cellular infectious agents that have two basic characteristics: Not capable of reproduction without a host cell Structure: Nucleic acid core- can be DNA or RNA

More information

the noisy gene Biology of the Universidad Autónoma de Madrid Jan 2008 Juan F. Poyatos Spanish National Biotechnology Centre (CNB)

the noisy gene Biology of the Universidad Autónoma de Madrid Jan 2008 Juan F. Poyatos Spanish National Biotechnology Centre (CNB) Biology of the the noisy gene Universidad Autónoma de Madrid Jan 2008 Juan F. Poyatos Spanish National Biotechnology Centre (CNB) day III: noisy bacteria - Regulation of noise (B. subtilis) - Intrinsic/Extrinsic

More information

Proteomics. 2 nd semester, Department of Biotechnology and Bioinformatics Laboratory of Nano-Biotechnology and Artificial Bioengineering

Proteomics. 2 nd semester, Department of Biotechnology and Bioinformatics Laboratory of Nano-Biotechnology and Artificial Bioengineering Proteomics 2 nd semester, 2013 1 Text book Principles of Proteomics by R. M. Twyman, BIOS Scientific Publications Other Reference books 1) Proteomics by C. David O Connor and B. David Hames, Scion Publishing

More information

Carri-Lyn Mead Thursday, January 13, 2005 Terry Fox Laboratory, Dr. Dixie Mager

Carri-Lyn Mead Thursday, January 13, 2005 Terry Fox Laboratory, Dr. Dixie Mager Investigating Trends in Transposable Element Insertion within Regulatory Regions Carri-Lyn Mead cmead@bcgsc.ca Thursday, January 13, 2005 Terry Fox Laboratory, Dr. Dixie Mager Outline Transposable Element

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/6/301/ra98/dc1 Supplementary Materials for Regulation of Epithelial Morphogenesis by the G Protein Coupled Receptor Mist and Its Ligand Fog Alyssa J. Manning,

More information

RNAi Suppression of AGAMOUS-like Genes Causes Field Sterility in Populus

RNAi Suppression of AGAMOUS-like Genes Causes Field Sterility in Populus RNAi Suppression of AGAMOUS-like Genes Causes Field Sterility in Populus Haiwei Lu and Steven H. Strauss Oregon State University Forest Tree Workshop PAG XXVI, San Diego, CA, 2018 The containment issue

More information

Transport between cytosol and nucleus

Transport between cytosol and nucleus of 60 3 Gated trans Lectures 9-15 MBLG 2071 The n GATED TRANSPORT transport between cytoplasm and nucleus (bidirectional) controlled by the nuclear pore complex active transport for macro molecules e.g.

More information

GENE REGULATION AND PROBLEMS OF DEVELOPMENT

GENE REGULATION AND PROBLEMS OF DEVELOPMENT GENE REGULATION AND PROBLEMS OF DEVELOPMENT By Surinder Kaur DIET Ropar Surinder_1998@ yahoo.in Mob No 9988530775 GENE REGULATION Gene is a segment of DNA that codes for a unit of function (polypeptide,

More information

Gene Regulation and Expression

Gene Regulation and Expression THINK ABOUT IT Think of a library filled with how-to books. Would you ever need to use all of those books at the same time? Of course not. Now picture a tiny bacterium that contains more than 4000 genes.

More information

Chapter 18 Lecture. Concepts of Genetics. Tenth Edition. Developmental Genetics

Chapter 18 Lecture. Concepts of Genetics. Tenth Edition. Developmental Genetics Chapter 18 Lecture Concepts of Genetics Tenth Edition Developmental Genetics Chapter Contents 18.1 Differentiated States Develop from Coordinated Programs of Gene Expression 18.2 Evolutionary Conservation

More information

The geneticist s questions

The geneticist s questions The geneticist s questions a) What is consequence of reduced gene function? 1) gene knockout (deletion, RNAi) b) What is the consequence of increased gene function? 2) gene overexpression c) What does

More information

Arabidopsis COMPASS-Like Complexes Mediate Histone H3 Lysine-4 Trimethylation to Control Floral Transition and Plant Development

Arabidopsis COMPASS-Like Complexes Mediate Histone H3 Lysine-4 Trimethylation to Control Floral Transition and Plant Development Arabidopsis COMPASS-Like Complexes Mediate Histone H3 Lysine-4 Trimethylation to Control Floral Transition and Plant Development Danhua Jiang 1,2, Nicholas C. Kong 1,2, Xiaofeng Gu 2, Zicong Li 1, Yuehui

More information

Honors Biology Reading Guide Chapter 11

Honors Biology Reading Guide Chapter 11 Honors Biology Reading Guide Chapter 11 v Promoter a specific nucleotide sequence in DNA located near the start of a gene that is the binding site for RNA polymerase and the place where transcription begins

More information

Discovering MultipleLevels of Regulatory Networks

Discovering MultipleLevels of Regulatory Networks Discovering MultipleLevels of Regulatory Networks IAS EXTENDED WORKSHOP ON GENOMES, CELLS, AND MATHEMATICS Hong Kong, July 25, 2018 Gary D. Stormo Department of Genetics Outline of the talk 1. Transcriptional

More information

Ab1 (57-68) Ab2 ( ) Ab3 ( ) Ab4 ( ) GBP-N domain GBP-C domain CARD domain

Ab1 (57-68) Ab2 ( ) Ab3 ( ) Ab4 ( ) GBP-N domain GBP-C domain CARD domain MDKPVCLIDTGSDGKLCVQQAALQVLQQIQQPVVVVAVVGLYRTGKSFLMNRLAG 55 KRTGFALSSNIKPKTEGIWMWCVPHPTKAGTSLVLLDTKGLGDVEKGDSKRDTYI 110 FSLTVLLSSTLVYNSRGVIDNKAMEELQYVTELIEHIKVTPDEDADDCTAFAKFF 165 PHFIWCLRDFTLELKLDGKDLTEDEYLEFALKLRPGTLKKVMMYNLPRECIQKFF

More information

Genome wide analysis of protein and mrna half lives reveals dynamic properties of mammalian gene expression

Genome wide analysis of protein and mrna half lives reveals dynamic properties of mammalian gene expression Genome wide analysis of protein and mrna half lives reveals dynamic properties of mammalian gene expression Matthias Selbach Cell Signaling and Mass Spectrometry Max Delbrück Center for Molecular Medicine

More information

Lecture 10: Cyclins, cyclin kinases and cell division

Lecture 10: Cyclins, cyclin kinases and cell division Chem*3560 Lecture 10: Cyclins, cyclin kinases and cell division The eukaryotic cell cycle Actively growing mammalian cells divide roughly every 24 hours, and follow a precise sequence of events know as

More information

UNIVERSITY OF YORK BIOLOGY. Developmental Biology

UNIVERSITY OF YORK BIOLOGY. Developmental Biology Examination Candidate Number: UNIVERSITY OF YORK BSc Stage 2 Degree Examinations 2017-18 Department: BIOLOGY Title of Exam: Developmental Biology Desk Number: Time allowed: 1 hour and 30 minutes Total

More information

56:198:582 Biological Networks Lecture 8

56:198:582 Biological Networks Lecture 8 56:198:582 Biological Networks Lecture 8 Course organization Two complementary approaches to modeling and understanding biological networks Constraint-based modeling (Palsson) System-wide Metabolism Steady-state

More information

Bi 1x Spring 2014: LacI Titration

Bi 1x Spring 2014: LacI Titration Bi 1x Spring 2014: LacI Titration 1 Overview In this experiment, you will measure the effect of various mutated LacI repressor ribosome binding sites in an E. coli cell by measuring the expression of a

More information

Identifying Signaling Pathways

Identifying Signaling Pathways These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by Anthony Gitter, Mark Craven, Colin Dewey Identifying Signaling Pathways BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2018

More information

Molecular Developmental Physiology and Signal Transduction

Molecular Developmental Physiology and Signal Transduction Prof. Dr. J. Vanden Broeck (Animal Physiology and Neurobiology - Dept. of Biology - KU Leuven) Molecular Developmental Physiology and Signal Transduction My Research Team Insect species under study +

More information

UNIT 6 PART 3 *REGULATION USING OPERONS* Hillis Textbook, CH 11

UNIT 6 PART 3 *REGULATION USING OPERONS* Hillis Textbook, CH 11 UNIT 6 PART 3 *REGULATION USING OPERONS* Hillis Textbook, CH 11 REVIEW: Signals that Start and Stop Transcription and Translation BUT, HOW DO CELLS CONTROL WHICH GENES ARE EXPRESSED AND WHEN? First of

More information

Proteomics Systems Biology

Proteomics Systems Biology Dr. Sanjeeva Srivastava IIT Bombay Proteomics Systems Biology IIT Bombay 2 1 DNA Genomics RNA Transcriptomics Global Cellular Protein Proteomics Global Cellular Metabolite Metabolomics Global Cellular

More information

BIOLOGY OF CORALS Semester [changes, usually A]

BIOLOGY OF CORALS Semester [changes, usually A] 2016-2017 BIOLOGY OF CORALS 227.4036 Semester [changes, usually A] Time: [IN the IUI Eilat 10 days] Instructor: [PhD] [Dan] [Tchernov] & PhD Maoz Fine Office Hours: [NR] Teaching Assistants & Office Hours:

More information

ENCODE DCC Antibody Validation Document

ENCODE DCC Antibody Validation Document ENCODE DCC Antibody Validation Document Date of Submission Name: Email: Lab Antibody Name: Target: Company/ Source: Catalog Number, database ID, laboratory Lot Number Antibody Description: Target Description:

More information

3/8/ Complex adaptations. 2. often a novel trait

3/8/ Complex adaptations. 2. often a novel trait Chapter 10 Adaptation: from genes to traits p. 302 10.1 Cascades of Genes (p. 304) 1. Complex adaptations A. Coexpressed traits selected for a common function, 2. often a novel trait A. not inherited from

More information

Apoptosis in Mammalian Cells

Apoptosis in Mammalian Cells Apoptosis in Mammalian Cells 7.16 2-10-05 Apoptosis is an important factor in many human diseases Cancer malignant cells evade death by suppressing apoptosis (too little apoptosis) Stroke damaged neurons

More information

Comparative analysis of RNA- Seq data with DESeq2

Comparative analysis of RNA- Seq data with DESeq2 Comparative analysis of RNA- Seq data with DESeq2 Simon Anders EMBL Heidelberg Two applications of RNA- Seq Discovery Eind new transcripts Eind transcript boundaries Eind splice junctions Comparison Given

More information

AP Biology Gene Regulation and Development Review

AP Biology Gene Regulation and Development Review AP Biology Gene Regulation and Development Review 1. What does the regulatory gene code for? 2. Is the repressor by default active/inactive? 3. What changes the repressor activity? 4. What does repressor

More information

Stochastic simulations!

Stochastic simulations! Stochastic simulations! Application to biomolecular networks! Literature overview Noise in genetic networks! Origins! How to measure the noise and distinguish between the two sources of noise (intrinsic

More information

Transcriptome analysis of a wild bird reveals physiological responses to the urban environment

Transcriptome analysis of a wild bird reveals physiological responses to the urban environment Supplementary Information ppendix S1 Transcriptome analysis of a wild bird reveals physiological responses to the urban environment Hannah Watson 1*, Elin Videvall 1, Martin N. ndersson 1 and Caroline

More information

GLOBEX Bioinformatics (Summer 2015) Genetic networks and gene expression data

GLOBEX Bioinformatics (Summer 2015) Genetic networks and gene expression data GLOBEX Bioinformatics (Summer 2015) Genetic networks and gene expression data 1 Gene Networks Definition: A gene network is a set of molecular components, such as genes and proteins, and interactions between

More information

Follow this and additional works at:

Follow this and additional works at: Washington University School of Medicine Digital Commons@Becker Open Access Publications 2014 The DAF-16 FOXO transcription factor regulates natc-1 to modulate stress resistance in Caenorhabditis elegans,

More information

BIS &003 Answers to Assigned Problems May 23, Week /18.6 How would you distinguish between an enhancer and a promoter?

BIS &003 Answers to Assigned Problems May 23, Week /18.6 How would you distinguish between an enhancer and a promoter? Week 9 Study Questions from the textbook: 6 th Edition: Chapter 19-19.6, 19.7, 19.15, 19.17 OR 7 th Edition: Chapter 18-18.6 18.7, 18.15, 18.17 19.6/18.6 How would you distinguish between an enhancer and

More information

Biology. Biology. Slide 1 of 26. End Show. Copyright Pearson Prentice Hall

Biology. Biology. Slide 1 of 26. End Show. Copyright Pearson Prentice Hall Biology Biology 1 of 26 Fruit fly chromosome 12-5 Gene Regulation Mouse chromosomes Fruit fly embryo Mouse embryo Adult fruit fly Adult mouse 2 of 26 Gene Regulation: An Example Gene Regulation: An Example

More information

(Lys), resulting in translation of a polypeptide without the Lys amino acid. resulting in translation of a polypeptide without the Lys amino acid.

(Lys), resulting in translation of a polypeptide without the Lys amino acid. resulting in translation of a polypeptide without the Lys amino acid. 1. A change that makes a polypeptide defective has been discovered in its amino acid sequence. The normal and defective amino acid sequences are shown below. Researchers are attempting to reproduce the

More information

Daphnia magna. Genetic and plastic responses in

Daphnia magna. Genetic and plastic responses in Genetic and plastic responses in Daphnia magna Comparison of clonal differences and environmental stress induced changes in alternative splicing and gene expression. Jouni Kvist Institute of Biotechnology,

More information

Genome-wide analysis of the MYB transcription factor superfamily in soybean

Genome-wide analysis of the MYB transcription factor superfamily in soybean Du et al. BMC Plant Biology 2012, 12:106 RESEARCH ARTICLE Open Access Genome-wide analysis of the MYB transcription factor superfamily in soybean Hai Du 1,2,3, Si-Si Yang 1,2, Zhe Liang 4, Bo-Run Feng

More information

13.4 Gene Regulation and Expression

13.4 Gene Regulation and Expression 13.4 Gene Regulation and Expression Lesson Objectives Describe gene regulation in prokaryotes. Explain how most eukaryotic genes are regulated. Relate gene regulation to development in multicellular organisms.

More information

Prokaryotic Gene Expression (Learning Objectives)

Prokaryotic Gene Expression (Learning Objectives) Prokaryotic Gene Expression (Learning Objectives) 1. Learn how bacteria respond to changes of metabolites in their environment: short-term and longer-term. 2. Compare and contrast transcriptional control

More information

Topic 4: Equilibrium binding and chemical kinetics

Topic 4: Equilibrium binding and chemical kinetics Topic 4: Equilibrium binding and chemical kinetics Outline: Applications, applications, applications use Boltzmann to look at receptor-ligand binding use Boltzmann to look at PolII-DNA binding and gene

More information

Full file at CHAPTER 2 Genetics

Full file at   CHAPTER 2 Genetics CHAPTER 2 Genetics MULTIPLE CHOICE 1. Chromosomes are a. small linear bodies. b. contained in cells. c. replicated during cell division. 2. A cross between true-breeding plants bearing yellow seeds produces

More information

Designer Genes C Test

Designer Genes C Test Northern Regional: January 19 th, 2019 Designer Genes C Test Name(s): Team Name: School Name: Team Number: Rank: Score: Directions: You will have 50 minutes to complete the test. You may not write on the

More information

7.06 Problem Set #4, Spring 2005

7.06 Problem Set #4, Spring 2005 7.06 Problem Set #4, Spring 2005 1. You re doing a mutant hunt in S. cerevisiae (budding yeast), looking for temperaturesensitive mutants that are defective in the cell cycle. You discover a mutant strain

More information

Fitness constraints on horizontal gene transfer

Fitness constraints on horizontal gene transfer Fitness constraints on horizontal gene transfer Dan I Andersson University of Uppsala, Department of Medical Biochemistry and Microbiology, Uppsala, Sweden GMM 3, 30 Aug--2 Sep, Oslo, Norway Acknowledgements:

More information

Eukaryotic vs. Prokaryotic genes

Eukaryotic vs. Prokaryotic genes BIO 5099: Molecular Biology for Computer Scientists (et al) Lecture 18: Eukaryotic genes http://compbio.uchsc.edu/hunter/bio5099 Larry.Hunter@uchsc.edu Eukaryotic vs. Prokaryotic genes Like in prokaryotes,

More information

The Complete Set Of Genetic Instructions In An Organism's Chromosomes Is Called The

The Complete Set Of Genetic Instructions In An Organism's Chromosomes Is Called The The Complete Set Of Genetic Instructions In An Organism's Chromosomes Is Called The What is a genome? A genome is an organism's complete set of genetic instructions. Single strands of DNA are coiled up

More information

Name: SBI 4U. Gene Expression Quiz. Overall Expectation:

Name: SBI 4U. Gene Expression Quiz. Overall Expectation: Gene Expression Quiz Overall Expectation: - Demonstrate an understanding of concepts related to molecular genetics, and how genetic modification is applied in industry and agriculture Specific Expectation(s):

More information

Inferring Transcriptional Regulatory Networks from Gene Expression Data II

Inferring Transcriptional Regulatory Networks from Gene Expression Data II Inferring Transcriptional Regulatory Networks from Gene Expression Data II Lectures 9 Oct 26, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday

More information

Regulation of Gene Expression

Regulation of Gene Expression Chapter 18 Regulation of Gene Expression PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from

More information

Evidence for dynamically organized modularity in the yeast protein-protein interaction network

Evidence for dynamically organized modularity in the yeast protein-protein interaction network Evidence for dynamically organized modularity in the yeast protein-protein interaction network Sari Bombino Helsinki 27.3.2007 UNIVERSITY OF HELSINKI Department of Computer Science Seminar on Computational

More information

Common Effects of Abiotic Stress Factors on Plants

Common Effects of Abiotic Stress Factors on Plants Common Effects of Abiotic Stress Factors on Plants Plants are living organisms which lack ability of locomotion. Animals can move easily from one location to other. Immovable property of plants makes it

More information

The Genetic Landscape of Caribbean Acropora Corals. by Elizabeth M. Hemond. B.A. in Environmental Biology, Columbia University

The Genetic Landscape of Caribbean Acropora Corals. by Elizabeth M. Hemond. B.A. in Environmental Biology, Columbia University The Genetic Landscape of Caribbean Acropora Corals by Elizabeth M. Hemond B.A. in Environmental Biology, Columbia University M.S. in Marine Biology, University of North Carolina Wilmington A dissertation

More information

downstream (0.8 kb) homologous sequences to the genomic locus of DIC. A DIC mutant strain (ro- 6

downstream (0.8 kb) homologous sequences to the genomic locus of DIC. A DIC mutant strain (ro- 6 A B C D ts Figure S1 Generation of DIC- mcherry expressing N.crassa strain. A. N. crassa colony morphology. When a cot1 (top, left panel) strain is grown at permissive temperature (25 C), it exhibits straight

More information

BME 5742 Biosystems Modeling and Control

BME 5742 Biosystems Modeling and Control BME 5742 Biosystems Modeling and Control Lecture 24 Unregulated Gene Expression Model Dr. Zvi Roth (FAU) 1 The genetic material inside a cell, encoded in its DNA, governs the response of a cell to various

More information

Production of recombinant proteins in microalgae at pilot greenhouse scale

Production of recombinant proteins in microalgae at pilot greenhouse scale Production of recombinant proteins in microalgae at pilot greenhouse scale Javier Gimpel University of California, San Diego Volvox carteri Algae Biomass Summit 2014 San Diego, CA 10/01/14 Expression of

More information

Dynamical Modeling in Biology: a semiotic perspective. Junior Barrera BIOINFO-USP

Dynamical Modeling in Biology: a semiotic perspective. Junior Barrera BIOINFO-USP Dynamical Modeling in Biology: a semiotic perspective Junior Barrera BIOINFO-USP Layout Introduction Dynamical Systems System Families System Identification Genetic networks design Cell Cycle Modeling

More information

Lecture 4: Transcription networks basic concepts

Lecture 4: Transcription networks basic concepts Lecture 4: Transcription networks basic concepts - Activators and repressors - Input functions; Logic input functions; Multidimensional input functions - Dynamics and response time 2.1 Introduction The

More information

1. In most cases, genes code for and it is that

1. In most cases, genes code for and it is that Name Chapter 10 Reading Guide From DNA to Protein: Gene Expression Concept 10.1 Genetics Shows That Genes Code for Proteins 1. In most cases, genes code for and it is that determine. 2. Describe what Garrod

More information

CLIMATE CHANGE: DOES MEMORY IN CORAL

CLIMATE CHANGE: DOES MEMORY IN CORAL CLIMATE CHANGE: DOES MEMORY IN CORAL DICTATE FITNESS IN A CHANGING WORLD? 1Kevin 1Annis 2Louisiana B. Strychar & 2Paul W. Sammarco Water Resources Institute of Grand Valley State University, Michigan,

More information

Question Set # 4 Answer Key 7.22 Nov. 2002

Question Set # 4 Answer Key 7.22 Nov. 2002 Question Set # 4 Answer Key 7.22 Nov. 2002 1) A variety of reagents and approaches are frequently used by developmental biologists to understand the tissue interactions and molecular signaling pathways

More information

Supplementary Information. Drought response transcriptomics are altered in poplar with reduced tonoplast sucrose transporter expression

Supplementary Information. Drought response transcriptomics are altered in poplar with reduced tonoplast sucrose transporter expression Supplementary Information Drought response transcriptomics are altered in poplar with reduced tonoplast sucrose transporter expression Liang Jiao Xue, Christopher J. Frost, Chung Jui Tsai, Scott A. Harding

More information