Protein bioinforma-cs. Åsa Björklund CMB/LICR

Size: px
Start display at page:

Download "Protein bioinforma-cs. Åsa Björklund CMB/LICR"

Transcription

1 Protein bioinforma-cs Åsa Björklund CMB/LICR

2 In this lecture Protein structures and 3D structure predic-on Protein domains HMMs Protein networks Protein func-on annota-on / predic-on

3 PTM Localiza-on Degrada-on Muta-ons Selec-on Gene mrna Polypep-de Folding 3D protein Protein complex ATGATCATGGTTACAGGT AUGAUCAUGGUUACAGGU MAHRKYLI Structure is more conserved than sequence!

4 This lecture Protein structures and structure predic-on Protein domains Mo-fs, Profiles and HMMs Some servers Protein networks Func-on predic-on

5 Protein sequence databases UniProtKB Swiss- Prot Quality PIR- PSD TrEMBL Quan-ty UniMES (metagenomics samples) Entrez Protein (NCBI) Coding regions from GenBank and Swissprot, PIR, PDB, etc. RefSeq Non redundant databases Uniref100, Uniref90 etc. NCBI nr

6 Protein structure databases (Gutmanas et al. 2013) 1. So_ X- ray tomogram of a fission yeast cell 2. Electron tomogram of ribosomes in the cytosol 3. Cryo- EM reconstruc-on of the 80S ribosome from yeast 4. Crystal structure of the 50S ribosomal subunit (PDB entry 3uzk) 5. Crystal structure revealing how tmrna and the small protein SmpB enable the kirromycin- stalled 70S ribosome to proceed with transla-on (PDB entries 4abr and 4abs)

7 PDB Protein Data Bank Main database of three-dimensional protein structures Also contains structures of other macromolecules (DNA, RNA, carbohydrates) PDB entry format resembles EMBL Currently (May 2013) 90,424 entries

8 Viewing protein structures Pymol Jmol Rasmol Download PDB file Open in viewer Select, color, rotate

9 Structure predic-on De novo folding Molecular Dynamics Based on energy minimiza-on, depends on star-ng structure Works well for small pepe-des, not feasible for very large proteins Homology modelling Template from homologous structure(s) Refinement based on energy minimiza-on Swiss- modeller, 3D- Jigsaw Consensus methods Combines predic-ons from several servers Pcons.net

10 Docking Predict interac-ons between proteins or protein and ligand Most proteins change conforma-on upon binding Ligand docking commonly used in drug design HADDOCK, PatchDock, ClusPro

11 Protein domains

12 Protein domains Defined as independent folding unit or independent evolving unit Each domain has a characteris-c structure and/or func-on conserved in evolu-on Domains are o_en combined to create mul-- domain proteins O_en grouped into families and superfamilies Known domains in ~80% of all proteins, covering ~58% of the residues

13 Protein domains

14 Protein Structure Classifica-on Databases QUALITY SCOP : All manual CATH : Semi-automatic FSSP : All automatic ENTREZ: All automatic QUANTITY

15 Structural Classifica-on Of Proteins (SCOP) Attempt to classify all proteins in PDB according to structural and evolutionary relationships Hierarchical classification system Classification based on human expertise Superfamily contains HMMs for all SCOP families (

16 SCOP Main secondary structure elements Class " Fold Superfamily Family All- alpha All- beta Alpha/beta

17 SCOP Arrangements of secondary structure elements Class " Fold Superfamily Family Globin- like Prion- like Alpha- beta knot

18 SCOP Low sequence similarity but conserved structure and/ or func-on Class " Fold Superfamily Family

19 SCOP Significant sequence similarity and similar structure and func-on Class " Fold Superfamily Family

20 Domains based on sequence conserva-on Pfam - pfam.sanger.ac.uk PfamA manually curated PfamB autmated clustering PfamClans groups families into superfamilies Smart - smart.embl- heidelberg.de Manually curated, specializes in signalling, extracellular and chroma-n- associated proteins. ProDom - prodom.prabi.fr Automated clustering

21 Other mo-fs DNA/RNA/Protein binding mo-fs Transmembrane helices (TMH) Signal pep-des Pospransla-onal modifica-on (PTM) signals Secondary structure Disordered regions

22 Hidden Markov Models (HMMs) Different states, with different probabili-es of each symbol (aa or nt) at each state Transi-on probabili-es between states Insert states Silent states

23 HMM models: key concepts - No magic involved: just an extension of the profile - Enables modelling of deletions and insertions - Very useful for protein domains, HMMs for many different domain databases such as SCOP, Pfam etc. are available for download or web-based searches - Common programs to build HMMs from MSAs and scan sequence databases for matches are HMMER and SAM.

24 HMMER Program package by Sean Eddy (hmmer.janelia.org) Create HMMs from Mul-ple Sequence Alignment (MSA) Run searches with HMMs, ex. Pfam Requires a few unix commands Has webserver for homology searches

25 Membrane protein topology predic-on Predict transmembrane helices (TMH) based on hydrophobicity profile A TMH is normally about 20aa Reentrant regions can create mispredic-ons Posi-ve inside rule guides the direc-on O_en includes homology informa-on Most methods use HMMs for predic-on

26 Membrane protein topology predic-on hpp://topcons.cbr.su.se/

27 Predic-on of signal pep-des A signal pep-de is a short (3-60 amino acids long) pep-de chain that directs the post- transla-onal transport of a protein. Signal pep-des may also be called targe-ng signals, signal sequences, transit pep-des, or localiza-on signals.

28 Predic-on of cleavage site and localiza-on SignalP - predicts the presence and loca-on of signal pep-de cleavage sites in amino acid sequences from different organisms: Gram- posi-ve prokaryotes Gram- nega-ve prokaryotes Eukaryotes TargetP - predicts the subcellular loca-on of eukaryo-c proteins. The loca-on assignment is based on the predicted presence of any of the N- terminal presequences: chloroplast transit pep-de (ctp), mitochondrial targe-ng pep-de (mtp) or secretory pathway signal pep-de (SP). The methods combines predic-on from several ar-ficial neural networks and HMMs.

29 InterPro Integrates domain/mo-f predic-ons from several databases ProDom: sequence- clusters built from UniProtKB using PSI- BLAST. PROSITE paperns: simple regular expressions. PROSITE and HAMAP profiles: sequence matrices. PRINTS fingerprints, un- weighted Posi-on Specific Sequence Matrices (PSSMs). PANTHER, PIRSF, Pfam, SMART, TIGRFAMs, Gene3D and SUPERFAMILY: hidden Markov models (HMMs). TMHMM, SignalP

30 Protein interac-on networks Yeast PPI (hpp:// Connec-vity/degree = number of interac-on partners Hubs = highly connected proteins Scale- free topology most genes have low connec-vity, few have high. Mainly yeast2hybrid and tandem affinity purifica-ons

31 Protein networks Protein protein interac-ons (PPI) IntAct DIP - dip.doe- mbi.ucla.edu/ Pathways KEGG - Biocarta - Reactome - Regulatory networks

32 Predic-ng the func-on of a gene Expression papern From RNAseq or Microarrays Same expression papern - > involved in the same pathway or has similar func-on Homology interac-ons are o_en conserved between species

33 Predic-ng the func-on of a gene Phylogene-c profiles Same conserva-on papern - > involved in same pathways

34 Predic-ng the func-on of a gene Gene fusions (Rosepa stone theory) Fusion of two proteins that interact can be convenient since their expression can be co- regulated.

35 Predic-ng the func-on of a gene Genomic context Adjacent genes may be regulated together (operons in bacteria)

36 Predic-ng the func-on of a gene Automated liperature mining Genes that o_en are found in the same abstracts are more likely to interact or have related func-ons Gene-c interac-on Genes with similar knock- down phenotypes or rescuing phenotypes are likely to have similar func-ons

37 STRING hpp://string.embl.de A database that combines different predic-ons of func-onal links Includes experimental databases such as DIP, BIND, KEGG, Biocharta etc. Bayesian sta-s-cs with weigh-ng of the different data sources and valida-on against known interac-ons.

38 STRING hpp://string.embl.de

39 Gene ontology (GO) Func-onal classifica-on of genes/proteins All different databases and annotators use different defini-ons of the same func-on => creates a problem in bioinforma-cs. The GO Consor-um gives standardized annota-ons to genes and proteins with rela-onships between terms.

40 Gene ontology (GO) Divided into three categories: (for cytochrome C) Molecular func-on (electron transporter ac-vity) Cellular component (mitochondrial matrix) Biological process (oxida-ve phosphoryla-on) Uses Directed Acyclic Graphs (DAGs) Evidence codes, ex. TAS (Traceable author statement) or IEP (Inferred from expression papern)

41 Never trust a server blindly! Always do control experiments: PosiCve controls: submit sequences for which you know the right answer. NegaCve controls: random or shuffled sequences. Try several different methods and use the consensus

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki. Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein

More information

Genome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting.

Genome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting. Genome Annotation Bioinformatics and Computational Biology Genome Annotation Frank Oliver Glöckner 1 Genome Analysis Roadmap Genome sequencing Assembly Gene prediction Protein targeting trna prediction

More information

Functional Annotation

Functional Annotation Functional Annotation Outline Introduction Strategy Pipeline Databases Now, what s next? Functional Annotation Adding the layers of analysis and interpretation necessary to extract its biological significance

More information

EBI web resources II: Ensembl and InterPro. Yanbin Yin Spring 2013

EBI web resources II: Ensembl and InterPro. Yanbin Yin Spring 2013 EBI web resources II: Ensembl and InterPro Yanbin Yin Spring 2013 1 Outline Intro to genome annotation Protein family/domain databases InterPro, Pfam, Superfamily etc. Genome browser Ensembl Hands on Practice

More information

Motifs, Profiles and Domains. Michael Tress Protein Design Group Centro Nacional de Biotecnología, CSIC

Motifs, Profiles and Domains. Michael Tress Protein Design Group Centro Nacional de Biotecnología, CSIC Motifs, Profiles and Domains Michael Tress Protein Design Group Centro Nacional de Biotecnología, CSIC Comparing Two Proteins Sequence Alignment Determining the pattern of evolution and identifying conserved

More information

Week 10: Homology Modelling (II) - HHpred

Week 10: Homology Modelling (II) - HHpred Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative

More information

-max_target_seqs: maximum number of targets to report

-max_target_seqs: maximum number of targets to report Review of exercise 1 tblastn -num_threads 2 -db contig -query DH10B.fasta -out blastout.xls -evalue 1e-10 -outfmt "6 qseqid sseqid qstart qend sstart send length nident pident evalue" Other options: -max_target_seqs:

More information

CS612 - Algorithms in Bioinformatics

CS612 - Algorithms in Bioinformatics Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available

More information

EBI web resources II: Ensembl and InterPro

EBI web resources II: Ensembl and InterPro EBI web resources II: Ensembl and InterPro Yanbin Yin http://www.ebi.ac.uk/training/online/course/ 1 Homework 3 Go to http://www.ebi.ac.uk/interpro/training.htmland finish the second online training course

More information

We have: We will: Assembled six genomes Made predictions of most likely gene locations. Add a layers of biological meaning to the sequences

We have: We will: Assembled six genomes Made predictions of most likely gene locations. Add a layers of biological meaning to the sequences Recap We have: Assembled six genomes Made predictions of most likely gene locations We will: Add a layers of biological meaning to the sequences Start with Biology This will motivate the choices we make

More information

Homology. and. Information Gathering and Domain Annotation for Proteins

Homology. and. Information Gathering and Domain Annotation for Proteins Homology and Information Gathering and Domain Annotation for Proteins Outline WHAT IS HOMOLOGY? HOW TO GATHER KNOWN PROTEIN INFORMATION? HOW TO ANNOTATE PROTEIN DOMAINS? EXAMPLES AND EXERCISES Homology

More information

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding

More information

1. Protein Data Bank (PDB) 1. Protein Data Bank (PDB)

1. Protein Data Bank (PDB) 1. Protein Data Bank (PDB) Protein structure databases; visualization; and classifications 1. Introduction to Protein Data Bank (PDB) 2. Free graphic software for 3D structure visualization 3. Hierarchical classification of protein

More information

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings

More information

Bioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing

Bioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing Bioinformatics Proteins II. - Pattern, Profile, & Structure Database Searching Robert Latek, Ph.D. Bioinformatics, Biocomputing WIBR Bioinformatics Course, Whitehead Institute, 2002 1 Proteins I.-III.

More information

CSCE555 Bioinformatics. Protein Function Annotation

CSCE555 Bioinformatics. Protein Function Annotation CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The

More information

Protein structure alignments

Protein structure alignments Protein structure alignments Proteins that fold in the same way, i.e. have the same fold are often homologs. Structure evolves slower than sequence Sequence is less conserved than structure If BLAST gives

More information

SCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like

SCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like SCOP all-β class 4-helical cytokines T4 endonuclease V all-α class, 3 different folds Globin-like TIM-barrel fold α/β class Profilin-like fold α+β class http://scop.mrc-lmb.cam.ac.uk/scop CATH Class, Architecture,

More information

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and

More information

Multiple sequence alignment

Multiple sequence alignment Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple

More information

Large-Scale Genomic Surveys

Large-Scale Genomic Surveys Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction

More information

Bioinformatics. Dept. of Computational Biology & Bioinformatics

Bioinformatics. Dept. of Computational Biology & Bioinformatics Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS

More information

Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program)

Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program) Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program) Course Name: Structural Bioinformatics Course Description: Instructor: This course introduces fundamental concepts and methods for structural

More information

Protein Structure: Data Bases and Classification Ingo Ruczinski

Protein Structure: Data Bases and Classification Ingo Ruczinski Protein Structure: Data Bases and Classification Ingo Ruczinski Department of Biostatistics, Johns Hopkins University Reference Bourne and Weissig Structural Bioinformatics Wiley, 2003 More References

More information

BMD645. Integration of Omics

BMD645. Integration of Omics BMD645 Integration of Omics Shu-Jen Chen, Chang Gung University Dec. 11, 2009 1 Traditional Biology vs. Systems Biology Traditional biology : Single genes or proteins Systems biology: Simultaneously study

More information

A Protein Ontology from Large-scale Textmining?

A Protein Ontology from Large-scale Textmining? A Protein Ontology from Large-scale Textmining? Protege-Workshop Manchester, 07-07-2003 Kai Kumpf, Juliane Fluck and Martin Hofmann Instructive mistakes: a narrative Aim: Protein ontology that supports

More information

Hidden Markov Models (HMMs) and Profiles

Hidden Markov Models (HMMs) and Profiles Hidden Markov Models (HMMs) and Profiles Swiss Institute of Bioinformatics (SIB) 26-30 November 2001 Markov Chain Models A Markov Chain Model is a succession of states S i (i = 0, 1,...) connected by transitions.

More information

Homology and Information Gathering and Domain Annotation for Proteins

Homology and Information Gathering and Domain Annotation for Proteins Homology and Information Gathering and Domain Annotation for Proteins Outline Homology Information Gathering for Proteins Domain Annotation for Proteins Examples and exercises The concept of homology The

More information

Structure to Function. Molecular Bioinformatics, X3, 2006

Structure to Function. Molecular Bioinformatics, X3, 2006 Structure to Function Molecular Bioinformatics, X3, 2006 Structural GeNOMICS Structural Genomics project aims at determination of 3D structures of all proteins: - organize known proteins into families

More information

Christian Sigrist. November 14 Protein Bioinformatics: Sequence-Structure-Function 2018 Basel

Christian Sigrist. November 14 Protein Bioinformatics: Sequence-Structure-Function 2018 Basel Christian Sigrist General Definition on Conserved Regions Conserved regions in proteins can be classified into 5 different groups: Domains: specific combination of secondary structures organized into a

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture

More information

CISC 636 Computational Biology & Bioinformatics (Fall 2016)

CISC 636 Computational Biology & Bioinformatics (Fall 2016) CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein

More information

Prediction of protein function from sequence analysis

Prediction of protein function from sequence analysis Prediction of protein function from sequence analysis Rita Casadio BIOCOMPUTING GROUP University of Bologna, Italy The omic era Genome Sequencing Projects: Archaea: 74 species In Progress:52 Bacteria:

More information

Sequence and Structure Alignment Z. Luthey-Schulten, UIUC Pittsburgh, 2006 VMD 1.8.5

Sequence and Structure Alignment Z. Luthey-Schulten, UIUC Pittsburgh, 2006 VMD 1.8.5 Sequence and Structure Alignment Z. Luthey-Schulten, UIUC Pittsburgh, 2006 VMD 1.8.5 Why Look at More Than One Sequence? 1. Multiple Sequence Alignment shows patterns of conservation 2. What and how many

More information

Procheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics.

Procheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics. Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics Iosif Vaisman Email: ivaisman@gmu.edu ----------------------------------------------------------------- Bond

More information

2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity.

2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. A global picture of the protein universe will help us to understand

More information

Some Problems from Enzyme Families

Some Problems from Enzyme Families Some Problems from Enzyme Families Greg Butler Department of Computer Science Concordia University, Montreal www.cs.concordia.ca/~faculty/gregb gregb@cs.concordia.ca Abstract I will discuss some problems

More information

Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010

Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010 Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010 1 New genomes (and metagenomes) sequenced every day... 2 3 3 3 3 3 3 3 3 3 Computational

More information

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic

More information

Gene function annotation

Gene function annotation Gene function annotation Paul D. Thomas, Ph.D. University of Southern California What is function annotation? The formal answer to the question: what does this gene do? The association between: a description

More information

ALL LECTURES IN SB Introduction

ALL LECTURES IN SB Introduction 1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL

More information

CAP 5510 Lecture 3 Protein Structures

CAP 5510 Lecture 3 Protein Structures CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity

More information

COMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University

COMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018

More information

Protein function prediction based on sequence analysis

Protein function prediction based on sequence analysis Performing sequence searches Post-Blast analysis, Using profiles and pattern-matching Protein function prediction based on sequence analysis Slides from a lecture on MOL204 - Applied Bioinformatics 18-Oct-2005

More information

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL

More information

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK

More information

Amino Acid Structures from Klug & Cummings. Bioinformatics (Lec 12)

Amino Acid Structures from Klug & Cummings. Bioinformatics (Lec 12) Amino Acid Structures from Klug & Cummings 2/17/05 1 Amino Acid Structures from Klug & Cummings 2/17/05 2 Amino Acid Structures from Klug & Cummings 2/17/05 3 Amino Acid Structures from Klug & Cummings

More information

Protein Structure and Function Prediction using Kernel Methods.

Protein Structure and Function Prediction using Kernel Methods. Protein Structure and Function Prediction using Kernel Methods. A THESIS SUBMITTED TO THE FACULTY OF THE GRADUATE SCHOOL OF THE UNIVERSITY OF MINNESOTA BY Huzefa Rangwala IN PARTIAL FULFILLMENT OF THE

More information

Introduction to Bioinformatics Online Course: IBT

Introduction to Bioinformatics Online Course: IBT Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple

More information

Genome Annotation Project Presentation

Genome Annotation Project Presentation Halogeometricum borinquense Genome Annotation Project Presentation Loci Hbor_05620 & Hbor_05470 Presented by: Mohammad Reza Najaf Tomaraei Hbor_05620 Basic Information DNA Coordinates: 527,512 528,261

More information

Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department

More information

Protein Structure Prediction and Display

Protein Structure Prediction and Display Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each

More information

Computational methods for predicting protein-protein interactions

Computational methods for predicting protein-protein interactions Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational

More information

Gene Ontology and overrepresentation analysis

Gene Ontology and overrepresentation analysis Gene Ontology and overrepresentation analysis Kjell Petersen J Express Microarray analysis course Oslo December 2009 Presentation adapted from Endre Anderssen and Vidar Beisvåg NMC Trondheim Overview How

More information

Getting To Know Your Protein

Getting To Know Your Protein Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research

More information

PROTEIN CLUSTERING AND CLASSIFICATION

PROTEIN CLUSTERING AND CLASSIFICATION PROTEIN CLUSTERING AND CLASSIFICATION ori Sasson 1 and Michal Linial 2 1The School of Computer Science and Engeeniring and 2 The Life Science Institute, The Hebrew University of Jerusalem, Israel 1. Introduction

More information

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments

More information

Introductory course on Multiple Sequence Alignment Part I: Theoretical foundations

Introductory course on Multiple Sequence Alignment Part I: Theoretical foundations Sequence Analysis and Structure Prediction Service Centro Nacional de Biotecnología CSIC 8-10 May, 2013 Introductory course on Multiple Sequence Alignment Part I: Theoretical foundations Course Notes Instructor:

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 07: profile Hidden Markov Model http://bibiserv.techfak.uni-bielefeld.de/sadr2/databasesearch/hmmer/profilehmm.gif Slides adapted from Dr. Shaojie Zhang

More information

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748 CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr

More information

Large-Scale Genomic Surveys

Large-Scale Genomic Surveys Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Structural Informatics Homology Modeling Sequence Alignment Structure Classification Gene

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2014 1 HMM Lecture Notes Dannie Durand and Rose Hoberman November 6th Introduction In the last few lectures, we have focused on three problems related

More information

Lecture 2. The Blast2GO annotation framework

Lecture 2. The Blast2GO annotation framework Lecture 2 The Blast2GO annotation framework Annotation steps Modulation of annotation intensity Export/Import Functions Sequence Selection Additional Tools Functional assignment Annotation Transference

More information

EBI web resources II: Ensembl and InterPro

EBI web resources II: Ensembl and InterPro EBI web resources II: Ensembl and InterPro Yanbin Yin Fall 2015 h.p://www.ebi.ac.uk/training/online/course/ 1 Homework 3 Go to h.p://www.ebi.ac.uk/interpro/training.html and finish the second online training

More information

Sequences, Structures, and Gene Regulatory Networks

Sequences, Structures, and Gene Regulatory Networks Sequences, Structures, and Gene Regulatory Networks Learning Outcomes After this class, you will Understand gene expression and protein structure in more detail Appreciate why biologists like to align

More information

BCB 444/544 Fall 07 Dobbs 1

BCB 444/544 Fall 07 Dobbs 1 BCB 444/544 Lecture 21 Protein Structure Visualization, Classification & Comparison Secondary Structure #21_Oct10 Required Reading (before lecture) Mon Oct 8 - Lecture 20 Protein Secondary Structure Chp

More information

Hands-On Nine The PAX6 Gene and Protein

Hands-On Nine The PAX6 Gene and Protein Hands-On Nine The PAX6 Gene and Protein Main Purpose of Hands-On Activity: Using bioinformatics tools to examine the sequences, homology, and disease relevance of the Pax6: a master gene of eye formation.

More information

In-Silico Approach for Hypothetical Protein Function Prediction

In-Silico Approach for Hypothetical Protein Function Prediction In-Silico Approach for Hypothetical Protein Function Prediction Shabanam Khatoon Department of Computer Science, Faculty of Natural Sciences Jamia Millia Islamia, New Delhi Suraiya Jabin Department of

More information

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major

More information

Multiple Choice Review- Eukaryotic Gene Expression

Multiple Choice Review- Eukaryotic Gene Expression Multiple Choice Review- Eukaryotic Gene Expression 1. Which of the following is the Central Dogma of cell biology? a. DNA Nucleic Acid Protein Amino Acid b. Prokaryote Bacteria - Eukaryote c. Atom Molecule

More information

Patterns and profiles applications of multiple alignments. Tore Samuelsson March 2013

Patterns and profiles applications of multiple alignments. Tore Samuelsson March 2013 Patterns and profiles applications of multiple alignments Tore Samuelsson March 3 Protein patterns and the PROSITE database Proteins that bind the nucleotides ATP or GTP share a short sequence motif Entry

More information

Computational Molecular Biology (

Computational Molecular Biology ( Computational Molecular Biology (http://cmgm cmgm.stanford.edu/biochem218/) Biochemistry 218/Medical Information Sciences 231 Douglas L. Brutlag, Lee Kozar Jimmy Huang, Josh Silverman Lecture Syllabus

More information

Examples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE

Examples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To

More information

Comprehensive genome analysis of 203 genomes provides structural genomics with new insights into protein family space

Comprehensive genome analysis of 203 genomes provides structural genomics with new insights into protein family space Published online February 15, 26 166 18 Nucleic Acids Research, 26, Vol. 34, No. 3 doi:1.193/nar/gkj494 Comprehensive genome analysis of 23 genomes provides structural genomics with new insights into protein

More information

1-D Predictions. Prediction of local features: Secondary structure & surface exposure

1-D Predictions. Prediction of local features: Secondary structure & surface exposure 1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local

More information

Today s Lecture: HMMs

Today s Lecture: HMMs Today s Lecture: HMMs Definitions Examples Probability calculations WDAG Dynamic programming algorithms: Forward Viterbi Parameter estimation Viterbi training 1 Hidden Markov Models Probability models

More information

HMMs and biological sequence analysis

HMMs and biological sequence analysis HMMs and biological sequence analysis Hidden Markov Model A Markov chain is a sequence of random variables X 1, X 2, X 3,... That has the property that the value of the current state depends only on the

More information

Genomics and bioinformatics summary. Finding genes -- computer searches

Genomics and bioinformatics summary. Finding genes -- computer searches Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence

More information

Computational Molecular Modeling

Computational Molecular Modeling Computational Molecular Modeling Lecture 1: Structure Models, Properties Chandrajit Bajaj Today s Outline Intro to atoms, bonds, structure, biomolecules, Geometry of Proteins, Nucleic Acids, Ribosomes,

More information

Meiothermus ruber Genome Analysis Project

Meiothermus ruber Genome Analysis Project Augustana College Augustana Digital Commons Meiothermus ruber Genome Analysis Project Biology 2018 Predicted ortholog pairs between E. coli and M. ruber are b3456 and mrub_2379, b3457 and mrub_2378, b3456

More information

STRUCTURAL BIOINFORMATICS II. Spring 2018

STRUCTURAL BIOINFORMATICS II. Spring 2018 STRUCTURAL BIOINFORMATICS II Spring 2018 Syllabus Course Number - Classification: Chemistry 5412 Class Schedule: Monday 5:30-7:50 PM, SERC Room 456 (4 th floor) Instructors: Ronald Levy, SERC 718 (ronlevy@temple.edu)

More information

Computational Biology: Basics & Interesting Problems

Computational Biology: Basics & Interesting Problems Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information

More information

Update on human genome completion and annotations: Protein information resource

Update on human genome completion and annotations: Protein information resource UPDATE ON GENOME COMPLETION AND ANNOTATIONS Update on human genome completion and annotations: Protein information resource Cathy Wu 1 and Daniel W. Nebert 2 * 1 Director of PIR, Department of Biochemistry

More information

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded

More information

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its

More information

Update on genome completion and annotations: Protein Information Resource

Update on genome completion and annotations: Protein Information Resource UPDATE ON GENOME COMPLETION AND ANNOTATIONS Update on genome completion and annotations: Protein Information Resource Cathy Wu 1 and Daniel W. Nebert 2 * 1 Director of PIR, Department of Biochemistry and

More information

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major

More information

Networks & pathways. Hedi Peterson MTAT Bioinformatics

Networks & pathways. Hedi Peterson MTAT Bioinformatics Networks & pathways Hedi Peterson (peterson@quretec.com) MTAT.03.239 Bioinformatics 03.11.2010 Networks are graphs Nodes Edges Edges Directed, undirected, weighted Nodes Genes Proteins Metabolites Enzymes

More information

Software and Databases for Protein Structure Classification. Some slides are modified from Kun Huang (OSU) and Doug Brutlag (Stanford)

Software and Databases for Protein Structure Classification. Some slides are modified from Kun Huang (OSU) and Doug Brutlag (Stanford) Software and Databases for Protein Structure Classification Some slides are modified from Kun Huang (OSU) and Doug Brutlag (Stanford) Proteins If there is a job to be done in the molecular world of our

More information

Bioinformatics methods COMPUTATIONAL WORKFLOW

Bioinformatics methods COMPUTATIONAL WORKFLOW Bioinformatics methods COMPUTATIONAL WORKFLOW RAW READ PROCESSING: 1. FastQC on raw reads 2. Kraken on raw reads to ID and remove contaminants 3. SortmeRNA to filter out rrna 4. Trimmomatic to filter by

More information

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs15.html Describing & Modeling Patterns

More information

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure

More information

Organization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p

Organization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p Organization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p.110-114 Arrangement of information in DNA----- requirements for RNA Common arrangement of protein-coding genes in prokaryotes=

More information

Chemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller

Chemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller Chemogenomic: Approaches to Rational Drug Design Jonas Skjødt Møller Chemogenomic Chemistry Biology Chemical biology Medical chemistry Chemical genetics Chemoinformatics Bioinformatics Chemoproteomics

More information

Comparative Features of Multicellular Eukaryotic Genomes

Comparative Features of Multicellular Eukaryotic Genomes Comparative Features of Multicellular Eukaryotic Genomes C elegans A thaliana O. Sativa D. melanogaster M. musculus H. sapiens Size (Mb) 97 115 389 120 2500 2900 # Genes 18,425 25,498 37,544 13,601 30,000

More information

PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES

PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES Eser Aygün 1, Caner Kömürlü 2, Zafer Aydin 3 and Zehra Çataltepe 1 1 Computer Engineering Department and 2

More information

Visualization of Macromolecular Structures

Visualization of Macromolecular Structures Visualization of Macromolecular Structures Present by: Qihang Li orig. author: O Donoghue, et al. Structural biology is rapidly accumulating a wealth of detailed information. Over 60,000 high-resolution

More information

Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus:

Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: m Eukaryotic mrna processing Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: Cap structure a modified guanine base is added to the 5 end. Poly-A tail

More information

Basics of protein structure

Basics of protein structure Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu

More information

DATA ACQUISITION FROM BIO-DATABASES AND BLAST. Natapol Pornputtapong 18 January 2018

DATA ACQUISITION FROM BIO-DATABASES AND BLAST. Natapol Pornputtapong 18 January 2018 DATA ACQUISITION FROM BIO-DATABASES AND BLAST Natapol Pornputtapong 18 January 2018 DATABASE Collections of data To share multi-user interface To prevent data loss To make sure to get the right things

More information