The Discovery of Plant Natriuretic Peptides. Physiology, molecular biology, systems biology and biotechnology

Size: px
Start display at page:

Download "The Discovery of Plant Natriuretic Peptides. Physiology, molecular biology, systems biology and biotechnology"

Transcription

1 The Discovery of Plant Natriuretic Peptides Physiology, molecular biology, systems biology and biotechnology

2 ANP - ATRIAL NATRIURETIC PEPTIDE ANP is a 28 aa peptide hormone ANP is produced in cardiocytes The targets are the vascular and renal system Some ANP receptors have guanylate cyclase domains NPs play a key role in homeostasis

3 Can vertebrate NPs affect plants? Do plants have a NP-like system? If plants contain NPs, can they affect vertebrates?

4 Stomatal function is a key to homeostasis in higher plants Stomatal opening is achieved by H 2 O uptake preceded by net K + influx which in turn is driven by H + -ATPase-dependent hyperpolarisation. Net H 2 O efflux causes closure and requires net K + efflux usually resulting from depolarisation.

5 First evidence ANP promotes concentration dependent stomatal opening Therefore: ANP must cause net K + (and consequent H 2 O) up-take Second messengers include: - [Ca 2+ ] cyt - [ph] cyt - inositol-1,4,5-trisphosphates - cyclic nucleotides (cgmp)

6 Isolation and identification of Plant Natriuretic Peptides - PNPs

7 - Anti-ANP purifies PNPs a biologically active plant peptide - PNPs modulate H 2 O and ion transport at nanomolar concentrations - PNPs are the first peptidic plant hormones that affect plant homeostasis

8 Structural analysis of PNPs irpnp Marker upper band: p kd 9 kd N-terminus: determined by Edman degradation C-terminus: determined by Mass Spec. - The AA sequence shows a high degree of homology with a blight induced, functionally uncharacterised protein (p12) from citrus

9

10 The molecular structure of PNP-like molecules

11 Citrus p12 MGVGTKVLVITTMAICLISSAAYASEGTATFYTPPYVPSACNGYKNDGVMIAAASYAIWN 60! AtPNP-B ---MSKSIVFFSTVLVFLFSFSYATPGIATFYTS-YTP--CYRGTQEGVMIAAASDTLWD! AtPNP-A --MAVKFVVVMIVFAQILAPIAEAAQGKAVYYDPPYTRSACYG-TQRETLVVGVKNNLWQ! * :*. ::. : *: * *.:*. *. *.:.::... :*:! Citrus p12 AtPNP-B AtPNP-A Citrus p12 AtPNP-B AtPNP-A NGAVCNKSFRVKCTGATNQGTPHPCRGGSVLVKIVDLCPAGCQATIDLSQEAFSQIANPD! NGRVCGKMFTVKCSGPRN-AVPHPCTGKSVKVKIVDHCPSGCASTLDLSREAFAQIANPV! NGRACGRRYRVRCIGATY-NFDRACTGRTVDVKVVDFCREPCNGDLNLSRDAFRVIANTD! **.*.: : *:* *. :.* * :* **:** * *. ::**::** ***.! AGKIKIEFNQA! AGIINIDYFP-! AGNIRVVYTP-! ** *.: :! R-arginine W-tryptophan AtPNP-A; Theoretical pi: 9.32 (and 9.35 without signal peptide)

12 35 68 AtPNP-A --- PYTRSACYGTQRETLVVGVKNNLWQNGRACGRRY --- α-hanp SLRRSSCFGGR--MDRIGAQSGLGCN----SFRY **:*:* : :*.:..* * ** AtPNP-A(35-68) is the biologically active domain of the molecule

13 C β2 β6 β5 β1 N ATPNP-A: MAVKFVVVMIVFAQILAPIAEAAQGKAVYY DPPYTRSACYGTQRETLVVGVKNNLWQNGR ACGRRYRVRCIGATYNFDRACTGRTVDVKV VDFCREPCNGDLNLSRDAFRVIANTDAGNI RVVYTP β3 β4 Six stranded β-barrel structure with two ψ loops

14 PNPs in an evolutionary context

15 Index 6 M. trunculata Index 8 G. max AtPNP-B A. thaliana PNP-A Index 5 M. trunculata Index 4 O. sativa CjBAp12 C. jambhiri PNP-B AtPNP-A A. thaliana Index 1 O. sativa Index 2 O. sativa Indices 3 & 7 O. sativa β expansin A. thaliana α expansin N. tabacum α expansin T. vesicolor β-expansin β expansin O. sativa β expansin A. lentiformis α expansin R. diphyllum α expansin O. sativa α expansin M. quadrifolia α expansin β expansin O. sativa 0. 1

16 Hypothesis: A highly expressed class of molecules that perform an extracellular function have been recruited for a role in homeostasis

17 N Intron Intron C Expansins GH45 domain Cellulose-binding domain N C PNP-like molecules - Expansins have no glucanase activity - Glucanases have no expansin activity - p12 (PNP) has no expansin activity - PNPs are mobile molecules

18 Ancestral molecule has hydrolytic activity on Wall substrate Loss of hydrolytic activity Intron Intron Intron N C N C GH45 domain CB domain GH45 domain - Wall remains the substrate - CB domain restricts mobility - Cell membrane is the substrate - Absence of a CB domain increases mobility Expansins PNPs Both classes of molecules are extra cytosolic & may cooperate in cell elongation growth

19 Defining the biological role of PNP-like molecules in planta

20 In situ localisation of PNPs in conductive tissue (a) (b) (c) Indication of systemic action

21 In situ tissue print with anti-hanp and anti-pnp A vb B ph pith x ep C vb D vb A. Cut through ivy petiole; x - xylem, ph - phloem, ep - epidermis, vb - vascular bundle B. Detail C. Incubation o/n with anti-hanp Ab D. Incubation o/n with anti-pnp Ab

22 PNP is localised in the conductive tissue PNP extracted from the xylem is biologicaly active The molecular structure and systemic action are compatible

23 We would expect NPs to affect ion transport Directly: e.g. by forming or modifying channels or affecting pumps Indirectly: By mobilizing 2 nd messengers that affect (gate) channels or affect pumps

24 Time course of PNP-dependent cgmp levels in the root stele of Zea mays cgmp (fmol / mg fresh weight) Time (min): control

25 Recombinant AtPNP-A modulates H + fluxes in A.t. roots 2 1 in Average H + fluxes in elongation zone Average H + fluxes in mature region Net H + fluxes in nmoles m -2 s Net flux out Net H + fluxes (nmoles m -2 s -1) Min.: Time (min) Net H + fluxes in nmoles m -2 s ` Time (min) in Net flux out

26 AtPNP-A modulates K + and Na + fluxes in A.t. roots Net K + fluxes in nmoles m -2 s -1 Net K + fluxes in nmoles m -2 s -1 Average K + flux in the elongation zone in Net flux out Time (min) Average K + flux in the mature zone in Net flux out Time (min) Net Na + fluxes in nmoles m -2 s -1 Net Na + fluxes in nmoles m -2 s Time (min) Average Na + flux in the elongation zone Average Na + flux in the mature zone Average Na flux Time (min)

27 Towards a key discovery

28 Monitoring osmotically induced volume changes in mesophyll cell protoplasts Absorbance ( nm) Time (min) 0.2 M 0.4 M 0.6 M MCP diameter in µm Sorbitol conc. (M) 0.2 M 0.4 M 0.6 M Sorbitol 40 µm

29 AtPNP-A modulates osmoticum-dependent volume changes in MCPs Mean Protoplast Volume (µm 3 ) AtPNP-A: cyclohex. : (µg/ml) AtPNP-A drives H 2 O uptake even under osmotically unfavourable conditions

30 All AtPNP-A dependent processes discovered to date are relevant to plant homeostasis and growth

31 PNP functions - known to date: H + Plasmalemma ATP ADP + P i K + Na + K +, Na + K + K IR PNP PNP H + Cl - ΔH + PNP PNP GTP cgmp PNP PNP guanylate cyclase domain Comp. Sol. Synth. H 2 O low affinity cation transporter

32 In search of a biological role for PNPs WT KO Comp Control 50 mm NaCl

33 Insights from whole plant physiology

34

35 Temperature dependence of systemic is indicative for phloem transport

36

37 Meier, S., Bastian, R., Donaldson, L., Murray, S., Bajic, V. and Gehring, C. Co-expression and promoter content analyses assign a role in biotic and abiotic stress responses to plant natriuretic peptides. BMC Plant Biol. (2008) 8, 24

38 Meier, S. and Gehring, C. A guide to the integrated application of on-line data mining tools for the inference of gene functions at the systems level. Biotech. J. (2008) DOI: /biot

39 A surprising finding

40 A bacterium with a plant-like peptide A.thaliana X.axonopodis A.thaliana X.axonopodis A.thaliana X.axonopodis --MAVKFVVVM----IVFAQILAPIAEAAQGKAVYYDPPYTR-----SAC MGIVMKHKILLGFSVAAIGLLFSSAAFADIGTISFYGNNARRPADLVQGC :.:*. :::.:. :::. * * *. :*. *..* YG-----TQRETLVVGVKNNLWQNGRACGRRYRVRCIGATYNFDRACTGR NVPEDQVSGRNYQVVTVSDGLWDNGASCGRRYRMRCISTPVKHS--CTAS : *: ** *.:.**:** :******:***.:. :.. **. TVDVKVVDFCREPCNGDLNLSRDAFRVIANTDAGNIRVVYTP---- TIDVIVVGRCPN-GRCTVGGRDVTMKIAFNRYSLLVQARTAPWANI *:** **. * :. :. :::: * : ::. :*

41 A HYPOTHESIS: Molecular mimicry of a signalling molecule may permit pathogen control of plant homeostasis

42 XacPNP works in plants

43 XacPNP induction by apoplast-like conditions

44 XacPNP weakens host defense

45 Out-look: Structural and functional characterisation of recombinant molecules Search of the PNP receptor Applications of PNPs in rational approaches to increasing abiotic stress tolerance

46

AP Biology Chapter 36

AP Biology Chapter 36 Chapter 36 Chapter 36 Transport in Plants 2006-2007 Transport in plants - Overview H2O & minerals transport in xylem transpiration evaporation, adhesion & cohesion negative pressure Sugars transport in

More information

Hort Chapter 10 MENGEL et al, 5th Ed

Hort Chapter 10 MENGEL et al, 5th Ed Hort 5504 POTASSIUM Chapter 10 MENGEL et al, 5th Ed POTASSIUM CYCLE 1 SOIL POTASSIUM K minerals and K release ~2-3% of earth s crust is K K tied to clay particles (< 2 µm size) Frequently soils high in

More information

NOTES: CH 36 - Transport in Plants

NOTES: CH 36 - Transport in Plants NOTES: CH 36 - Transport in Plants Recall that transport across the cell membrane of plant cells occurs by: -diffusion -facilitated diffusion -osmosis (diffusion of water) -active transport (done by transport

More information

Chapter 36: Transport in Vascular Plants - Pathways for Survival

Chapter 36: Transport in Vascular Plants - Pathways for Survival Chapter 36: Transport in Vascular Plants - Pathways for Survival For vascular plants, the evolutionary journey onto land involved differentiation into roots and shoots Vascular tissue transports nutrients

More information

23-. Shoot and root development depend on ratio of IAA/CK

23-. Shoot and root development depend on ratio of IAA/CK Balance of Hormones regulate growth and development Environmental factors regulate hormone levels light- e.g. phototropism gravity- e.g. gravitropism temperature Mode of action of each hormone 1. Signal

More information

DNA or RNA metabolism (1%) Signal transduction (2%) Development (2%) Other cellular processes (17%)

DNA or RNA metabolism (1%) Signal transduction (2%) Development (2%) Other cellular processes (17%) Fig. 35-24 Other metabolism (18%) DNA or RNA metabolism (1%) Signal transduction (2%) Development (2%) Unknown (24%) Energy pathways (3%) Cell division and organization (3%) Transport (4%) Transcription

More information

Transport in Plants (Ch. 23.5)

Transport in Plants (Ch. 23.5) Transport in Plants (Ch. 23.5) Transport in plants H 2 O & minerals transport in xylem Transpiration Adhesion, cohesion & Evaporation Sugars transport in phloem bulk flow Gas exchange photosynthesis CO

More information

Module Membrane Biogenesis and Transport Lecture 15 Ion Channels Dale Sanders

Module Membrane Biogenesis and Transport Lecture 15 Ion Channels Dale Sanders Module 0220502 Membrane Biogenesis and Transport Lecture 15 Ion Channels Dale Sanders 9 March 2009 Aims: By the end of the lecture you should understand The principles behind the patch clamp technique;

More information

Cytokinin. Fig Cytokinin needed for growth of shoot apical meristem. F Cytokinin stimulates chloroplast development in the dark

Cytokinin. Fig Cytokinin needed for growth of shoot apical meristem. F Cytokinin stimulates chloroplast development in the dark Cytokinin Abundant in young, dividing cells Shoot apical meristem Root apical meristem Synthesized in root tip, developing embryos, young leaves, fruits Transported passively via xylem into shoots from

More information

Chapter 39. Plant Response. AP Biology

Chapter 39. Plant Response. AP Biology Chapter 39. Plant Response 1 Plant Reactions Stimuli & a Stationary Life u animals respond to stimuli by changing behavior move toward positive stimuli move away from negative stimuli u plants respond

More information

Chapter 36~ Transport in Plants

Chapter 36~ Transport in Plants Chapter 36~ Transport in Plants Structural Features Used for Resource Acquistion Roots and stems to do transport of resources Diffusion, active transport, and bulk flow Work in vascular plants to transport

More information

Chapter 35 Regulation and Transport in Plants

Chapter 35 Regulation and Transport in Plants Chapter 35 Regulation and Remember what plants need Photosynthesis light reactions Calvin cycle light sun H 2 O ground CO 2 air What structures have plants evolved to supply these needs? Interdependent

More information

Host-Pathogen Interaction. PN Sharma Department of Plant Pathology CSK HPKV, Palampur

Host-Pathogen Interaction. PN Sharma Department of Plant Pathology CSK HPKV, Palampur Host-Pathogen Interaction PN Sharma Department of Plant Pathology CSK HPKV, Palampur-176062 PATHOGEN DEFENCE IN PLANTS A BIOLOGICAL AND MOLECULAR VIEW Two types of plant resistance response to potential

More information

cytosol stroma Photorespiration: Ribulose bisphosphate carboxylase/oxygenase (Rubisco) Ribulose bisphosphate carboxylase/oxygenase (Rubisco)

cytosol stroma Photorespiration: Ribulose bisphosphate carboxylase/oxygenase (Rubisco) Ribulose bisphosphate carboxylase/oxygenase (Rubisco) Carbon Reactions: CO 2 is fixed by Rubisco located in the stroma. The molecule that is carboxylated is RuBP. RuBP has 5 carbons and is regenerated in the Calvin cycle. In the Calvin cycle, carbon is conserved,

More information

Questions: Properties of excitable tissues Transport across cell membrane Resting potential Action potential Excitability change at excitation

Questions: Properties of excitable tissues Transport across cell membrane Resting potential Action potential Excitability change at excitation Questions: Properties of excitable tissues Transport across cell membrane Resting potential Action potential Excitability change at excitation EXCITABLE TISSUES The tissues can change the properties under

More information

Biology 213 Exam 3 Practice Key

Biology 213 Exam 3 Practice Key Biology 213 Practice Key 1. (4) Explain the difference between a macronutrient and a micronutrient and cite two examples of each category? Macronutrients are the minerals needed by the plant in greater

More information

Please sit next to a partner. you are an A or a B

Please sit next to a partner. you are an A or a B Please sit next to a partner you are an A or a B Plants Transport in Vascular Plants Transport Overview Vascular tissue transports nutrients throughout a plant Such transport may occur over long distances

More information

Compartments and Transport. Three Major Pathways of Transport. Absorp+on of Water and Minerals by Root Cells. Bulk flow

Compartments and Transport. Three Major Pathways of Transport. Absorp+on of Water and Minerals by Root Cells. Bulk flow Plasmodesmata Channels connec+ng neighboring cells Cell membrane and cytosol are con+nuous from cell to cell Symplast Cytoplasmic con+nuum Apoplast Compartments and Transport Through plasmodesmata con+nuum

More information

TREES. Functions, structure, physiology

TREES. Functions, structure, physiology TREES Functions, structure, physiology Trees in Agroecosystems - 1 Microclimate effects lower soil temperature alter soil moisture reduce temperature fluctuations Maintain or increase soil fertility biological

More information

Advanced Higher Biology. Unit 1- Cells and Proteins 2c) Membrane Proteins

Advanced Higher Biology. Unit 1- Cells and Proteins 2c) Membrane Proteins Advanced Higher Biology Unit 1- Cells and Proteins 2c) Membrane Proteins Membrane Structure Phospholipid bilayer Transmembrane protein Integral protein Movement of Molecules Across Membranes Phospholipid

More information

RuBP has 5 carbons and is regenerated in the Calvin cycle. In the Calvin cycle, carbon is conserved, ATP is used and NADPH is used.

RuBP has 5 carbons and is regenerated in the Calvin cycle. In the Calvin cycle, carbon is conserved, ATP is used and NADPH is used. Carbon Reactions: CO 2 is fixed by Rubisco located in the stroma. The molecule that is carboxylated is RuBP. RuBP has 5 carbons and is regenerated in the Calvin cycle. In the Calvin cycle, carbon is conserved,

More information

SECOND PUBLIC EXAMINATION. Honour School of Physics Part C: 4 Year Course. Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS

SECOND PUBLIC EXAMINATION. Honour School of Physics Part C: 4 Year Course. Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS 2757 SECOND PUBLIC EXAMINATION Honour School of Physics Part C: 4 Year Course Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS TRINITY TERM 2013 Monday, 17 June, 2.30 pm 5.45 pm 15

More information

Plant Stimuli pp Topic 3: Plant Behaviour Ch. 39. Plant Behavioural Responses. Plant Hormones. Plant Hormones pp

Plant Stimuli pp Topic 3: Plant Behaviour Ch. 39. Plant Behavioural Responses. Plant Hormones. Plant Hormones pp Topic 3: Plant Behaviour Ch. 39 Plants exist in environments that are constantly changing. Like animals, plants must be able to detect and react to stimuli in the environment. Unlike animals, plants can

More information

There should be nothing new for you in this lecture. If there is, stay for office hours and / or ask for help from the TAs.

There should be nothing new for you in this lecture. If there is, stay for office hours and / or ask for help from the TAs. Membranes 02 The goal of this lecture is to review pre-requisite material related to the structure and function of biological membranes and to provide students a further overview of material to be covered

More information

Transport in Plants Notes AP Biology Mrs. Laux 3 levels of transport occur in plants: 1. Uptake of water and solutes by individual cells -for

Transport in Plants Notes AP Biology Mrs. Laux 3 levels of transport occur in plants: 1. Uptake of water and solutes by individual cells -for 3 levels of transport occur in plants: 1. Uptake of water and solutes by individual cells -for photosynthesis and respiration -ex: absorption of H 2 O /minerals by root hairs 2. Short distance cell-to-cell

More information

Membrane transport 1. Summary

Membrane transport 1. Summary Membrane transport 1. Summary A. Simple diffusion 1) Diffusion by electrochemical gradient no energy required 2) No channel or carrier (or transporter protein) is needed B. Passive transport (= Facilitated

More information

2014 Pearson Education, Inc. 1

2014 Pearson Education, Inc. 1 1 CO 2 O 2 Light Sugar O 2 and minerals CO 2 2 Buds 42 29 21 34 13 26 5 18 10 31 23 8 15 28 16 2 24 Shoot apical meristem 7 3 20 1 mm 32 11 19 12 6 4 1 25 17 14 9 40 27 22 3 Cell wall Apoplastic route

More information

Transport of glucose across epithelial cells: a. Gluc/Na cotransport; b. Gluc transporter Alberts

Transport of glucose across epithelial cells: a. Gluc/Na cotransport; b. Gluc transporter Alberts Figure 7 a. Secondary transporters make up the largest subfamily of transport proteins. TAGI 2000. Nature 408, 796 1. Na+- or H+-coupled cotransporters - Secondary active transport 2/7-02 Energy released

More information

Electrical Properties of the Membrane

Electrical Properties of the Membrane BIOE 2520 Electrical Properties of the Membrane Reading: Chapter 11 of Alberts et al. Stephen Smith, Ph.D. 433 Biotech Center shs46@pitt.edu Permeability of Lipid membrane Lipid bilayer is virtually impermeable

More information

Organs and leaf structure

Organs and leaf structure Organs and leaf structure Different types of tissues are arranged together to form organs. Structure: 2 parts (Petiole and Leaf Blade) Thin flat blade, large surface area Leaves contain all 3 types of

More information

Biology Slide 1 of 36

Biology Slide 1 of 36 Biology 1 of 36 2 of 36 Types of Roots Types of Roots What are the two main types of roots? 3 of 36 Types of Roots The two main types of roots are: taproots, which are found mainly in dicots, and fibrous

More information

Figure 1. Identification of UGT74E2 as an IBA glycosyltransferase. (A) Relative conversion rates of different plant hormones to their glucosylated

Figure 1. Identification of UGT74E2 as an IBA glycosyltransferase. (A) Relative conversion rates of different plant hormones to their glucosylated Figure 1. Identification of UGT74E2 as an IBA glycosyltransferase. (A) Relative conversion rates of different plant hormones to their glucosylated form by recombinant UGT74E2. The naturally occurring auxin

More information

Chapter 4-2. Transpiration diffusion of water vapor

Chapter 4-2. Transpiration diffusion of water vapor Chapter 4-2 Transpiration diffusion of water vapor Transpiration diffusion of water vapor Diffusion is primary means of any further movement of the water out of the leaf. That is water movement is controlled

More information

Transport in Plants AP Biology

Transport in Plants AP Biology Transport in Plants 2006-2007 Water & mineral absorption Water absorption from soil osmosis aquaporins Mineral absorption active transport proton pumps active transport of H + aquaporin root hair proton

More information

Energy and Cells. Appendix 1. The two primary energy transformations in plants are photosynthesis and respiration.

Energy and Cells. Appendix 1. The two primary energy transformations in plants are photosynthesis and respiration. Energy and Cells Appendix 1 Energy transformations play a key role in all physical and chemical processes that occur in plants. Energy by itself is insufficient to drive plant growth and development. Enzymes

More information

C MPETENC EN I C ES LECT EC UR U E R

C MPETENC EN I C ES LECT EC UR U E R LECTURE 7: SUGAR TRANSPORT COMPETENCIES Students, after mastering the materials of Plant Physiology course, should be able to: 1. To explain the pathway of sugar transport in plants 2. To explain the mechanism

More information

23 2 Roots Slide 2 of 36

23 2 Roots Slide 2 of 36 2 of 36 Types of Roots Types of Roots What are the two main types of roots? 3 of 36 Types of Roots The two main types of roots are: taproots, which are found mainly in dicots, and fibrous roots, which

More information

OCR (A) Biology A-level

OCR (A) Biology A-level OCR (A) Biology A-level Topic 3.3: Transport in plants Notes Plants require a transport system to ensure that all the cells of a plant receive a sufficient amount of nutrients. This is achieved through

More information

Enduring understanding 1.A: Change in the genetic makeup of a population over time is evolution.

Enduring understanding 1.A: Change in the genetic makeup of a population over time is evolution. The AP Biology course is designed to enable you to develop advanced inquiry and reasoning skills, such as designing a plan for collecting data, analyzing data, applying mathematical routines, and connecting

More information

Transport in Vascular Plants

Transport in Vascular Plants Chapter 36 Transport in Vascular Plants PowerPoint Lectures for Biology, Seventh Edition Neil Campbell and Jane Reece Lectures by Chris Romero Vascular tissue Transports nutrients throughout a plant; such

More information

Bald cypress Taxodium distichum in a swamp in North Carolina

Bald cypress Taxodium distichum in a swamp in North Carolina Bald cypress Taxodium distichum in a swamp in North Carolina Bald cypress is another deciduous gymnosperm. It is native to the SE United States. It can tolerate a wide range of soil conditions. It is not

More information

Plant Structure and Function

Plant Structure and Function Plant Structure and Function A Meridian Biology AP Study Guide by John Ho and Tim Qi Plant Terms Growth: Growth Types Type Location Description Primary Primary Vertical growth (up-down), dominant direction

More information

Chapter 36. Transport in Vascular Plants

Chapter 36. Transport in Vascular Plants Chapter 36 Transport in Vascular Plants Overview: Pathways for Survival For vascular plants The evolutionary journey onto land involved the differentiation of the plant body into roots and shoots Vascular

More information

Membranes 2: Transportation

Membranes 2: Transportation Membranes 2: Transportation Steven E. Massey, Ph.D. Associate Professor Bioinformatics Department of Biology University of Puerto Rico Río Piedras Office & Lab: NCN#343B Tel: 787-764-0000 ext. 7798 E-mail:

More information

Overview of ion channel proteins. What do ion channels do? Three important points:

Overview of ion channel proteins. What do ion channels do? Three important points: Overview of ion channel proteins Protein Structure Membrane proteins & channels Specific channels Several hundred distinct types Organization Evolution We need to consider 1. Structure 2. Functions 3.

More information

CHAPTER TRANSPORT

CHAPTER TRANSPORT CHAPTER 2 2.4 TRANSPORT Uptake of CO2 FOCUS: Uptake and transport of water and mineral salts Transport of organic substances Physical forces drive the transport of materials in plants over a range of distances

More information

Chapter 17. From Gene to Protein. Biology Kevin Dees

Chapter 17. From Gene to Protein. Biology Kevin Dees Chapter 17 From Gene to Protein DNA The information molecule Sequences of bases is a code DNA organized in to chromosomes Chromosomes are organized into genes What do the genes actually say??? Reflecting

More information

Movement of water and solutes in plants Chapter 4 and 30

Movement of water and solutes in plants Chapter 4 and 30 Movement of water and solutes in plants Chapter 4 and 30 Molecular Movement Diffusion Molecules or ions moving in the opposite direction = movement against a diffusion gradient. Rates of diffusion are

More information

Chapt. 12, Movement Across Membranes. Chapt. 12, Movement through lipid bilayer. Chapt. 12, Movement through lipid bilayer

Chapt. 12, Movement Across Membranes. Chapt. 12, Movement through lipid bilayer. Chapt. 12, Movement through lipid bilayer Chapt. 12, Movement Across Membranes Two ways substances can cross membranes Passing through the lipid bilayer Passing through the membrane as a result of specialized proteins 1 Chapt. 12, Movement through

More information

2014 Pearson Education, Inc. 1. Light. Sugar O 2 H 2 O. and minerals CO Pearson Education, Inc.

2014 Pearson Education, Inc. 1. Light. Sugar O 2 H 2 O. and minerals CO Pearson Education, Inc. 1 CO 2 O 2 Light ugar O 2 and minerals CO 2 2 Buds 34 42 29 26 31 18 21 13 5 10 23 8 15 28 16 24 hoot apical meristem 2 7 3 20 32 11 19 12 6 4 1 25 17 14 9 40 27 22 1 mm 3 Cell wall Apoplastic route Cytosol

More information

CELL SIGNALLING and MEMBRANE TRANSPORT. Mark Louie D. Lopez Department of Biology College of Science Polytechnic University of the Philippines

CELL SIGNALLING and MEMBRANE TRANSPORT. Mark Louie D. Lopez Department of Biology College of Science Polytechnic University of the Philippines CELL SIGNALLING and MEMBRANE TRANSPORT Mark Louie D. Lopez Department of Biology College of Science Polytechnic University of the Philippines GENERIC SIGNALLING PATHWAY CELL RESPONSE TO SIGNALS CELL RESPONSE

More information

Visual pigments. Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2019

Visual pigments. Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2019 Visual pigments Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2019 References Webvision: The Organization of the Retina and Visual System (http://www.ncbi.nlm.nih.gov/books/nbk11522/#a 127) The

More information

Translocation 11/30/2010. Translocation is the transport of products of photosynthesis, mainly sugars, from mature leaves to areas of growth and

Translocation 11/30/2010. Translocation is the transport of products of photosynthesis, mainly sugars, from mature leaves to areas of growth and Translocation Translocation is the transport of products of photosynthesis, mainly sugars, from mature leaves to areas of growth and storage. Phloem is the tissue through which translocation occurs. Sieve

More information

AP Biology Essential Knowledge Cards BIG IDEA 1

AP Biology Essential Knowledge Cards BIG IDEA 1 AP Biology Essential Knowledge Cards BIG IDEA 1 Essential knowledge 1.A.1: Natural selection is a major mechanism of evolution. Essential knowledge 1.A.4: Biological evolution is supported by scientific

More information

Resource acquisition and transport in vascular plants

Resource acquisition and transport in vascular plants Resource acquisition and transport in vascular plants Overview of what a plant does Chapter 36 CO 2 O 2 O 2 and and CO 2 CO 2 O 2 Sugar Light Shoots are optimized to capture light and reduce water loss

More information

AP Biology. Transport in plants. Chapter 36. Transport in Plants. Transport in plants. Transport in plants. Transport in plants. Transport in plants

AP Biology. Transport in plants. Chapter 36. Transport in Plants. Transport in plants. Transport in plants. Transport in plants. Transport in plants Chapter 36. Transport in Plants evaporation, adhesion & cohesion negative pressure evaporation, adhesion & cohesion negative pressure transport in phloem bulk flow Calvin cycle in leaves loads sucrose

More information

! E EUKARYOTE CYTOLOGY INTERCELLULAR SPACE MIDDLE LAMELLA PEROXISOME PLASMODESMATA VACUOLE CYTOSOL CELL WALL GOLGI BODY MIDDLE LAMELLA NUCLEUS

! E EUKARYOTE CYTOLOGY INTERCELLULAR SPACE MIDDLE LAMELLA PEROXISOME PLASMODESMATA VACUOLE CYTOSOL CELL WALL GOLGI BODY MIDDLE LAMELLA NUCLEUS EUKARYOTE CYTOLOGY INTERCELLULAR SPACE! E PEROXISOME VACUOLE CELL WALL MIDDLE LAMELLA CHLOROPLAST CYTOPLASMIC STRAND CYTOSOL CELL MEMBRANE MIDDLE LAMELLA PLASMODESMATA CYTOSOL GOLGI BODY NUCLEUS MITOCHONDRION

More information

Big Idea 1: The process of evolution drives the diversity and unity of life.

Big Idea 1: The process of evolution drives the diversity and unity of life. Big Idea 1: The process of evolution drives the diversity and unity of life. understanding 1.A: Change in the genetic makeup of a population over time is evolution. 1.A.1: Natural selection is a major

More information

AP Curriculum Framework with Learning Objectives

AP Curriculum Framework with Learning Objectives Big Ideas Big Idea 1: The process of evolution drives the diversity and unity of life. AP Curriculum Framework with Learning Objectives Understanding 1.A: Change in the genetic makeup of a population over

More information

CONTROL OF GROWTH BY HORMONES

CONTROL OF GROWTH BY HORMONES CONTROL OF GROWTH BY HORMONES Growth and organogenesis are controlled......by genes (independent of environment): e.g., number of primary vascular bundles, general shape of a leaf or flower...by genes

More information

CONTROL OF PLANT GROWTH AND DEVELOPMENT BI-2232 RIZKITA R E

CONTROL OF PLANT GROWTH AND DEVELOPMENT BI-2232 RIZKITA R E CONTROL OF PLANT GROWTH AND DEVELOPMENT BI-2232 RIZKITA R E The development of a plant the series of progressive changes that take place throughout its life is regulated in complex ways. Factors take part

More information

Membrane Protein Channels

Membrane Protein Channels Membrane Protein Channels Potassium ions queuing up in the potassium channel Pumps: 1000 s -1 Channels: 1000000 s -1 Pumps & Channels The lipid bilayer of biological membranes is intrinsically impermeable

More information

Water Relations in Viticulture BRIANNA HOGE AND JIM KAMAS

Water Relations in Viticulture BRIANNA HOGE AND JIM KAMAS Water Relations in Viticulture BRIANNA HOGE AND JIM KAMAS Overview Introduction Important Concepts for Understanding water Movement through Vines Osmosis Water Potential Cell Expansion and the Acid Growth

More information

Receptors and Ion Channels

Receptors and Ion Channels Receptors and Ion Channels Laurie Kellaway Senior Lecturer Department of Human Biology Laurie@curie.uct.ac.za Tel. +27 +21 4066 271 What are the two types of Neurotransmitter receptors Ionotropic receptors

More information

Marine Resources Development Foundation/MarineLab Grades: 9, 10, 11, 12 States: AP Biology Course Description Subjects: Science

Marine Resources Development Foundation/MarineLab Grades: 9, 10, 11, 12 States: AP Biology Course Description Subjects: Science Marine Resources Development Foundation/MarineLab Grades: 9, 10, 11, 12 States: AP Biology Course Description Subjects: Science Highlighted components are included in Tallahassee Museum s 2016 program

More information

CHAPTER 32 TRANSPORT IN PLANTS OUTLINE OBJECTIVES

CHAPTER 32 TRANSPORT IN PLANTS OUTLINE OBJECTIVES CHAPTER 32 TRANSPORT IN PLANTS OUTLINE I. The traffic of water and solutes occurs on cellular, organ, and whole-plant levels: an overview of transport in plants A. Transport at the Cellular Level B. Short

More information

Introduction to Physiology II: Control of Cell Volume and Membrane Potential

Introduction to Physiology II: Control of Cell Volume and Membrane Potential Introduction to Physiology II: Control of Cell Volume and Membrane Potential J. P. Keener Mathematics Department Math Physiology p.1/23 Basic Problem The cell is full of stuff: Proteins, ions, fats, etc.

More information

Figure 18.1 Blue-light stimulated phototropism Blue light Inhibits seedling hypocotyl elongation

Figure 18.1 Blue-light stimulated phototropism Blue light Inhibits seedling hypocotyl elongation Blue Light and Photomorphogenesis Q: Figure 18.3 Blue light responses - phototropsim of growing Corn Coleoptile 1. How do we know plants respond to blue light? 2. What are the functions of multiple BL

More information

Homework for Monday: Correct potometer questions Complete transport in plants worksheet

Homework for Monday: Correct potometer questions Complete transport in plants worksheet Transport in plants Homework for Monday: Correct potometer questions Complete transport in plants worksheet Transpiration the loss of water from a plant through evaporation Did you know? A 15m maple tree

More information

A A A A B B1

A A A A B B1 LEARNING OBJECTIVES FOR EACH BIG IDEA WITH ASSOCIATED SCIENCE PRACTICES AND ESSENTIAL KNOWLEDGE Learning Objectives will be the target for AP Biology exam questions Learning Objectives Sci Prac Es Knowl

More information

POTASSIUM IN PLANT GROWTH AND YIELD. by Ismail Cakmak Sabanci University Istanbul, Turkey

POTASSIUM IN PLANT GROWTH AND YIELD. by Ismail Cakmak Sabanci University Istanbul, Turkey POTASSIUM IN PLANT GROWTH AND YIELD by Ismail Cakmak Sabanci University Istanbul, Turkey Low K High K High K Low K Low K High K Low K High K Control K Deficiency Cakmak et al., 1994, J. Experimental Bot.

More information

Visual pigments. Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2015

Visual pigments. Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2015 Visual pigments Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2015 References Photoreceptors and visual pigments Webvision: The Organization of the Retina and Visual System (http://www.ncbi.nlm.nih.gov/books/nbk11522/#a127)

More information

Photosynthesis: Life from Light and Air. Regents Biology

Photosynthesis: Life from Light and Air. Regents Biology Photosynthesis: Life from Light and Air Plants are energy producers Like animals, plants need energy to live unlike animals, plants don t need to eat food to make that energy Plants make both FOOD & ENERGY

More information

Identification number: TÁMOP /1/A

Identification number: TÁMOP /1/A Manifestation of Novel Social Challenges of the European Union in the Teaching Material of Medical Biotechnology Master s Programmes at the University of Pécs and at the University of Debrecen Identification

More information

Essential knowledge 1.A.2: Natural selection

Essential knowledge 1.A.2: Natural selection Appendix C AP Biology Concepts at a Glance Big Idea 1: The process of evolution drives the diversity and unity of life. Enduring understanding 1.A: Change in the genetic makeup of a population over time

More information

Resource Acquisition and Transport in Vascular Plants

Resource Acquisition and Transport in Vascular Plants Chapter 36 Resource Acquisition and Transport in Vascular Plants PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley

More information

Biology 1030 Winter 2009

Biology 1030 Winter 2009 Meeting Tissue Needs II Chapter 36 (738-755) Chapter 37 (756-770) Cellular Currency Plants harvest solar energy Photosynthesis Produces sugars Proteins, nucleic acids, lipids? H 2 O CO 2 Plants cells still

More information

(by Ken Robinson, revised 2009 by NPelaez)

(by Ken Robinson, revised 2009 by NPelaez) Biology 13100 (by Ken Robinson, revised 2009 by NPelaez) The Transport of Water in Higher Plants, and Ca 2+ as Cellular Regulator (including problem set 3) The movement of water across a cell membrane

More information

Statistical mechanics of biological processes

Statistical mechanics of biological processes Statistical mechanics of biological processes 1 Modeling biological processes Describing biological processes requires models. If reaction occurs on timescales much faster than that of connected processes

More information

Stomata and water fluxes through plants

Stomata and water fluxes through plants Stomata and water fluxes through plants Bill Davies The Lancaster Environment Centre, UK Summary Stomata and responses to the environment Conductance, a function of frequency and aperture Measuring/estimating

More information

Importance of Protein sorting. A clue from plastid development

Importance of Protein sorting. A clue from plastid development Importance of Protein sorting Cell organization depend on sorting proteins to their right destination. Cell functions depend on sorting proteins to their right destination. Examples: A. Energy production

More information

Membrane Protein Pumps

Membrane Protein Pumps Membrane Protein Pumps Learning objectives You should be able to understand & discuss: Active transport-na + /K + ATPase ABC transporters Metabolite transport by lactose permease 1. Ion pumps: ATP-driven

More information

Molecular Cell Biology 5068 In Class Exam 2 November 8, 2016

Molecular Cell Biology 5068 In Class Exam 2 November 8, 2016 Molecular Cell Biology 5068 In Class Exam 2 November 8, 2016 Exam Number: Please print your name: Instructions: Please write only on these pages, in the spaces allotted and not on the back. Write your

More information

CELLS NOT YOUR CELL PHONE HOMEOSTASIS: LESSON 5 OVERVIEW TEKS

CELLS NOT YOUR CELL PHONE HOMEOSTASIS: LESSON 5 OVERVIEW TEKS Lesson 5: Active Transport Protein Pumps Objectives: In this lesson the student will: CELLS NOT YOUR CELL PHONE HOMEOSTASIS: LESSON 5 OVERVIEW 1. Identify how the unique structure of the cell membrane

More information

1. What is the source of the oxygen released into the air as a product of photosynthesis? D. Both water and carbon dioxide (Total 1 mark)

1. What is the source of the oxygen released into the air as a product of photosynthesis? D. Both water and carbon dioxide (Total 1 mark) 2.9 Photosynthesis Paper 1 Possible Mult Choice Questions 1. What is the source of the oxygen released into the air as a product of photosynthesis? A. Chlorophyll B. Carbon dioxide only C. Water only D.

More information

Valley Central School District 944 State Route 17K Montgomery, NY Telephone Number: (845) ext Fax Number: (845)

Valley Central School District 944 State Route 17K Montgomery, NY Telephone Number: (845) ext Fax Number: (845) Valley Central School District 944 State Route 17K Montgomery, NY 12549 Telephone Number: (845)457-2400 ext. 18121 Fax Number: (845)457-4254 Advance Placement Biology Presented to the Board of Education

More information

CBSE Quick Revision Notes (Class-11 Biology) CHAPTER-11 TRANSPORT IN PLANTS

CBSE Quick Revision Notes (Class-11 Biology) CHAPTER-11 TRANSPORT IN PLANTS CBSE Quick Revision Notes (Class-11 Biology) CHAPTER-11 TRANSPORT IN PLANTS Plant transport various substance like gases, minerals, water, hormones, photosynthetes and organic solutes to short distance

More information

Part I => CARBS and LIPIDS. 1.5 MEMBRANE TRANSPORT 1.5a Passive Transport 1.5b Facilitated Transport 1.5c Active Transport

Part I => CARBS and LIPIDS. 1.5 MEMBRANE TRANSPORT 1.5a Passive Transport 1.5b Facilitated Transport 1.5c Active Transport Part I => CARBS and LIPIDS 1.5 MEMBRANE TRANSPORT 1.5a Passive Transport 1.5b Facilitated Transport 1.5c Active Transport Section 1.5a: Passive Transport Synopsis 1.5a - Passive transport (or passive diffusion)

More information

Neurophysiology. Danil Hammoudi.MD

Neurophysiology. Danil Hammoudi.MD Neurophysiology Danil Hammoudi.MD ACTION POTENTIAL An action potential is a wave of electrical discharge that travels along the membrane of a cell. Action potentials are an essential feature of animal

More information

Biology Exam #1 Study Guide. True/False Indicate whether the statement is true or false. F 1. All living things are composed of many cells.

Biology Exam #1 Study Guide. True/False Indicate whether the statement is true or false. F 1. All living things are composed of many cells. Biology Exam #1 Study Guide True/False Indicate whether the statement is true or false. F 1. All living things are composed of many cells. T 2. Membranes are selectively permeable if they allow only certain

More information

Chapter 12 & 13 Transport, Soil and Mineral Nutrition

Chapter 12 & 13 Transport, Soil and Mineral Nutrition Chapter 12 & 13 Transport, Soil and Mineral Nutrition Topics Methods of transport Xylem transport Phloem transport Soils properties and nutrient absorption Macro and micro essential nutrient elements Too

More information

Muscle regulation and Actin Topics: Tropomyosin and Troponin, Actin Assembly, Actin-dependent Movement

Muscle regulation and Actin Topics: Tropomyosin and Troponin, Actin Assembly, Actin-dependent Movement 1 Muscle regulation and Actin Topics: Tropomyosin and Troponin, Actin Assembly, Actin-dependent Movement In the last lecture, we saw that a repeating alternation between chemical (ATP hydrolysis) and vectorial

More information

1. (a) Why are the two kinds of self-incompatibiltiy (SI) mechanisms called sporophytic and gametophytic?

1. (a) Why are the two kinds of self-incompatibiltiy (SI) mechanisms called sporophytic and gametophytic? Bio 328 -Spring 2005 NAME: Test #1 Please provide succinct answers in the space provided under each question. Unless otherwise noted in the margin the value of each question is 3 points. 1. (a) Why are

More information

Reception The target cell s detection of a signal coming from outside the cell May Occur by: Direct connect Through signal molecules

Reception The target cell s detection of a signal coming from outside the cell May Occur by: Direct connect Through signal molecules Why Do Cells Communicate? Regulation Cells need to control cellular processes In multicellular organism, cells signaling pathways coordinate the activities within individual cells that support the function

More information

Drug interactions. (Efficacy is a measure of the size of response produced by receptor activation)

Drug interactions. (Efficacy is a measure of the size of response produced by receptor activation) Drug interactions Receptor A signal transducer, modifying cell function in response to an extracellular signal. - Membrane proteins e.g. AChR, - Cytoplasmic proteins e.g. steroid receptors Drugs usually

More information

Signal Transduction Phosphorylation Protein kinases. Misfolding diseases. Protein Engineering Lysozyme variants

Signal Transduction Phosphorylation Protein kinases. Misfolding diseases. Protein Engineering Lysozyme variants Signal Transduction Phosphorylation Protein kinases Misfolding diseases Protein Engineering Lysozyme variants Cells and Signals Regulation The cell must be able to respond to stimuli Cellular activities

More information

Endocrine Physiology. Introduction to Endocrine Principles

Endocrine Physiology. Introduction to Endocrine Principles Endocrine Physiology Introduction to Endocrine Principles There are TWO major groups of hormones Peptide and protein hormones Amine hormones Peptide and protein hormones act through cell membrane receptors

More information

Renal handling of substances. Dr.Charushila Rukadikar Assistance Professor Physiology

Renal handling of substances. Dr.Charushila Rukadikar Assistance Professor Physiology Renal handling of substances Dr.Charushila Rukadikar Assistance Professor Physiology GENERAL PRINCIPLES OF RENAL TUBULAR TRANSPORT Transport mechanisms across cell membrane 1) Passive transport i. Diffusion

More information

The circle and the basics of signal transduction. Course Outline. Topic #! Topic lecture! Silverthorn! Membranes (pre-requisite material)" "

The circle and the basics of signal transduction. Course Outline. Topic #! Topic lecture! Silverthorn! Membranes (pre-requisite material) Homeostasis 03 The goal of this lecture is to discuss the concept of homeostasis and to introduce basic signal transduction mechanisms involved in homeostatic regulation The sections for this lecture are:

More information

Time allowed: 2 hours Answer ALL questions in Section A, ALL PARTS of the question in Section B and ONE question from Section C.

Time allowed: 2 hours Answer ALL questions in Section A, ALL PARTS of the question in Section B and ONE question from Section C. UNIVERSITY OF EAST ANGLIA School of Biological Sciences Main Series UG Examination 2015-2016 FUNDAMENTALS OF CELL BIOLOGY AND BIOCHEMISTRY BIO-4004B Time allowed: 2 hours Answer ALL questions in Section

More information