Protein bioinforma-cs. Åsa Björklund CMB/LICR
|
|
- Allen Smith
- 5 years ago
- Views:
Transcription
1 Protein bioinforma-cs Åsa Björklund CMB/LICR
2 In this lecture Protein structures and 3D structure predic-on Protein domains HMMs Protein networks Protein func-on annota-on / predic-on
3 PTM Localiza-on Degrada-on Muta-ons Selec-on Gene mrna Polypep-de Folding 3D protein Protein complex ATGATCATGGTTACAGGT AUGAUCAUGGUUACAGGU MAHRKYLI Structure is more conserved than sequence!
4 This lecture Protein structures and structure predic-on Protein domains Mo-fs, Profiles and HMMs Some servers Protein networks Func-on predic-on
5 Protein sequence databases UniProtKB Swiss- Prot Quality PIR- PSD TrEMBL Quan-ty UniMES (metagenomics samples) Entrez Protein (NCBI) Coding regions from GenBank and Swissprot, PIR, PDB, etc. RefSeq Non redundant databases Uniref100, Uniref90 etc. NCBI nr
6 Protein structure databases (Gutmanas et al. 2013) 1. So_ X- ray tomogram of a fission yeast cell 2. Electron tomogram of ribosomes in the cytosol 3. Cryo- EM reconstruc-on of the 80S ribosome from yeast 4. Crystal structure of the 50S ribosomal subunit (PDB entry 3uzk) 5. Crystal structure revealing how tmrna and the small protein SmpB enable the kirromycin- stalled 70S ribosome to proceed with transla-on (PDB entries 4abr and 4abs)
7 PDB Protein Data Bank Main database of three-dimensional protein structures Also contains structures of other macromolecules (DNA, RNA, carbohydrates) PDB entry format resembles EMBL Currently (May 2013) 90,424 entries
8 Viewing protein structures Pymol Jmol Rasmol Download PDB file Open in viewer Select, color, rotate
9 Structure predic-on De novo folding Molecular Dynamics Based on energy minimiza-on, depends on star-ng structure Works well for small pepe-des, not feasible for very large proteins Homology modelling Template from homologous structure(s) Refinement based on energy minimiza-on Swiss- modeller, 3D- Jigsaw Consensus methods Combines predic-ons from several servers Pcons.net
10 Docking Predict interac-ons between proteins or protein and ligand Most proteins change conforma-on upon binding Ligand docking commonly used in drug design HADDOCK, PatchDock, ClusPro
11 Protein domains
12 Protein domains Defined as independent folding unit or independent evolving unit Each domain has a characteris-c structure and/or func-on conserved in evolu-on Domains are o_en combined to create mul-- domain proteins O_en grouped into families and superfamilies Known domains in ~80% of all proteins, covering ~58% of the residues
13 Protein domains
14 Protein Structure Classifica-on Databases QUALITY SCOP : All manual CATH : Semi-automatic FSSP : All automatic ENTREZ: All automatic QUANTITY
15 Structural Classifica-on Of Proteins (SCOP) Attempt to classify all proteins in PDB according to structural and evolutionary relationships Hierarchical classification system Classification based on human expertise Superfamily contains HMMs for all SCOP families (
16 SCOP Main secondary structure elements Class " Fold Superfamily Family All- alpha All- beta Alpha/beta
17 SCOP Arrangements of secondary structure elements Class " Fold Superfamily Family Globin- like Prion- like Alpha- beta knot
18 SCOP Low sequence similarity but conserved structure and/ or func-on Class " Fold Superfamily Family
19 SCOP Significant sequence similarity and similar structure and func-on Class " Fold Superfamily Family
20 Domains based on sequence conserva-on Pfam - pfam.sanger.ac.uk PfamA manually curated PfamB autmated clustering PfamClans groups families into superfamilies Smart - smart.embl- heidelberg.de Manually curated, specializes in signalling, extracellular and chroma-n- associated proteins. ProDom - prodom.prabi.fr Automated clustering
21 Other mo-fs DNA/RNA/Protein binding mo-fs Transmembrane helices (TMH) Signal pep-des Pospransla-onal modifica-on (PTM) signals Secondary structure Disordered regions
22 Hidden Markov Models (HMMs) Different states, with different probabili-es of each symbol (aa or nt) at each state Transi-on probabili-es between states Insert states Silent states
23 HMM models: key concepts - No magic involved: just an extension of the profile - Enables modelling of deletions and insertions - Very useful for protein domains, HMMs for many different domain databases such as SCOP, Pfam etc. are available for download or web-based searches - Common programs to build HMMs from MSAs and scan sequence databases for matches are HMMER and SAM.
24 HMMER Program package by Sean Eddy (hmmer.janelia.org) Create HMMs from Mul-ple Sequence Alignment (MSA) Run searches with HMMs, ex. Pfam Requires a few unix commands Has webserver for homology searches
25 Membrane protein topology predic-on Predict transmembrane helices (TMH) based on hydrophobicity profile A TMH is normally about 20aa Reentrant regions can create mispredic-ons Posi-ve inside rule guides the direc-on O_en includes homology informa-on Most methods use HMMs for predic-on
26 Membrane protein topology predic-on hpp://topcons.cbr.su.se/
27 Predic-on of signal pep-des A signal pep-de is a short (3-60 amino acids long) pep-de chain that directs the post- transla-onal transport of a protein. Signal pep-des may also be called targe-ng signals, signal sequences, transit pep-des, or localiza-on signals.
28 Predic-on of cleavage site and localiza-on SignalP - predicts the presence and loca-on of signal pep-de cleavage sites in amino acid sequences from different organisms: Gram- posi-ve prokaryotes Gram- nega-ve prokaryotes Eukaryotes TargetP - predicts the subcellular loca-on of eukaryo-c proteins. The loca-on assignment is based on the predicted presence of any of the N- terminal presequences: chloroplast transit pep-de (ctp), mitochondrial targe-ng pep-de (mtp) or secretory pathway signal pep-de (SP). The methods combines predic-on from several ar-ficial neural networks and HMMs.
29 InterPro Integrates domain/mo-f predic-ons from several databases ProDom: sequence- clusters built from UniProtKB using PSI- BLAST. PROSITE paperns: simple regular expressions. PROSITE and HAMAP profiles: sequence matrices. PRINTS fingerprints, un- weighted Posi-on Specific Sequence Matrices (PSSMs). PANTHER, PIRSF, Pfam, SMART, TIGRFAMs, Gene3D and SUPERFAMILY: hidden Markov models (HMMs). TMHMM, SignalP
30 Protein interac-on networks Yeast PPI (hpp:// Connec-vity/degree = number of interac-on partners Hubs = highly connected proteins Scale- free topology most genes have low connec-vity, few have high. Mainly yeast2hybrid and tandem affinity purifica-ons
31 Protein networks Protein protein interac-ons (PPI) IntAct DIP - dip.doe- mbi.ucla.edu/ Pathways KEGG - Biocarta - Reactome - Regulatory networks
32 Predic-ng the func-on of a gene Expression papern From RNAseq or Microarrays Same expression papern - > involved in the same pathway or has similar func-on Homology interac-ons are o_en conserved between species
33 Predic-ng the func-on of a gene Phylogene-c profiles Same conserva-on papern - > involved in same pathways
34 Predic-ng the func-on of a gene Gene fusions (Rosepa stone theory) Fusion of two proteins that interact can be convenient since their expression can be co- regulated.
35 Predic-ng the func-on of a gene Genomic context Adjacent genes may be regulated together (operons in bacteria)
36 Predic-ng the func-on of a gene Automated liperature mining Genes that o_en are found in the same abstracts are more likely to interact or have related func-ons Gene-c interac-on Genes with similar knock- down phenotypes or rescuing phenotypes are likely to have similar func-ons
37 STRING hpp://string.embl.de A database that combines different predic-ons of func-onal links Includes experimental databases such as DIP, BIND, KEGG, Biocharta etc. Bayesian sta-s-cs with weigh-ng of the different data sources and valida-on against known interac-ons.
38 STRING hpp://string.embl.de
39 Gene ontology (GO) Func-onal classifica-on of genes/proteins All different databases and annotators use different defini-ons of the same func-on => creates a problem in bioinforma-cs. The GO Consor-um gives standardized annota-ons to genes and proteins with rela-onships between terms.
40 Gene ontology (GO) Divided into three categories: (for cytochrome C) Molecular func-on (electron transporter ac-vity) Cellular component (mitochondrial matrix) Biological process (oxida-ve phosphoryla-on) Uses Directed Acyclic Graphs (DAGs) Evidence codes, ex. TAS (Traceable author statement) or IEP (Inferred from expression papern)
41 Never trust a server blindly! Always do control experiments: PosiCve controls: submit sequences for which you know the right answer. NegaCve controls: random or shuffled sequences. Try several different methods and use the consensus
Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.
Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein
More informationGenome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting.
Genome Annotation Bioinformatics and Computational Biology Genome Annotation Frank Oliver Glöckner 1 Genome Analysis Roadmap Genome sequencing Assembly Gene prediction Protein targeting trna prediction
More informationFunctional Annotation
Functional Annotation Outline Introduction Strategy Pipeline Databases Now, what s next? Functional Annotation Adding the layers of analysis and interpretation necessary to extract its biological significance
More informationEBI web resources II: Ensembl and InterPro. Yanbin Yin Spring 2013
EBI web resources II: Ensembl and InterPro Yanbin Yin Spring 2013 1 Outline Intro to genome annotation Protein family/domain databases InterPro, Pfam, Superfamily etc. Genome browser Ensembl Hands on Practice
More informationMotifs, Profiles and Domains. Michael Tress Protein Design Group Centro Nacional de Biotecnología, CSIC
Motifs, Profiles and Domains Michael Tress Protein Design Group Centro Nacional de Biotecnología, CSIC Comparing Two Proteins Sequence Alignment Determining the pattern of evolution and identifying conserved
More informationWeek 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
More information-max_target_seqs: maximum number of targets to report
Review of exercise 1 tblastn -num_threads 2 -db contig -query DH10B.fasta -out blastout.xls -evalue 1e-10 -outfmt "6 qseqid sseqid qstart qend sstart send length nident pident evalue" Other options: -max_target_seqs:
More informationCS612 - Algorithms in Bioinformatics
Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available
More informationEBI web resources II: Ensembl and InterPro
EBI web resources II: Ensembl and InterPro Yanbin Yin http://www.ebi.ac.uk/training/online/course/ 1 Homework 3 Go to http://www.ebi.ac.uk/interpro/training.htmland finish the second online training course
More informationWe have: We will: Assembled six genomes Made predictions of most likely gene locations. Add a layers of biological meaning to the sequences
Recap We have: Assembled six genomes Made predictions of most likely gene locations We will: Add a layers of biological meaning to the sequences Start with Biology This will motivate the choices we make
More informationHomology. and. Information Gathering and Domain Annotation for Proteins
Homology and Information Gathering and Domain Annotation for Proteins Outline WHAT IS HOMOLOGY? HOW TO GATHER KNOWN PROTEIN INFORMATION? HOW TO ANNOTATE PROTEIN DOMAINS? EXAMPLES AND EXERCISES Homology
More informationHMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder
HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding
More information1. Protein Data Bank (PDB) 1. Protein Data Bank (PDB)
Protein structure databases; visualization; and classifications 1. Introduction to Protein Data Bank (PDB) 2. Free graphic software for 3D structure visualization 3. Hierarchical classification of protein
More informationAmino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1
Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings
More informationBioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing
Bioinformatics Proteins II. - Pattern, Profile, & Structure Database Searching Robert Latek, Ph.D. Bioinformatics, Biocomputing WIBR Bioinformatics Course, Whitehead Institute, 2002 1 Proteins I.-III.
More informationCSCE555 Bioinformatics. Protein Function Annotation
CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The
More informationProtein structure alignments
Protein structure alignments Proteins that fold in the same way, i.e. have the same fold are often homologs. Structure evolves slower than sequence Sequence is less conserved than structure If BLAST gives
More informationSCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like
SCOP all-β class 4-helical cytokines T4 endonuclease V all-α class, 3 different folds Globin-like TIM-barrel fold α/β class Profilin-like fold α+β class http://scop.mrc-lmb.cam.ac.uk/scop CATH Class, Architecture,
More informationChapter 5. Proteomics and the analysis of protein sequence Ⅱ
Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and
More informationMultiple sequence alignment
Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple
More informationLarge-Scale Genomic Surveys
Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction
More informationBioinformatics. Dept. of Computational Biology & Bioinformatics
Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS
More informationSyllabus of BIOINF 528 (2017 Fall, Bioinformatics Program)
Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program) Course Name: Structural Bioinformatics Course Description: Instructor: This course introduces fundamental concepts and methods for structural
More informationProtein Structure: Data Bases and Classification Ingo Ruczinski
Protein Structure: Data Bases and Classification Ingo Ruczinski Department of Biostatistics, Johns Hopkins University Reference Bourne and Weissig Structural Bioinformatics Wiley, 2003 More References
More informationBMD645. Integration of Omics
BMD645 Integration of Omics Shu-Jen Chen, Chang Gung University Dec. 11, 2009 1 Traditional Biology vs. Systems Biology Traditional biology : Single genes or proteins Systems biology: Simultaneously study
More informationA Protein Ontology from Large-scale Textmining?
A Protein Ontology from Large-scale Textmining? Protege-Workshop Manchester, 07-07-2003 Kai Kumpf, Juliane Fluck and Martin Hofmann Instructive mistakes: a narrative Aim: Protein ontology that supports
More informationHidden Markov Models (HMMs) and Profiles
Hidden Markov Models (HMMs) and Profiles Swiss Institute of Bioinformatics (SIB) 26-30 November 2001 Markov Chain Models A Markov Chain Model is a succession of states S i (i = 0, 1,...) connected by transitions.
More informationHomology and Information Gathering and Domain Annotation for Proteins
Homology and Information Gathering and Domain Annotation for Proteins Outline Homology Information Gathering for Proteins Domain Annotation for Proteins Examples and exercises The concept of homology The
More informationStructure to Function. Molecular Bioinformatics, X3, 2006
Structure to Function Molecular Bioinformatics, X3, 2006 Structural GeNOMICS Structural Genomics project aims at determination of 3D structures of all proteins: - organize known proteins into families
More informationChristian Sigrist. November 14 Protein Bioinformatics: Sequence-Structure-Function 2018 Basel
Christian Sigrist General Definition on Conserved Regions Conserved regions in proteins can be classified into 5 different groups: Domains: specific combination of secondary structures organized into a
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison
CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein
More informationPrediction of protein function from sequence analysis
Prediction of protein function from sequence analysis Rita Casadio BIOCOMPUTING GROUP University of Bologna, Italy The omic era Genome Sequencing Projects: Archaea: 74 species In Progress:52 Bacteria:
More informationSequence and Structure Alignment Z. Luthey-Schulten, UIUC Pittsburgh, 2006 VMD 1.8.5
Sequence and Structure Alignment Z. Luthey-Schulten, UIUC Pittsburgh, 2006 VMD 1.8.5 Why Look at More Than One Sequence? 1. Multiple Sequence Alignment shows patterns of conservation 2. What and how many
More informationProcheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics.
Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics Iosif Vaisman Email: ivaisman@gmu.edu ----------------------------------------------------------------- Bond
More information2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity.
Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. A global picture of the protein universe will help us to understand
More informationSome Problems from Enzyme Families
Some Problems from Enzyme Families Greg Butler Department of Computer Science Concordia University, Montreal www.cs.concordia.ca/~faculty/gregb gregb@cs.concordia.ca Abstract I will discuss some problems
More informationAnnotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010
Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010 1 New genomes (and metagenomes) sequenced every day... 2 3 3 3 3 3 3 3 3 3 Computational
More informationStatistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic
More informationGene function annotation
Gene function annotation Paul D. Thomas, Ph.D. University of Southern California What is function annotation? The formal answer to the question: what does this gene do? The association between: a description
More informationALL LECTURES IN SB Introduction
1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationCOMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University
COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018
More informationProtein function prediction based on sequence analysis
Performing sequence searches Post-Blast analysis, Using profiles and pattern-matching Protein function prediction based on sequence analysis Slides from a lecture on MOL204 - Applied Bioinformatics 18-Oct-2005
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationAmino Acid Structures from Klug & Cummings. Bioinformatics (Lec 12)
Amino Acid Structures from Klug & Cummings 2/17/05 1 Amino Acid Structures from Klug & Cummings 2/17/05 2 Amino Acid Structures from Klug & Cummings 2/17/05 3 Amino Acid Structures from Klug & Cummings
More informationProtein Structure and Function Prediction using Kernel Methods.
Protein Structure and Function Prediction using Kernel Methods. A THESIS SUBMITTED TO THE FACULTY OF THE GRADUATE SCHOOL OF THE UNIVERSITY OF MINNESOTA BY Huzefa Rangwala IN PARTIAL FULFILLMENT OF THE
More informationIntroduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple
More informationGenome Annotation Project Presentation
Halogeometricum borinquense Genome Annotation Project Presentation Loci Hbor_05620 & Hbor_05470 Presented by: Mohammad Reza Najaf Tomaraei Hbor_05620 Basic Information DNA Coordinates: 527,512 528,261
More informationStatistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department
More informationProtein Structure Prediction and Display
Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each
More informationComputational methods for predicting protein-protein interactions
Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational
More informationGene Ontology and overrepresentation analysis
Gene Ontology and overrepresentation analysis Kjell Petersen J Express Microarray analysis course Oslo December 2009 Presentation adapted from Endre Anderssen and Vidar Beisvåg NMC Trondheim Overview How
More informationGetting To Know Your Protein
Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research
More informationPROTEIN CLUSTERING AND CLASSIFICATION
PROTEIN CLUSTERING AND CLASSIFICATION ori Sasson 1 and Michal Linial 2 1The School of Computer Science and Engeeniring and 2 The Life Science Institute, The Hebrew University of Jerusalem, Israel 1. Introduction
More information08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega
BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments
More informationIntroductory course on Multiple Sequence Alignment Part I: Theoretical foundations
Sequence Analysis and Structure Prediction Service Centro Nacional de Biotecnología CSIC 8-10 May, 2013 Introductory course on Multiple Sequence Alignment Part I: Theoretical foundations Course Notes Instructor:
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 07: profile Hidden Markov Model http://bibiserv.techfak.uni-bielefeld.de/sadr2/databasesearch/hmmer/profilehmm.gif Slides adapted from Dr. Shaojie Zhang
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More informationLarge-Scale Genomic Surveys
Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Structural Informatics Homology Modeling Sequence Alignment Structure Classification Gene
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2014 1 HMM Lecture Notes Dannie Durand and Rose Hoberman November 6th Introduction In the last few lectures, we have focused on three problems related
More informationLecture 2. The Blast2GO annotation framework
Lecture 2 The Blast2GO annotation framework Annotation steps Modulation of annotation intensity Export/Import Functions Sequence Selection Additional Tools Functional assignment Annotation Transference
More informationEBI web resources II: Ensembl and InterPro
EBI web resources II: Ensembl and InterPro Yanbin Yin Fall 2015 h.p://www.ebi.ac.uk/training/online/course/ 1 Homework 3 Go to h.p://www.ebi.ac.uk/interpro/training.html and finish the second online training
More informationSequences, Structures, and Gene Regulatory Networks
Sequences, Structures, and Gene Regulatory Networks Learning Outcomes After this class, you will Understand gene expression and protein structure in more detail Appreciate why biologists like to align
More informationBCB 444/544 Fall 07 Dobbs 1
BCB 444/544 Lecture 21 Protein Structure Visualization, Classification & Comparison Secondary Structure #21_Oct10 Required Reading (before lecture) Mon Oct 8 - Lecture 20 Protein Secondary Structure Chp
More informationHands-On Nine The PAX6 Gene and Protein
Hands-On Nine The PAX6 Gene and Protein Main Purpose of Hands-On Activity: Using bioinformatics tools to examine the sequences, homology, and disease relevance of the Pax6: a master gene of eye formation.
More informationIn-Silico Approach for Hypothetical Protein Function Prediction
In-Silico Approach for Hypothetical Protein Function Prediction Shabanam Khatoon Department of Computer Science, Faculty of Natural Sciences Jamia Millia Islamia, New Delhi Suraiya Jabin Department of
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationMultiple Choice Review- Eukaryotic Gene Expression
Multiple Choice Review- Eukaryotic Gene Expression 1. Which of the following is the Central Dogma of cell biology? a. DNA Nucleic Acid Protein Amino Acid b. Prokaryote Bacteria - Eukaryote c. Atom Molecule
More informationPatterns and profiles applications of multiple alignments. Tore Samuelsson March 2013
Patterns and profiles applications of multiple alignments Tore Samuelsson March 3 Protein patterns and the PROSITE database Proteins that bind the nucleotides ATP or GTP share a short sequence motif Entry
More informationComputational Molecular Biology (
Computational Molecular Biology (http://cmgm cmgm.stanford.edu/biochem218/) Biochemistry 218/Medical Information Sciences 231 Douglas L. Brutlag, Lee Kozar Jimmy Huang, Josh Silverman Lecture Syllabus
More informationExamples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE
Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To
More informationComprehensive genome analysis of 203 genomes provides structural genomics with new insights into protein family space
Published online February 15, 26 166 18 Nucleic Acids Research, 26, Vol. 34, No. 3 doi:1.193/nar/gkj494 Comprehensive genome analysis of 23 genomes provides structural genomics with new insights into protein
More information1-D Predictions. Prediction of local features: Secondary structure & surface exposure
1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local
More informationToday s Lecture: HMMs
Today s Lecture: HMMs Definitions Examples Probability calculations WDAG Dynamic programming algorithms: Forward Viterbi Parameter estimation Viterbi training 1 Hidden Markov Models Probability models
More informationHMMs and biological sequence analysis
HMMs and biological sequence analysis Hidden Markov Model A Markov chain is a sequence of random variables X 1, X 2, X 3,... That has the property that the value of the current state depends only on the
More informationGenomics and bioinformatics summary. Finding genes -- computer searches
Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence
More informationComputational Molecular Modeling
Computational Molecular Modeling Lecture 1: Structure Models, Properties Chandrajit Bajaj Today s Outline Intro to atoms, bonds, structure, biomolecules, Geometry of Proteins, Nucleic Acids, Ribosomes,
More informationMeiothermus ruber Genome Analysis Project
Augustana College Augustana Digital Commons Meiothermus ruber Genome Analysis Project Biology 2018 Predicted ortholog pairs between E. coli and M. ruber are b3456 and mrub_2379, b3457 and mrub_2378, b3456
More informationSTRUCTURAL BIOINFORMATICS II. Spring 2018
STRUCTURAL BIOINFORMATICS II Spring 2018 Syllabus Course Number - Classification: Chemistry 5412 Class Schedule: Monday 5:30-7:50 PM, SERC Room 456 (4 th floor) Instructors: Ronald Levy, SERC 718 (ronlevy@temple.edu)
More informationComputational Biology: Basics & Interesting Problems
Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information
More informationUpdate on human genome completion and annotations: Protein information resource
UPDATE ON GENOME COMPLETION AND ANNOTATIONS Update on human genome completion and annotations: Protein information resource Cathy Wu 1 and Daniel W. Nebert 2 * 1 Director of PIR, Department of Biochemistry
More informationHomology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB
Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationUpdate on genome completion and annotations: Protein Information Resource
UPDATE ON GENOME COMPLETION AND ANNOTATIONS Update on genome completion and annotations: Protein Information Resource Cathy Wu 1 and Daniel W. Nebert 2 * 1 Director of PIR, Department of Biochemistry and
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationNetworks & pathways. Hedi Peterson MTAT Bioinformatics
Networks & pathways Hedi Peterson (peterson@quretec.com) MTAT.03.239 Bioinformatics 03.11.2010 Networks are graphs Nodes Edges Edges Directed, undirected, weighted Nodes Genes Proteins Metabolites Enzymes
More informationSoftware and Databases for Protein Structure Classification. Some slides are modified from Kun Huang (OSU) and Doug Brutlag (Stanford)
Software and Databases for Protein Structure Classification Some slides are modified from Kun Huang (OSU) and Doug Brutlag (Stanford) Proteins If there is a job to be done in the molecular world of our
More informationBioinformatics methods COMPUTATIONAL WORKFLOW
Bioinformatics methods COMPUTATIONAL WORKFLOW RAW READ PROCESSING: 1. FastQC on raw reads 2. Kraken on raw reads to ID and remove contaminants 3. SortmeRNA to filter out rrna 4. Trimmomatic to filter by
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs15.html Describing & Modeling Patterns
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure
More informationOrganization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p
Organization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p.110-114 Arrangement of information in DNA----- requirements for RNA Common arrangement of protein-coding genes in prokaryotes=
More informationChemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller
Chemogenomic: Approaches to Rational Drug Design Jonas Skjødt Møller Chemogenomic Chemistry Biology Chemical biology Medical chemistry Chemical genetics Chemoinformatics Bioinformatics Chemoproteomics
More informationComparative Features of Multicellular Eukaryotic Genomes
Comparative Features of Multicellular Eukaryotic Genomes C elegans A thaliana O. Sativa D. melanogaster M. musculus H. sapiens Size (Mb) 97 115 389 120 2500 2900 # Genes 18,425 25,498 37,544 13,601 30,000
More informationPROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES
PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES Eser Aygün 1, Caner Kömürlü 2, Zafer Aydin 3 and Zehra Çataltepe 1 1 Computer Engineering Department and 2
More informationVisualization of Macromolecular Structures
Visualization of Macromolecular Structures Present by: Qihang Li orig. author: O Donoghue, et al. Structural biology is rapidly accumulating a wealth of detailed information. Over 60,000 high-resolution
More informationNewly made RNA is called primary transcript and is modified in three ways before leaving the nucleus:
m Eukaryotic mrna processing Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: Cap structure a modified guanine base is added to the 5 end. Poly-A tail
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationDATA ACQUISITION FROM BIO-DATABASES AND BLAST. Natapol Pornputtapong 18 January 2018
DATA ACQUISITION FROM BIO-DATABASES AND BLAST Natapol Pornputtapong 18 January 2018 DATABASE Collections of data To share multi-user interface To prevent data loss To make sure to get the right things
More information