Anabaenopsis abijatae AB2002/09 (AM773296) Nostoc carneum IAM M-35 (AB325906) Calothrix brevissima IAM M-249 (AB074504)
|
|
- Nickolas Mosley
- 5 years ago
- Views:
Transcription
1 57 Nostoc sphaeroides HBHF0604 (EU178144) Gloeotrichia echinulata PYH6 (AM230703) Nostoc punctiforme ATCC (CP001037) Nostoc linckia IAM M-30 (AB325907) 93 Nostoc muscorum I (AJ630451) Trichormus variabilis KCTC AG10180 (DQ234832) Cylindrospermum stagnale PCC 7417 (AJ133163) Anabaenopsis abijatae AB2002/09 (AM773296) Nostoc carneum IAM M-35 (AB325906) Calothrix brevissima IAM M-249 (AB074504) Anabaenopsis circularis NIES21 (AF247595) FACHB-245 Anabaena variabilis ATCC (CP000117) Anabaena anomala RPAN34 (GQ4664) Anabaena ballyganglii RPAN35 (GQ466496) Anabaena laxa RPAN14 (GQ466510) Anabaena aphanizomenoides RPAN68 (GQ466515) Anabaena sphaerica RPAN12 (GQ466513) Nodularia baltica BY1 (AJ133177) Nodularia harveyana Bo53 (AJ781143) Aphanizomenon ovalisporum FAS-AP1 (EU076457) 80 Halotia wernerae CENA158 T (KC695852) Halotia longispora CENA184 T (KC695875) Trichormus variabilis KCTC AG10180 (DQ234832) Gloeotrichia echinulata PYH6 (AM230703) 62 Nostoc calcicola TH2S22 (AM711529) Nostoc ellipsosporum V (AJ630450) Nostoc muscorum I (AJ630451) Nostoc linckia IAM M-30 (AB325907) FACHB-252 Nostoc entophytum IAM M-267 (AB093490) Cylindrospermum stagnale PCC 7417 (AJ133163) 96 Anabaenopsis circularis NIES21 (AF247595) Anabaena variabilis ATCC (CP000117) Anabaena anomala RPAN34 (GQ4664) Anabaena sphaerica RPAN12 (GQ466513) Anabaena laxa RPAN14 (GQ466510) Anabaena ballyganglii RPAN35 (GQ466496)
2 72 96 Cyanobium gracile PCC6307 (AF001477) Aphanothece minutissima 2LT34S03 (FM177488) Merismopedia tenuissima 0BB46S01 (AJ639891) 88 Synechococcus rubescens SAG 3.81 (AF317076) Prochlorococcus marinus subsp. marinus CCMP 1375 T (AE017126) Prochlorococcus marinus subsp. pastoris MED4 (BX548174) Prochlorococcus marinus subsp. pastoris PCC 9511 T (AF180967) Synechococcus spongiarum SH4 (JENA00091) Synechococcus elongatus simbu1 (JN ) Synechococcus elongatus ARKK1 (JN8126.1) Synechococcus elongatus RBD03 (KT ) Synechococcus elongatus CENA126 (KP ) 62 Synechococcus elongatus PCC 6301 (KM0181.1) 82 FACHB-1092 Synechococcus elongatus PCC 7942 (CP000) Leptolyngbya nodulosa UTEX 2910 (EF122600) Oscillatoria neglecta M-82 (AB003168) Loriellopsis cavernicola LF-B5 T (HM748318) 79 Aphanocapsa muscicola VP3-03 (FR798916) Synechococcus lividus C1 (AF132772) 60 Phormidium pristleyi ANT.LH61.2 (AY493582) Arthronema africanum SAG (AB115966) Neosynechococcus sphagnicola CAUP A 1101 (JJML00087) Leptolyngbya frigida ANT.LH64B.1 (AY493577)
3 Nodularia spumigena AV63 (AJ781138) Nodularia baltica BY1 (AJ133177) Nodularia harveyana Bo53 (AJ781143) 84 Nodularia sphaerocarpa Fae19 (AJ781144) Anabaenopsis nadsonii 2LT27S11 (FM177481) Anabaenopsis elenkinii AB2002/34 (AM ) Anabaenopsis elenkinii AB2006/20 (AM ) Halotia longispora CENA184 T (KC695875) Halotia branconii CENA392 T (KJ843313) Halotia wernerae CENA158 T (KC695852) 82 Nostoc calcicola TH2S22 (AM711529) Nostoc ellipsosporum V (AJ630450) Nostoc muscorum I (AJ630451) Nostoc linckia IAM M-30 (AB325907) Anabaena crassa 215 (AJ293112) Anabaena planctonica 1tu33s8 (AJ630432) 70 Anabaena macrospora PMC9301 (AJ293115) 92 Anabaena spiroides PMC9702 (AJ293118) 59 Anabaena smithii 1tu39s8 (AJ630436) Anabaena sigmoidea 0tu36s7 (AJ630434) 60 Aphanizomenon flos-aquae 1tu26s2 (AJ ) Aphanizomenon flos-aquae 1tu29s19 (AJ ) Aphanizomenon flos-aquae PMC9401 (AJ293126) Aphanizomenon flos-aquae PMC9707 (AJ ) Aphanizomenon gracile PMC9402 (AJ ) FACHB FIG S1 Neighbour-joining tree based on 16S rrna gene sequences, showing the phylogenetic relationships between strains FACHB-245, FACHB-252, FACHB-1092 and FACHB-1171 and closest genera of cyanobacteria such as Anabaena, Nostoc, Synechococcus and Aphanizomenon. Bootstrap values (expressed as percentages of 0 replications) >50% are given at nodes. Bar, 0.5%, 0.5%, 1% and 0.5% sequence divergences respectively
4 S. cinnamoneus NBRC12852 T (AB184850) 76 S. pseudoechinosporeusnbrc12518 T (AB184) 60 S. hiroshimensis NBRC 3839 T (AB184802) S. blastmyceticus NRRL B-5480 T (AY9802) 84 S. ardus NBRC T (AB184864) S. abikoensis NBRC T (AB184537) S. olivoverticillatus NBRC T (AB184636) JXJ S. eurocidicus NRRL B-1676 T (AY9790) S. stramineus NBRC T (AB184720) S. netropsis NBRC 3723 T (AB184792) S. mobaraensis NBRC T (AORZ00256) S. sporoclivatus NBRC 767 T (AB2434) S. rhizosphaericus NBRC 778 T (AB2441) 90 S. atrirubernrrl B T (EU812169) S. seoulensis NBRC T (AB2470) S. spongiae Sp080513SC-24 T (AB498741) S. niveiscabiei S78 T (AF361786) S. fragilisnrrl 2424 T (AY17) 85 S. chiangmaiensis TA4-1 T (AB562507) FIG S2 Neighbour-joining tree based on 16S rrna gene sequences, showing the phylogenetic relationships between strain JXJ-0089 and related and representative species of genus Streptomyces. Bootstrap values (expressed as percentages of 0 replications) >50% are given at nodes. Bar, 0.5% sequence divergence. 19
5 20 a
6 21 b
7 22 c
8 d 23 24
9 25 e
10 26 f
11 27 g
12 28 h
13 29 i
14 j FIG S3 Spectra data of 1 D and 2D NMR of tryptamine and tryptoline. a, 1 H NMR of tryptamine; b, 13 C NMR of tryptamine; c, COSY of tryptamine; d, HSQC of tryptamine; e, HMBC of tryptamine; f, 1 H NMR of tryptoline, g, 13 C NMR of tryptoline; h, COSY of tryptoline; i, HSQC of tryptoline; j, HMBC of tryptoline
15 FIG S4 Algicidal activities of tryptoline, tryptamine, tryptophan, gramine and copper sulfate on Microcystis sp. FACHB-905 lawn (1, 6, 11, 16 represent tryptoline of 5, 10, 15 and 20 µg/disk respectively; 2, 7, 12 and 17 represent tryptamine of 5, 10, 15 and 20 µg/disk respectively; 3, 8, 13 and 18 represent tryptophan of 5, 10, 15 and 20 µg/disk respectively; 4, 9, 14 and 19 represent gramine of 5, 10, 15 and 20 µg/disk respectively; 5, 10, 15 and 20 represent copper sulfate of 5, 10, 15 and 20 µg/disk respectively.)
16 FIG S5 Damages of tryptamine and tryptoline to the morphology of Anabaena sp. FACHB-245 and Nostoc sp. FACHB-252 (observed by using the oil immersionlens of optical microscope, Olympus BX43, 10 times, NA=1.25). a and d, cells of Anabaena sp. FACHB-245 and Nostoc sp. FACHB-252 damaged by tryptamine; b and e, cells of Anabaena sp. FACHB-245 and Nostoc sp. FACHB-252 damaged by tryptoline; c and f, cells of Anabaena sp. FACHB-245 and Nostoc sp. FACHB-252 of the controls. Cell chains of Anabaena sp. Cell chains of Anabaena sp. FACHB-245 separated each other, and the background was the glass slide; cell chains of Nostoc sp. FACHB-252 aggregated, and the background was not glass, but other cell chains or fragment of lysed cells etc.
PHYLOGENY AND MOLECULAR BIODIVERSITY OF BIDIRECTIONAL HYDROGENASES IN CYANOBACTERIA
BABEȘ-BOLYAI UNIVERSITY FACULTY OF BIOLOGY AND GEOLOGY DEPARTMENT OF MOLECULAR BIOLOGY AND BIOTECHNOLOGY PHD THESIS PHYLOGENY AND MOLECULAR BIODIVERSITY OF BIDIRECTIONAL HYDROGENASES IN CYANOBACTERIA -
More informationBIODIVERSITY OF CYANOBACTERIA IN RIVER GANGA AT KANPUR, UTTAR PRADESH, INDIA
BIODIVERSITY OF CYANOBACTERIA IN RIVER GANGA AT KANPUR, UTTAR PRADESH, INDIA *Vinod Rishi 1 and Awasthi A.K. 2 1 Mahatma Gandhi Chitrakoot Gramoday University Chitrakoot, Satna, M. P. 2 Brahmanand Degree
More informationEvolution of The Biological Pump. Andy Ridgwell. (alternative ocean carbon facts in a fake World)
Goldschmidt 18 Evolution of The Biological Pump (alternative ocean carbon facts in a fake World) Andy Ridgwell University of California Riverside University of Bristol Ng Pg K J T P C D S O Cm Cenozoic
More informationSupporting information New Diketopiperazine Derivatives from a Deep-Sea-Derived
Supporting information New Diketopiperazine Derivatives from a Deep-Sea-Derived Nocardiopsis alba SCSIO 03039 Qingbo Zhang 1,3, Sumei Li 1, Yuchan Chen 2, Xinpeng Tian 1, Haibo Zhang 1, Guangtao Zhang
More informationRESULTS CHAPTER IV. 4. A. Occurrence of blue green algae
CHAPTER IV RESULTS 4. A. Occurrence of blue green algae Blue green algae are common in all kinds of natural habitats. Many species are cosmopolitan, distributed throughout the world. Water logged rice
More informationSupporting Information
Supporting Information Schirrmeister et al. 10.1073/pnas.1209927110 SI Text Taxon Sampling. Strain G40 (deposited in GenBank) is a yetuncharacterized, terminally differentiated, multicellular isolate from
More informationBALKAN SCIENTIFIC CONFERENCE OF BIOLOGY May 19-21, 2005, Plovdiv, Bulgaria
University of Plovdiv Paisii Hilendarski Faculty of Biology Union of scientists in Bulgaria BALKAN SCIENTIFIC CONFERENCE OF BIOLOGY May 19-21, 2005, Plovdiv, Bulgaria PROCEEDINGS B. GRUEV, M. NIKOLOVA,
More informationISSN: Teneva et al. J. BioSci. Biotech. 2012, 1(1): RESEARCH ARTICLE
Ivanka Teneva 1* Plamen Stoyanov 1* Rumen Mladenov 1 Balik Dzhambazov 2 Molecular and phylogenetic characterization of two species of the genus Nostoc (Cyanobacteria) based on the cpcb-igs-cpca locus of
More informationvariety of habitats such as fresh water or marine system, soil, paddy fields and tree
INTRODUCTION: According to Fritsch (1935), algae include all halophytic organisms that fail to reach the level of differentiation characteristic of archegoniate plants. Algae grow in a variety of habitats
More informationAmanda Murby University of New Hampshire. Cyanobacteria Monitoring and Analysis Workshop June 26, Cyanobacteria. Importance of Toxins and Size
Amanda Murby University of New Hampshire Cyanobacteria Monitoring and Analysis Workshop June 26, 2013 Cyanobacteria Importance of Toxins and Size Single-cells breaking off of the Microcystis? Aphanizomenon
More informationFigure S1. Phylogenetic tree of predicted ethylene binding domains from non-plant genomes.
ETR1 Arabidopsis_thaliana ERS1 Arabidopsis_thaliana ERS2 Arabidopsis_thalianas ETR2 Arabidopsis_thaliana EIN4 Arabidopsis_thaliana GI_495567658 Methylophaga_thiooxydans GI_516343515 Nafulsella_turpanensis
More informationAssessing Taxonomic Issues with the Genera Anabaena, Aphanizomenon and Nostoc Using Morphology, 16S rrna and efp genes
Assessing Taxonomic Issues with the Genera Anabaena, Aphanizomenon and Nostoc Using Morphology, 16S rrna and efp genes by Orietta Beltrami A thesis presented to the University of Waterloo in fulfillment
More informationDonna Kashian, Anna Boegehold, Karim Alame, and Nick Johnson
Donna Kashian, Anna Boegehold, Karim Alame, and Nick Johnson Alter nutrient and phytoplankton dynamics Dreissenid may enhance cyanobacteria blooms through selective feeding Cyanobacteria can produce harmful
More informationOscillatoria sp. PCC 6407 fresh water, USA (1964) 1. Oscillatoria sp. PCC 6412 fresh water, USA (1964) 1
Table S1. Cyanobacterial strains and environmental samples used in the study. All numbered strains are maintained at the Helsinki University Cyanobacteria Culture Collection, all PCC strains are maintained
More informationACCGGTTTCGAATTGACAATTAATCATCGGCTCGTATAATGGTACC TGAAATGAGCTGTTGACAATTAATCATCCGGCTCGTATAATGTGTGG AATTGTGAGCGGATAACAATTTCACAGGTACC
SUPPLEMENTAL TABLE S1. Promoter and riboswitch sequences used in this study. Predicted transcriptional start sites are bolded and underlined. Riboswitch sequences were obtained from Topp et al., Appl Environ
More informationEvolution of branching filamentous cyanobacteria: Molecular-phylogenetic analyses of stigonematalean species
Evolution of branching filamentous cyanobacteria: Molecular-phylogenetic analyses of stigonematalean species Akiko Tomitani Research Program for Paleoenvironment, Institute for Research on Earth Evolution
More informationProblem of the taxonomic category species in cyanobacteria
Algological Studies 109 (Cyanobacterial Research 4) 281 297 Stuttgart, August 2003 Problem of the taxonomic category species in cyanobacteria By JIŘÍ KOMÁREK Czech Academy of Sciences, Institute of Botany,
More informationIn Vivo Monitoring of Blue-Green Algae Using Hydrolab Multi- Parameter Sondes
In Vivo Monitoring of Blue-Green Algae Using Hydrolab Multi- Parameter Sondes Patrick A. Sanders Hach Hydromet Hydrolab and OTT Products E-Mail: psanders@hach.com What are Blue Green Algae Widely thought
More informationPhylogenetically distant clade of Nostoc-like taxa with the description of Aliinostoc gen. nov. and Aliinostoc morphoplasticum sp. nov.
TAXONOMIC DESCRIPTION Bagchi et al., Int J Syst Evol Microbiol 2017;67:3329 3338 DOI 10.1099/ijsem.0.002112 Phylogenetically distant clade of Nostoc-like taxa with the description of Aliinostoc gen. nov.
More informationBLUE GREEN ALGAE FROM RICE FIELDS OF KARIMGANJ DISTRICT, ASSAM, NORTH EAST INDIA ABSTRACT
BLUE GREEN ALGAE FROM RICE FIELDS OF KARIMGANJ DISTRICT, ASSAM, NORTH EAST INDIA MOIRANGTHEM THAJAMANBI 1, JAYASHREE ROUT 1 * AND NOORUDDIN THAJUDDIN 2 *1 Department of Ecology and Environmental Science,
More informationIdentification of hypothetical proteins with putative arsenate reductase properties in cyanobacteria by bioinformatics approach
Identification of hypothetical s with putative arsenate reductase properties in cyanobacteria by bioinformatics approach PV Parvati Sai Arun * Centre for Bioinformatics, CR Rao Advanced Institute of Mathematics,
More informationUreaplasma Urease Genes have Undergone a Unique Evolutionary Process
The Open Systems Biology Journal, 2009, 2, 1-7 1 Open Access Ureaplasma Urease Genes have Undergone a Unique Evolutionary Process Hiromi Nishida * Agricultural Bioinformatics Research Unit, Graduate School
More informationClassification and Nomenclature of Viruses of Cyanobacteria
Taxonomy Received: May 25, 1982 Intervirology 1983;19:61-66 Classification and Nomenclature of Viruses of Cyanobacteria R.S. Safferman R.E. Cannon P.R. Desjardins B.V. Gromov R. Haselkorn L.A. Sherman
More informationPhylogenetic rooting using minimal ancestor deviation
Phylogenetic rooting using minimal ancestor deviation Fernando D. K. Tria 1, Giddy Landan 1*, Tal Dagan Genomic Microbiology Group, Institute of General Microbiology, Kiel University, Kiel, Germany 1 Equally
More informationPhylogenetic Study by the Morphological and Molecular Analyses of Japanese Planktonic Anabaena Species
Bull. Natl. Mus. Nat. Sci., Ser. B, 36(2), pp. 71 80, May 22, 2010 Phylogenetic Study by the Morphological and Molecular Analyses of Japanese Planktonic Anabaena Species Akihiro Tuji* and Yuko Niiyama
More informationREVIEW OF LITERATURE:
REVIEW OF LITERATURE: Cyanobacteria are prokaryotic micro-organisms that resemble gram negative bacteria in structure but possess oxygen evolving photosynthetic system similar to that of eukaryotic algae
More informationCharacterization of cyanobacterial communities from high-elevation lakes in the Bolivian Andes
Click Here for Full Article JOURNAL OF GEOPHYSICAL RESEARCH, VOL. 115,, doi:10.1029/2008jg000817, 2010 Characterization of cyanobacterial communities from high-elevation lakes in the Bolivian Andes Erich
More informationToxic Cyanoprokaryotes in resource waters : monitoring of their occurrence and toxin detection
Toxic Cyanoprokaryotes in resource waters : monitoring of their occurrence and toxin detection Bouaïcha, N. 1, Via-Ordorika, L. 1, Vandevelde, T. 2, Fauchon, N. 2, Puiseux-Dao, S. 1 1 : CEMATMA, Cryptogamie,
More informationInternational Journal of Research and Development in Pharmacy and Life Sciences. Research Article
International Journal of Research and Development in Pharmacy and Life Sciences Available online at http//www.ijrdpl.com February - March, 05, Vol., No., pp 56-6 ISSN (P): 9-9X, ISSN (E): 78-08 Research
More informationS Mishra, P Bhargava, R Rai, Y Mishra, T Zotta, E Parente, L Rai
ISPUB.COM The Internet Journal of Microbiology Volume 7 Number 2 Protein fingerprinting may serve as a complementary tool for the phylogenetic classification of heterocystous (Nostoc, Anabaena, Cylindrospermum,
More informationResearch Article Potential Anticryptococcal Compound from Marine Nocardiopsis synnemataformans
OPEN ACCESS Journal of Biological Sciences ISSN 1727-348 DOI: 1.3923/jbs.217.157.17 Research Article Potential Anticryptococcal Compound from Marine Nocardiopsis synnemataformans Sudarshan Singh Rathore,
More informationDiversity of Blue-Green Algae and Green Algae in the Deciduous Dipterocarp Forest at Huai Kha Khang Wildlife Sanctuary
Kasetsart J. (Nat. Sci.) 32 : 339-346 (1998) Diversity of Blue-Green Algae and Green Algae in the Deciduous Dipterocarp Forest at Huai Kha Khang Wildlife Sanctuary Duenrut Chonudomkul 1, Wichien Yongmanitchai
More informationModern ionotropic glutamate receptor with a K + selectivity signature sequence
SUPPLEMENTARY INFORMATION Modern ionotropic glutamate receptor with a K + selectivity signature sequence H. Janovjak, G. Sandoz and E.Y. Isacoff * * Correspondence should be addressed to E.Y.I. (ehud@berkeley.edu).
More informationOCCURRENCE OF NITROGEN-FIXING CYANOBACTERIA IN LOCAL RICE FIELDS OF ORISSA, INDIA
ECOPRINT 17: 77-8, 21 ISSN 124-8668 Ecological Society (ECOS), Nepal www.nepjol.info/index.php/eco; www.ecosnepal.com OCCURRENCE OF NITROGEN-FIXING CYANOBACTERIA IN LOCAL RICE FIELDS OF ORISSA, INDIA H.S.
More informationStudy of Cyanobacterial Biodiversity in Rice Fields of Central Bihar
3 rd World Conference on Applied Sciences, Engineering & Technology 27-29 September 2014, Kathmandu, Nepal Study of Cyanobacterial Biodiversity in Rice Fields of Central Bihar P. KHARE, A. SINGH, C. PRABHA
More informationThe Phosphopantetheinyl Transferase Superfamily: Phylogenetic Analysis and Functional Implications in Cyanobacteria
APPLIED AND ENVIRONMENTAL MICROBIOLOGY, Apr. 2006, p. 2298 2305 Vol. 72, No. 4 0099-2240/06/$08.00 0 doi:10.1128/aem.72.4.2298 2305.2006 Copyright 2006, American Society for Microbiology. All Rights Reserved.
More informationPhylogenetic diversity of picocyanobacteria in Arctic and Antarctic ecosystems
Phylogenetic diversity of picocyanobacteria in Arctic and Antarctic ecosystems Vincent, W.F 1, J.P. Bowman 2, L.M. Rankin 2, and T.A. McMeekin 2 1 Dépt de biologie & Centre d études nordiques, Laval University,
More informationCyanobacteria, Bacillariophyta & Dinophyta
Cyanobacteria, Bacillariophyta & Dinophyta Objective Today we will examine members of the Cyanophyta, Bacillariophyta and Dinophyta. We will become familiar with aspects of their diversity, variation in
More informationISSN: (Print) (Online) Journal homepage:
European Journal of Phycology ISSN: 0967-0262 (Print) 1469-4433 (Online) Journal homepage: http://www.tandfonline.com/loi/tejp20 Phenotypic and genotypic characteristics of Phormidium-like cyanobacteria
More informationPhotosynthetic picoeukaryote assemblages in the South China Sea from the Pearl River estuary to the SEATS station
The following supplement accompanies the article Photosynthetic picoeukaryote assemblages in the South China Sea from the Pearl River estuary to the SEATS station Wenxue Wu, Bangqin Huang*, Chao Zhong
More informationPhylogenetic Analysis of Anabaena spp. (Cyanobacteria) Using Sequences of 16S rrna Gene.
Australian Journal of Basic and Applied Sciences, 3(4): 4026-4031, 2009 ISSN 1991-8178 Phylogenetic Analysis of Anabaena spp. (Cyanobacteria) Using Sequences of 16S rrna Gene. Anbalagan Ezhilarasi and
More informationThe Investigation of Allelopathy and its Potential Effect on Trophic Dynamics in Aquatic Systems
The Investigation of Allelopathy and its Potential Effect on Trophic Dynamics in Aquatic Systems Daniel J. Sullivan and Eric D. Dibble Department of Wildlife, Fisheries, and Aquaculture Science College
More informationInternational Journal of Advanced Research in Biological Sciences ISSN: Coden: IJARQG(USA)
International Journal of Advanced Research in Biological Sciences ISSN: 2348-8069 www.ijarbs.com Coden: IJARQG(USA) Research Article Screening and characterization of cyanobacterial species isolated from
More informationCYANOBACTERIA- SOME REPORTS FROM VARIOUS HABITATS OF RANCHI (JHARKHAND) INDIA
J. Indian bot. Soc. e-issn:2455-7218, ISSN:0019-4468 Vol. 97 (1) 2018 :29-35 CYANOBACTERIA- SOME REPORTS FROM VARIOUS HABITATS OF RANCHI (JHARKHAND) INDIA CHHAYA THAKUR AND RADHA SAHU Algal Biology and
More informationNew Zealand Guidelines for Cyanobacteria in Recreational Fresh Waters. Interim Guidelines
New Zealand Guidelines for Cyanobacteria in Recreational Fresh Waters Interim Guidelines Acknowledgements Prepared for the Ministry for the Environment and the Ministry of Health by: Susanna A Wood: Cawthron
More informationCyanobacterial and micro algal diversity from Kanpur, an industrial city in North Indian Gangetic plains.
, an industrial city in North Indian Gangetic plains. ABSTRACT Sugandha Tiwari Department of Botany, D.G. College, C.S.J.M. University, Kanpur,Uttar Pradesh, India. Email address : sugandhatiwari7@gmail.com
More informationMicrobial community analysis of Lake Chillisquaque, a small water system in Central Pennsylvania
Bucknell University Bucknell Digital Commons Honors Theses Student Theses 2011 Microbial community analysis of Lake Chillisquaque, a small water system in Central Pennsylvania Allison Mayhew Bucknell University
More informationUnderstanding Harmful Algal Blooms and their potential impacts Native American Communities
Tribal Lands and Environment Forum (TLEF) August 15-18, 2016 Mohegan Sun Resort Uncasville, Connecticut Understanding Harmful Algal Blooms and their potential impacts Native American Communities Barry
More information/ / MET Day 000 NC1^ INRTL MNVR I E E PRE SLEEP K PRE SLEEP R E
05//0 5:26:04 09/6/0 (259) 6 7 8 9 20 2 22 2 09/7 0 02 0 000/00 0 02 0 04 05 06 07 08 09 0 2 ay 000 ^ 0 X Y / / / / ( %/ ) 2 /0 2 ( ) ^ 4 / Y/ 2 4 5 6 7 8 9 2 X ^ X % 2 // 09/7/0 (260) ay 000 02 05//0
More informationMURDOCH RESEARCH REPOSITORY
MURDOCH RESEARCH REPOSITORY This is the author s final version of the work, as accepted for publication following peer review but without the publisher s layout or pagination. The definitive version is
More informationPalmer Algal Posters to Cyanotoxins; changes in our knowledge of cyanobacteria (bluegreens)
Palmer Algal Posters to Cyanotoxins; changes in our knowledge of cyanobacteria (bluegreens) North Carolina Lake Management Society Spring Workshop 2016 Mark Vander Borgh, Linda Ehrlich and Astrid Schnetzer
More informationGenetic Diversity and Molecular Phylogeny of Cyanobacteria from Sri Lanka Based on 16S rrna Gene
Environ. Eng. Res. 2014; 19(4): 317-329 pissn 1226-1025 http://dx.doi.org/10.4491/eer.2014.035 eissn 2005-968X Genetic Diversity and Molecular Phylogeny of Cyanobacteria from Sri Lanka Based on 16S rrna
More information1 CHARACTERIZATION AND CLASSIFICATIONS OF BLUE-GREEN ALGAE/CYANOBACTERIA* P. A. Roger** and P. M. Reddy
1 CHARACTERIZATION AND CLASSIFICATIONS OF BLUE-GREEN ALGAE/CYANOBACTERIA* P. A. Roger** and P. M. Reddy Soil Microbiology Department The International Rice Research Institute Los Banos, Philippines CONTENTS
More informationInternational Journal of Experimental Research and Review (IJERR) Copyright by International Academic Publishing House (IAPH), Website:
International Journal of Experimental Research and Review (IJERR) Copyright by International Academic Publishing House (IAPH), Website: www.iaph.in ISSN: 2455-4855 Original Article CYANOBACTERIAL DIVERSITY
More informationStudy of soil blue-green algae and their effect on seed germination and plant growth of vegetable crops
Rostaniha (Botanical Journal of Iran) Vol. 12 (2), 211 11 / 11 Rostaniha 12(2): 11-11 (211) (139) 11-11 :(2)12 Study of soil blue-green algae and their effect on seed germination and plant growth of vegetable
More informationGenetic Diversity and Molecular Phylogeny of Cyanobacteria from Sri Lanka based on 16S rrna Gene
Environ. Eng. Res. 2014 Research Paper http://dx.doi.org/10.4491/eer.2014.035 pissn 1226-1025 eissn 2005-968X In Press, Uncorrected Proof Genetic Diversity and Molecular Phylogeny of Cyanobacteria from
More informationSupplementary Fig. 1. Infection of three C. elegans strains used for spatially restricted enzymatic tagging. Animals infected with N.
Supplementary Fig. 1. Infection of three C. elegans strains used for spatially restricted enzymatic tagging. Animals infected with N. parisii stained with a FISH probe (red) specific for Nematocida rrna.
More informationA L A BA M A L A W R E V IE W
A L A BA M A L A W R E V IE W Volume 52 Fall 2000 Number 1 B E F O R E D I S A B I L I T Y C I V I L R I G HT S : C I V I L W A R P E N S I O N S A N D TH E P O L I T I C S O F D I S A B I L I T Y I N
More informationSeasonal variation of phytoplankton and cyanobacteria composition and associated microcystins in six Portuguese freshwater reservoirs
Ann. Limnol. - Int. J. Lim. 2008, 44 (3), 189-196 Seasonal variation of phytoplankton and cyanobacteria composition and associated microcystins in six Portuguese freshwater reservoirs E. Valério 1,2*,
More informationCoculture of two Developmental Stages of a Marine-derived Aspergillus alliaceus. Results in the Production of the Cytotoxic Bianthrone Allianthrone A
Coculture of two Developmental Stages of a Marine-derived Aspergillus alliaceus Results in the Production of the Cytotoxic Bianthrone Allianthrone A P. E. Mandelare, D. A. Adpressa, E. N. Kaweesa, L. N.
More informationA TAXONOMIC STUDY ON SOIL TAXA OF APOHETEROCYTIC CYANOPROKARYOTA FROM NOSTOCACEAE FAMILY IN IRAN
DOI: http://dx.doi.org/10.22092/ijb.2013.4137 A TAXONOMIC STUDY ON SOIL TAXA OF APOHETEROCYTIC CYANOPROKARYOTA FROM NOSTOCACEAE FAMILY IN IRAN Z. Shariatmadari & H. Riahi Received 09.10.2012. Accepted
More informationSupporting Information
Supporting Information Das et al. 10.1073/pnas.1302500110 < SP >< LRRNT > < LRR1 > < LRRV1 > < LRRV2 Pm-VLRC M G F V V A L L V L G A W C G S C S A Q - R Q R A C V E A G K S D V C I C S S A T D S S P E
More information(Received March 26, 2018, Accepted May 24, 2018)
International Journal of Research in BioSciences Volume 7 Issue 3, pp. (1-17), June 2018 Available online at http://www.ijrbs.in ISSN 2319-2844 Research Paper Physicochemical confirmatory evidences for
More informationMolecular phylogeny of the heterocystous cyanobacteria (subsections IV and V) based on nifd
International Journal of Systematic and Evolutionary Microbiology (2004), 54, 493 497 DOI 10.1099/ijs.0.02821-0 Molecular phylogeny of the heterocystous cyanobacteria (subsections IV and V) based on nifd
More informationThe evolutionary diversification of cyanobacteria: Molecular phylogenetic and paleontological perspectives
The evolutionary diversification of cyanobacteria: Molecular phylogenetic and paleontological perspectives Akiko Tomitani, Andrew H. Knoll, Colleen M. Cavanaugh, and Terufumi Ohno The Kyoto University
More informationCyanobacteria of Greece: an annotated checklist
Biodiversity Data Journal 4: e10084 doi: 10.3897/BDJ.4.e10084 Taxonomic Paper Cyanobacteria of Greece: an annotated checklist Spyros Gkelis, Iordanis Ourailidis, Manthos Panou, Nikos Pappas Department
More informationLife in an unusual intracellular niche a bacterial symbiont infecting the nucleus of amoebae
Life in an unusual intracellular niche a bacterial symbiont infecting the nucleus of amoebae Frederik Schulz, Ilias Lagkouvardos, Florian Wascher, Karin Aistleitner, Rok Kostanjšek, Matthias Horn Supplementary
More informationPhylogeny and Biogeography of Cyanobacteria and Their Produced Toxins
Mar. Drugs 2013, 11, 4350-4369; doi:10.3390/md11114350 Review OPEN ACCESS marine drugs ISSN 1660-3397 www.mdpi.com/journal/marinedrugs Phylogeny and Biogeography of Cyanobacteria and Their Produced Toxins
More information~~'h. Reprint from. Mansoura University Journal of Agricultural Sciences. Volume 31 No. (8) August, Established in 1976
ISSN 111-346 ~~'h. ~ ~~ Reprint from Mansoura University Journal of Agricultural Sciences Volume 31 No. (8) August, 26 Established in 1976 Official Publication of Faculty of Agriculture, Mansoura University
More informationa-fB. Code assigned:
This form should be used for all taxonomic proposals. Please complete all those modules that are applicable (and then delete the unwanted sections). For guidance, see the notes written in blue and the
More informationParts Manual. EPIC II Critical Care Bed REF 2031
EPIC II Critical Care Bed REF 2031 Parts Manual For parts or technical assistance call: USA: 1-800-327-0770 2013/05 B.0 2031-109-006 REV B www.stryker.com Table of Contents English Product Labels... 4
More informationSupplementary Information
Supplementary Information Precipitation shapes communities of arbuscular mycorrhizal fungi in Tibetan alpine steppe Jing Zhang 1, Fang Wang 1, Rongxiao Che 1, Ping Wang 2, Hanke Liu 1, Baoming Ji 2* Xiaoyong
More informationElements of Bioinformatics 14F01 TP5 -Phylogenetic analysis
Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila
More informationManaging Mycological Mysteries
Managing Mycological Mysteries (Systematics and the Identification of Fungi) NPDN meeting March 2016 Megan Romberg USDA APHIS PPQ PHP NIS APHIS NIS Beltsville APHIS CPHST Beltsville APHIS NIS (Mycology)
More informationSammanfattning. accumulation. Sammanfattning av ytansamlingar
Oceanographic Unit No 7, August 2015 Algal situation in Marine Waters surrounding Sweden Sammanfattning Denna rapport handlar enbart om Östersjön då SMHI följt med på den Finska expeditionen COMBINE 3
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. Schematic pipeline for single-cell genome assembly, cleaning and annotation. a. The assembly process was optimized to account for multiple cells putatively
More informationThe only contamination levels for microbial contaminants in recreational and source waters are coliforms and the fecal bacteria E.
The only contamination levels for microbial contaminants in recreational and source waters are coliforms and the fecal bacteria E. coli and Enterococci sp. With the threats to public health caused by emerging
More informationIntraphylum Diversity and Complex Evolution of Cyanobacterial AminoacyltRNA Synthetases
Intraphylum Diversity and Complex Evolution of Cyanobacterial AminoacyltRNA Synthetases Ignacio Luque,* 1 María Loreto Riera-Alberola,* Alfonso Andújar,* and Jesús A. G. Ochoa de Alda 1 *Instituto de Bioquímica
More informationDiversity within cyanobacterial mat communities in variable salinity meltwater ponds of McMurdo Ice Shelf, Antarctica
Blackwell Science, LtdOxford, UKEMIEnvironmental Microbiology 1462-2912Society for Applied Microbiology and Blackwell Publishing Ltd, 200474519529Original ArticleCyanobacterial diversity in variable salinity
More informationReview Paper(NS-3) BIOLOGICAL PHOTOHYDROGEN PRODUCTION BY CYANOBACTERIA : FUTURE PROSPECTS AS A FUEL
Review Paper(NS-3) BIOLOGICAL PHOTOHYDROGEN PRODUCTION BY CYANOBACTERIA : FUTURE PROSPECTS AS A FUEL Kamra Anjana*, Bala Kiran, Sharma Mona and Anubha Kaushik Department of Environmental Science and Engineering,
More informationPhylogenetic relationship of Arthrospira, Phormidium,andSpirulina strains from Kenyan and Indian waterbodies
127 VI Phylogenetic relationship of Arthrospira, Phormidium,andSpirulina strains from Kenyan and Indian waterbodies Phylogenetic relationship of Arthrospira, Phormidium and Spirulina strains 128 Phylogenetic
More informationPhylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
More information= (, ) V λ (1) λ λ ( + + ) P = [ ( ), (1)] ( ) ( ) = ( ) ( ) ( 0 ) ( 0 ) = ( 0 ) ( 0 ) 0 ( 0 ) ( ( 0 )) ( ( 0 )) = ( ( 0 )) ( ( 0 )) ( + ( 0 )) ( + ( 0 )) = ( + ( 0 )) ( ( 0 )) P V V V V V P V P V V V
More informationBINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
More informationAnsalactams B-D Illustrate Further Biosynthetic Plasticity within the Ansamycin Pathway
Ansalactams B-D Illustrate Further Biosynthetic Plasticity within the Ansamycin Pathway Tu Cam Le, Inho Yang, Yeo Joon Yoon, Sang-Jip Nam,*, and William Fenical *, Department of Chemistry and Nano Science,
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationMTH5102 Spring 2017 HW Assignment 1: Prob. Set; Sec. 1.2, #7, 8, 12, 13, 20, 21 The due date for this assignment is 1/18/17.
MTH5102 Spring 2017 HW Assignment 1: Prob. Set; Sec. 1.2, #7, 8, 12, 13, 20, 21 The due date for this assignment is 1/18/17. 7. Let S = {0, 1} and F = R. In F (S, R), show that f = g and f + g = h, where
More informationHow DNA barcoding can be more effective in microalgae. identification: a case of cryptic diversity revelation in Scenedesmus
How DNA barcoding can be more effective in microalgae identification: a case of cryptic diversity revelation in Scenedesmus (Chlorophyceae) Shanmei Zou, Cong Fei, Chun Wang, Zhan Gao, Yachao Bao, Meilin
More informationAntimicrobial Activity of Nostoc calcicola (Cyanobacteria) Isolated from Central India Against Human Pathogens
ORIGINAL ARTICLE Antimicrobial Activity of Nostoc calcicola (Cyanobacteria) Isolated from Central India Against Human Pathogens Sulekha Yadav 1,2, Monica Agrawal 1,2, Neelima Raipuria 2, Manish Kumar Agrawal
More informationpage 1 Total ( )
A B C D E F Costs budget of [Claimant / Defendant] dated [ ] Estimated page 1 Work done / to be done Pre-action Disbs ( ) Time ( ) Disbs ( ) Time ( ) Total ( ) 1 Issue /statements of case 0.00 0.00 CMC
More informationDistribution and physiological characterization of cyanobacteria isolated from arid zones of Rajasthan
Tropical Ecology 46(2): 165 171, 2005 ISSN 0564 3295 International Society for Tropical Ecology Distribution and physiological characterization of cyanobacteria isolated from arid zones of Rajasthan O.N.
More informationJunior Soldiers Unit 13 : Lesson 1
J S U 1 : L 1 R Bb PURPOSE: T v c pp xp pc f Bb f fm B Pc. Ev bf m, G v c C b f. Ep 1: NLT) C Pp R: Ep 1:-10 NLT) 1 C 8:6 CEV) Ep :-5 CEV) T Bb c b cf m, pc fc m p f. T v c B Pc m f Bb. W vc f G W, p v
More informationIron Regulation of Growth and Heterocyst Formation in the Nitrogen Fixing Cyanobacterium Nostoc sp. PCC 7120
J. Eco. Heal. Env.4, No. 3, 103-109 (2016) 103 Journal of Ecology of Health & Environment An International Journal http://dx.doi.org/10.18576/jehe/040301 Iron Regulation of Growth and Heterocyst Formation
More informationInferring long-term trends in prairie reservoirs (Saskatchewan, Canada) through analysis of DNA in sediment cores
Inferring long-term trends in prairie reservoirs (Saskatchewan, Canada) through analysis of DNA in sediment cores Tse, T. J. a,b, Song, T. a, Hecker, M. a,b, Giesy, J.P. a,b,c, Doig, L. E. a,b, and Jones,
More informationSupplementary material
Table 1: The number of protein sequences listed for the BacelLo training data set according to each origin and localization. Localization Plants Animal Fungi chloroplast (ch) 204 - - cytoplasm (cy) 58
More information30 6 2012 12 ACTA SEDIMENTOLOGICA SINICA Vol. 30 No. 6 Dec. 2012 1000-0550 2012 06-1080-08 1 1 2 1 1 3 1. 550001 2. 550008 3. 550001 1 2 0 ~ 60 rpm 1959 E-mail chengxing500@ 163. com P642. 25 A 0 9 1 ~
More informationCommunicated by William S. Bowers, University of Arizona, Tucson, AZ, February 24, 2005 (received for review December 3, 2004)
Diverse taxa of cyanobacteria produce -N-methylamino-L-alanine, a neurotoxic amino acid Paul Alan Cox *,, Sandra Anne Banack, Susan J. Murch *, Ulla Rasmussen, Georgia Tien, Robert Richard Bidigare, James
More informationJournal of Multidisciplinary Scientific Research,2013, 1(3): ISSN: Available Online:
Journal of Multidisciplinary Scientific Research,2013, 1(3): 01-08 ISSN: 2307-6976 Available Online: http://jmsr.rstpublishers.com/ DISTRIBUTION OF HETEROCYSTOUS AND NON- HETEROCYSTOUS SOIL MICROFLORA
More informationPhytoplankton biomass and species succession in the Gulf of Finland, Northern Baltic Proper and Southern Baltic Sea in 2010
Phytoplankton biomass and species succession in the Gulf of Finland, Northern Baltic Proper and Southern Baltic Sea in 2010 Authors: Seppo Kaitala, Seija Hällfors and Petri Maunula Centre for Marine Research,
More informationCyanobacterial Diversity in Western Ghats Region of Maharashtra, India
Bioremediation, Biodiversity and Bioavailability 2013 Global Science Books Cyanobacterial Diversity in Western Ghats Region of Maharashtra, India Tukaram D. Nikam 1* Janardhan N. Nehul 2 Yogesh R. Gahile
More information