The Discovery of Plant Natriuretic Peptides. Physiology, molecular biology, systems biology and biotechnology
|
|
- Marcus Black
- 5 years ago
- Views:
Transcription
1 The Discovery of Plant Natriuretic Peptides Physiology, molecular biology, systems biology and biotechnology
2 ANP - ATRIAL NATRIURETIC PEPTIDE ANP is a 28 aa peptide hormone ANP is produced in cardiocytes The targets are the vascular and renal system Some ANP receptors have guanylate cyclase domains NPs play a key role in homeostasis
3 Can vertebrate NPs affect plants? Do plants have a NP-like system? If plants contain NPs, can they affect vertebrates?
4 Stomatal function is a key to homeostasis in higher plants Stomatal opening is achieved by H 2 O uptake preceded by net K + influx which in turn is driven by H + -ATPase-dependent hyperpolarisation. Net H 2 O efflux causes closure and requires net K + efflux usually resulting from depolarisation.
5 First evidence ANP promotes concentration dependent stomatal opening Therefore: ANP must cause net K + (and consequent H 2 O) up-take Second messengers include: - [Ca 2+ ] cyt - [ph] cyt - inositol-1,4,5-trisphosphates - cyclic nucleotides (cgmp)
6 Isolation and identification of Plant Natriuretic Peptides - PNPs
7 - Anti-ANP purifies PNPs a biologically active plant peptide - PNPs modulate H 2 O and ion transport at nanomolar concentrations - PNPs are the first peptidic plant hormones that affect plant homeostasis
8 Structural analysis of PNPs irpnp Marker upper band: p kd 9 kd N-terminus: determined by Edman degradation C-terminus: determined by Mass Spec. - The AA sequence shows a high degree of homology with a blight induced, functionally uncharacterised protein (p12) from citrus
9
10 The molecular structure of PNP-like molecules
11 Citrus p12 MGVGTKVLVITTMAICLISSAAYASEGTATFYTPPYVPSACNGYKNDGVMIAAASYAIWN 60! AtPNP-B ---MSKSIVFFSTVLVFLFSFSYATPGIATFYTS-YTP--CYRGTQEGVMIAAASDTLWD! AtPNP-A --MAVKFVVVMIVFAQILAPIAEAAQGKAVYYDPPYTRSACYG-TQRETLVVGVKNNLWQ! * :*. ::. : *: * *.:*. *. *.:.::... :*:! Citrus p12 AtPNP-B AtPNP-A Citrus p12 AtPNP-B AtPNP-A NGAVCNKSFRVKCTGATNQGTPHPCRGGSVLVKIVDLCPAGCQATIDLSQEAFSQIANPD! NGRVCGKMFTVKCSGPRN-AVPHPCTGKSVKVKIVDHCPSGCASTLDLSREAFAQIANPV! NGRACGRRYRVRCIGATY-NFDRACTGRTVDVKVVDFCREPCNGDLNLSRDAFRVIANTD! **.*.: : *:* *. :.* * :* **:** * *. ::**::** ***.! AGKIKIEFNQA! AGIINIDYFP-! AGNIRVVYTP-! ** *.: :! R-arginine W-tryptophan AtPNP-A; Theoretical pi: 9.32 (and 9.35 without signal peptide)
12 35 68 AtPNP-A --- PYTRSACYGTQRETLVVGVKNNLWQNGRACGRRY --- α-hanp SLRRSSCFGGR--MDRIGAQSGLGCN----SFRY **:*:* : :*.:..* * ** AtPNP-A(35-68) is the biologically active domain of the molecule
13 C β2 β6 β5 β1 N ATPNP-A: MAVKFVVVMIVFAQILAPIAEAAQGKAVYY DPPYTRSACYGTQRETLVVGVKNNLWQNGR ACGRRYRVRCIGATYNFDRACTGRTVDVKV VDFCREPCNGDLNLSRDAFRVIANTDAGNI RVVYTP β3 β4 Six stranded β-barrel structure with two ψ loops
14 PNPs in an evolutionary context
15 Index 6 M. trunculata Index 8 G. max AtPNP-B A. thaliana PNP-A Index 5 M. trunculata Index 4 O. sativa CjBAp12 C. jambhiri PNP-B AtPNP-A A. thaliana Index 1 O. sativa Index 2 O. sativa Indices 3 & 7 O. sativa β expansin A. thaliana α expansin N. tabacum α expansin T. vesicolor β-expansin β expansin O. sativa β expansin A. lentiformis α expansin R. diphyllum α expansin O. sativa α expansin M. quadrifolia α expansin β expansin O. sativa 0. 1
16 Hypothesis: A highly expressed class of molecules that perform an extracellular function have been recruited for a role in homeostasis
17 N Intron Intron C Expansins GH45 domain Cellulose-binding domain N C PNP-like molecules - Expansins have no glucanase activity - Glucanases have no expansin activity - p12 (PNP) has no expansin activity - PNPs are mobile molecules
18 Ancestral molecule has hydrolytic activity on Wall substrate Loss of hydrolytic activity Intron Intron Intron N C N C GH45 domain CB domain GH45 domain - Wall remains the substrate - CB domain restricts mobility - Cell membrane is the substrate - Absence of a CB domain increases mobility Expansins PNPs Both classes of molecules are extra cytosolic & may cooperate in cell elongation growth
19 Defining the biological role of PNP-like molecules in planta
20 In situ localisation of PNPs in conductive tissue (a) (b) (c) Indication of systemic action
21 In situ tissue print with anti-hanp and anti-pnp A vb B ph pith x ep C vb D vb A. Cut through ivy petiole; x - xylem, ph - phloem, ep - epidermis, vb - vascular bundle B. Detail C. Incubation o/n with anti-hanp Ab D. Incubation o/n with anti-pnp Ab
22 PNP is localised in the conductive tissue PNP extracted from the xylem is biologicaly active The molecular structure and systemic action are compatible
23 We would expect NPs to affect ion transport Directly: e.g. by forming or modifying channels or affecting pumps Indirectly: By mobilizing 2 nd messengers that affect (gate) channels or affect pumps
24 Time course of PNP-dependent cgmp levels in the root stele of Zea mays cgmp (fmol / mg fresh weight) Time (min): control
25 Recombinant AtPNP-A modulates H + fluxes in A.t. roots 2 1 in Average H + fluxes in elongation zone Average H + fluxes in mature region Net H + fluxes in nmoles m -2 s Net flux out Net H + fluxes (nmoles m -2 s -1) Min.: Time (min) Net H + fluxes in nmoles m -2 s ` Time (min) in Net flux out
26 AtPNP-A modulates K + and Na + fluxes in A.t. roots Net K + fluxes in nmoles m -2 s -1 Net K + fluxes in nmoles m -2 s -1 Average K + flux in the elongation zone in Net flux out Time (min) Average K + flux in the mature zone in Net flux out Time (min) Net Na + fluxes in nmoles m -2 s -1 Net Na + fluxes in nmoles m -2 s Time (min) Average Na + flux in the elongation zone Average Na + flux in the mature zone Average Na flux Time (min)
27 Towards a key discovery
28 Monitoring osmotically induced volume changes in mesophyll cell protoplasts Absorbance ( nm) Time (min) 0.2 M 0.4 M 0.6 M MCP diameter in µm Sorbitol conc. (M) 0.2 M 0.4 M 0.6 M Sorbitol 40 µm
29 AtPNP-A modulates osmoticum-dependent volume changes in MCPs Mean Protoplast Volume (µm 3 ) AtPNP-A: cyclohex. : (µg/ml) AtPNP-A drives H 2 O uptake even under osmotically unfavourable conditions
30 All AtPNP-A dependent processes discovered to date are relevant to plant homeostasis and growth
31 PNP functions - known to date: H + Plasmalemma ATP ADP + P i K + Na + K +, Na + K + K IR PNP PNP H + Cl - ΔH + PNP PNP GTP cgmp PNP PNP guanylate cyclase domain Comp. Sol. Synth. H 2 O low affinity cation transporter
32 In search of a biological role for PNPs WT KO Comp Control 50 mm NaCl
33 Insights from whole plant physiology
34
35 Temperature dependence of systemic is indicative for phloem transport
36
37 Meier, S., Bastian, R., Donaldson, L., Murray, S., Bajic, V. and Gehring, C. Co-expression and promoter content analyses assign a role in biotic and abiotic stress responses to plant natriuretic peptides. BMC Plant Biol. (2008) 8, 24
38 Meier, S. and Gehring, C. A guide to the integrated application of on-line data mining tools for the inference of gene functions at the systems level. Biotech. J. (2008) DOI: /biot
39 A surprising finding
40 A bacterium with a plant-like peptide A.thaliana X.axonopodis A.thaliana X.axonopodis A.thaliana X.axonopodis --MAVKFVVVM----IVFAQILAPIAEAAQGKAVYYDPPYTR-----SAC MGIVMKHKILLGFSVAAIGLLFSSAAFADIGTISFYGNNARRPADLVQGC :.:*. :::.:. :::. * * *. :*. *..* YG-----TQRETLVVGVKNNLWQNGRACGRRYRVRCIGATYNFDRACTGR NVPEDQVSGRNYQVVTVSDGLWDNGASCGRRYRMRCISTPVKHS--CTAS : *: ** *.:.**:** :******:***.:. :.. **. TVDVKVVDFCREPCNGDLNLSRDAFRVIANTDAGNIRVVYTP---- TIDVIVVGRCPN-GRCTVGGRDVTMKIAFNRYSLLVQARTAPWANI *:** **. * :. :. :::: * : ::. :*
41 A HYPOTHESIS: Molecular mimicry of a signalling molecule may permit pathogen control of plant homeostasis
42 XacPNP works in plants
43 XacPNP induction by apoplast-like conditions
44 XacPNP weakens host defense
45 Out-look: Structural and functional characterisation of recombinant molecules Search of the PNP receptor Applications of PNPs in rational approaches to increasing abiotic stress tolerance
46
AP Biology Chapter 36
Chapter 36 Chapter 36 Transport in Plants 2006-2007 Transport in plants - Overview H2O & minerals transport in xylem transpiration evaporation, adhesion & cohesion negative pressure Sugars transport in
More informationHort Chapter 10 MENGEL et al, 5th Ed
Hort 5504 POTASSIUM Chapter 10 MENGEL et al, 5th Ed POTASSIUM CYCLE 1 SOIL POTASSIUM K minerals and K release ~2-3% of earth s crust is K K tied to clay particles (< 2 µm size) Frequently soils high in
More informationNOTES: CH 36 - Transport in Plants
NOTES: CH 36 - Transport in Plants Recall that transport across the cell membrane of plant cells occurs by: -diffusion -facilitated diffusion -osmosis (diffusion of water) -active transport (done by transport
More informationChapter 36: Transport in Vascular Plants - Pathways for Survival
Chapter 36: Transport in Vascular Plants - Pathways for Survival For vascular plants, the evolutionary journey onto land involved differentiation into roots and shoots Vascular tissue transports nutrients
More information23-. Shoot and root development depend on ratio of IAA/CK
Balance of Hormones regulate growth and development Environmental factors regulate hormone levels light- e.g. phototropism gravity- e.g. gravitropism temperature Mode of action of each hormone 1. Signal
More informationDNA or RNA metabolism (1%) Signal transduction (2%) Development (2%) Other cellular processes (17%)
Fig. 35-24 Other metabolism (18%) DNA or RNA metabolism (1%) Signal transduction (2%) Development (2%) Unknown (24%) Energy pathways (3%) Cell division and organization (3%) Transport (4%) Transcription
More informationTransport in Plants (Ch. 23.5)
Transport in Plants (Ch. 23.5) Transport in plants H 2 O & minerals transport in xylem Transpiration Adhesion, cohesion & Evaporation Sugars transport in phloem bulk flow Gas exchange photosynthesis CO
More informationModule Membrane Biogenesis and Transport Lecture 15 Ion Channels Dale Sanders
Module 0220502 Membrane Biogenesis and Transport Lecture 15 Ion Channels Dale Sanders 9 March 2009 Aims: By the end of the lecture you should understand The principles behind the patch clamp technique;
More informationCytokinin. Fig Cytokinin needed for growth of shoot apical meristem. F Cytokinin stimulates chloroplast development in the dark
Cytokinin Abundant in young, dividing cells Shoot apical meristem Root apical meristem Synthesized in root tip, developing embryos, young leaves, fruits Transported passively via xylem into shoots from
More informationChapter 39. Plant Response. AP Biology
Chapter 39. Plant Response 1 Plant Reactions Stimuli & a Stationary Life u animals respond to stimuli by changing behavior move toward positive stimuli move away from negative stimuli u plants respond
More informationChapter 36~ Transport in Plants
Chapter 36~ Transport in Plants Structural Features Used for Resource Acquistion Roots and stems to do transport of resources Diffusion, active transport, and bulk flow Work in vascular plants to transport
More informationChapter 35 Regulation and Transport in Plants
Chapter 35 Regulation and Remember what plants need Photosynthesis light reactions Calvin cycle light sun H 2 O ground CO 2 air What structures have plants evolved to supply these needs? Interdependent
More informationHost-Pathogen Interaction. PN Sharma Department of Plant Pathology CSK HPKV, Palampur
Host-Pathogen Interaction PN Sharma Department of Plant Pathology CSK HPKV, Palampur-176062 PATHOGEN DEFENCE IN PLANTS A BIOLOGICAL AND MOLECULAR VIEW Two types of plant resistance response to potential
More informationcytosol stroma Photorespiration: Ribulose bisphosphate carboxylase/oxygenase (Rubisco) Ribulose bisphosphate carboxylase/oxygenase (Rubisco)
Carbon Reactions: CO 2 is fixed by Rubisco located in the stroma. The molecule that is carboxylated is RuBP. RuBP has 5 carbons and is regenerated in the Calvin cycle. In the Calvin cycle, carbon is conserved,
More informationQuestions: Properties of excitable tissues Transport across cell membrane Resting potential Action potential Excitability change at excitation
Questions: Properties of excitable tissues Transport across cell membrane Resting potential Action potential Excitability change at excitation EXCITABLE TISSUES The tissues can change the properties under
More informationBiology 213 Exam 3 Practice Key
Biology 213 Practice Key 1. (4) Explain the difference between a macronutrient and a micronutrient and cite two examples of each category? Macronutrients are the minerals needed by the plant in greater
More informationPlease sit next to a partner. you are an A or a B
Please sit next to a partner you are an A or a B Plants Transport in Vascular Plants Transport Overview Vascular tissue transports nutrients throughout a plant Such transport may occur over long distances
More informationCompartments and Transport. Three Major Pathways of Transport. Absorp+on of Water and Minerals by Root Cells. Bulk flow
Plasmodesmata Channels connec+ng neighboring cells Cell membrane and cytosol are con+nuous from cell to cell Symplast Cytoplasmic con+nuum Apoplast Compartments and Transport Through plasmodesmata con+nuum
More informationTREES. Functions, structure, physiology
TREES Functions, structure, physiology Trees in Agroecosystems - 1 Microclimate effects lower soil temperature alter soil moisture reduce temperature fluctuations Maintain or increase soil fertility biological
More informationAdvanced Higher Biology. Unit 1- Cells and Proteins 2c) Membrane Proteins
Advanced Higher Biology Unit 1- Cells and Proteins 2c) Membrane Proteins Membrane Structure Phospholipid bilayer Transmembrane protein Integral protein Movement of Molecules Across Membranes Phospholipid
More informationRuBP has 5 carbons and is regenerated in the Calvin cycle. In the Calvin cycle, carbon is conserved, ATP is used and NADPH is used.
Carbon Reactions: CO 2 is fixed by Rubisco located in the stroma. The molecule that is carboxylated is RuBP. RuBP has 5 carbons and is regenerated in the Calvin cycle. In the Calvin cycle, carbon is conserved,
More informationSECOND PUBLIC EXAMINATION. Honour School of Physics Part C: 4 Year Course. Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS
2757 SECOND PUBLIC EXAMINATION Honour School of Physics Part C: 4 Year Course Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS TRINITY TERM 2013 Monday, 17 June, 2.30 pm 5.45 pm 15
More informationPlant Stimuli pp Topic 3: Plant Behaviour Ch. 39. Plant Behavioural Responses. Plant Hormones. Plant Hormones pp
Topic 3: Plant Behaviour Ch. 39 Plants exist in environments that are constantly changing. Like animals, plants must be able to detect and react to stimuli in the environment. Unlike animals, plants can
More informationThere should be nothing new for you in this lecture. If there is, stay for office hours and / or ask for help from the TAs.
Membranes 02 The goal of this lecture is to review pre-requisite material related to the structure and function of biological membranes and to provide students a further overview of material to be covered
More informationTransport in Plants Notes AP Biology Mrs. Laux 3 levels of transport occur in plants: 1. Uptake of water and solutes by individual cells -for
3 levels of transport occur in plants: 1. Uptake of water and solutes by individual cells -for photosynthesis and respiration -ex: absorption of H 2 O /minerals by root hairs 2. Short distance cell-to-cell
More informationMembrane transport 1. Summary
Membrane transport 1. Summary A. Simple diffusion 1) Diffusion by electrochemical gradient no energy required 2) No channel or carrier (or transporter protein) is needed B. Passive transport (= Facilitated
More information2014 Pearson Education, Inc. 1
1 CO 2 O 2 Light Sugar O 2 and minerals CO 2 2 Buds 42 29 21 34 13 26 5 18 10 31 23 8 15 28 16 2 24 Shoot apical meristem 7 3 20 1 mm 32 11 19 12 6 4 1 25 17 14 9 40 27 22 3 Cell wall Apoplastic route
More informationTransport of glucose across epithelial cells: a. Gluc/Na cotransport; b. Gluc transporter Alberts
Figure 7 a. Secondary transporters make up the largest subfamily of transport proteins. TAGI 2000. Nature 408, 796 1. Na+- or H+-coupled cotransporters - Secondary active transport 2/7-02 Energy released
More informationElectrical Properties of the Membrane
BIOE 2520 Electrical Properties of the Membrane Reading: Chapter 11 of Alberts et al. Stephen Smith, Ph.D. 433 Biotech Center shs46@pitt.edu Permeability of Lipid membrane Lipid bilayer is virtually impermeable
More informationOrgans and leaf structure
Organs and leaf structure Different types of tissues are arranged together to form organs. Structure: 2 parts (Petiole and Leaf Blade) Thin flat blade, large surface area Leaves contain all 3 types of
More informationBiology Slide 1 of 36
Biology 1 of 36 2 of 36 Types of Roots Types of Roots What are the two main types of roots? 3 of 36 Types of Roots The two main types of roots are: taproots, which are found mainly in dicots, and fibrous
More informationFigure 1. Identification of UGT74E2 as an IBA glycosyltransferase. (A) Relative conversion rates of different plant hormones to their glucosylated
Figure 1. Identification of UGT74E2 as an IBA glycosyltransferase. (A) Relative conversion rates of different plant hormones to their glucosylated form by recombinant UGT74E2. The naturally occurring auxin
More informationChapter 4-2. Transpiration diffusion of water vapor
Chapter 4-2 Transpiration diffusion of water vapor Transpiration diffusion of water vapor Diffusion is primary means of any further movement of the water out of the leaf. That is water movement is controlled
More informationTransport in Plants AP Biology
Transport in Plants 2006-2007 Water & mineral absorption Water absorption from soil osmosis aquaporins Mineral absorption active transport proton pumps active transport of H + aquaporin root hair proton
More informationEnergy and Cells. Appendix 1. The two primary energy transformations in plants are photosynthesis and respiration.
Energy and Cells Appendix 1 Energy transformations play a key role in all physical and chemical processes that occur in plants. Energy by itself is insufficient to drive plant growth and development. Enzymes
More informationC MPETENC EN I C ES LECT EC UR U E R
LECTURE 7: SUGAR TRANSPORT COMPETENCIES Students, after mastering the materials of Plant Physiology course, should be able to: 1. To explain the pathway of sugar transport in plants 2. To explain the mechanism
More information23 2 Roots Slide 2 of 36
2 of 36 Types of Roots Types of Roots What are the two main types of roots? 3 of 36 Types of Roots The two main types of roots are: taproots, which are found mainly in dicots, and fibrous roots, which
More informationOCR (A) Biology A-level
OCR (A) Biology A-level Topic 3.3: Transport in plants Notes Plants require a transport system to ensure that all the cells of a plant receive a sufficient amount of nutrients. This is achieved through
More informationEnduring understanding 1.A: Change in the genetic makeup of a population over time is evolution.
The AP Biology course is designed to enable you to develop advanced inquiry and reasoning skills, such as designing a plan for collecting data, analyzing data, applying mathematical routines, and connecting
More informationTransport in Vascular Plants
Chapter 36 Transport in Vascular Plants PowerPoint Lectures for Biology, Seventh Edition Neil Campbell and Jane Reece Lectures by Chris Romero Vascular tissue Transports nutrients throughout a plant; such
More informationBald cypress Taxodium distichum in a swamp in North Carolina
Bald cypress Taxodium distichum in a swamp in North Carolina Bald cypress is another deciduous gymnosperm. It is native to the SE United States. It can tolerate a wide range of soil conditions. It is not
More informationPlant Structure and Function
Plant Structure and Function A Meridian Biology AP Study Guide by John Ho and Tim Qi Plant Terms Growth: Growth Types Type Location Description Primary Primary Vertical growth (up-down), dominant direction
More informationChapter 36. Transport in Vascular Plants
Chapter 36 Transport in Vascular Plants Overview: Pathways for Survival For vascular plants The evolutionary journey onto land involved the differentiation of the plant body into roots and shoots Vascular
More informationMembranes 2: Transportation
Membranes 2: Transportation Steven E. Massey, Ph.D. Associate Professor Bioinformatics Department of Biology University of Puerto Rico Río Piedras Office & Lab: NCN#343B Tel: 787-764-0000 ext. 7798 E-mail:
More informationOverview of ion channel proteins. What do ion channels do? Three important points:
Overview of ion channel proteins Protein Structure Membrane proteins & channels Specific channels Several hundred distinct types Organization Evolution We need to consider 1. Structure 2. Functions 3.
More informationCHAPTER TRANSPORT
CHAPTER 2 2.4 TRANSPORT Uptake of CO2 FOCUS: Uptake and transport of water and mineral salts Transport of organic substances Physical forces drive the transport of materials in plants over a range of distances
More informationChapter 17. From Gene to Protein. Biology Kevin Dees
Chapter 17 From Gene to Protein DNA The information molecule Sequences of bases is a code DNA organized in to chromosomes Chromosomes are organized into genes What do the genes actually say??? Reflecting
More informationMovement of water and solutes in plants Chapter 4 and 30
Movement of water and solutes in plants Chapter 4 and 30 Molecular Movement Diffusion Molecules or ions moving in the opposite direction = movement against a diffusion gradient. Rates of diffusion are
More informationChapt. 12, Movement Across Membranes. Chapt. 12, Movement through lipid bilayer. Chapt. 12, Movement through lipid bilayer
Chapt. 12, Movement Across Membranes Two ways substances can cross membranes Passing through the lipid bilayer Passing through the membrane as a result of specialized proteins 1 Chapt. 12, Movement through
More information2014 Pearson Education, Inc. 1. Light. Sugar O 2 H 2 O. and minerals CO Pearson Education, Inc.
1 CO 2 O 2 Light ugar O 2 and minerals CO 2 2 Buds 34 42 29 26 31 18 21 13 5 10 23 8 15 28 16 24 hoot apical meristem 2 7 3 20 32 11 19 12 6 4 1 25 17 14 9 40 27 22 1 mm 3 Cell wall Apoplastic route Cytosol
More informationCELL SIGNALLING and MEMBRANE TRANSPORT. Mark Louie D. Lopez Department of Biology College of Science Polytechnic University of the Philippines
CELL SIGNALLING and MEMBRANE TRANSPORT Mark Louie D. Lopez Department of Biology College of Science Polytechnic University of the Philippines GENERIC SIGNALLING PATHWAY CELL RESPONSE TO SIGNALS CELL RESPONSE
More informationVisual pigments. Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2019
Visual pigments Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2019 References Webvision: The Organization of the Retina and Visual System (http://www.ncbi.nlm.nih.gov/books/nbk11522/#a 127) The
More informationTranslocation 11/30/2010. Translocation is the transport of products of photosynthesis, mainly sugars, from mature leaves to areas of growth and
Translocation Translocation is the transport of products of photosynthesis, mainly sugars, from mature leaves to areas of growth and storage. Phloem is the tissue through which translocation occurs. Sieve
More informationAP Biology Essential Knowledge Cards BIG IDEA 1
AP Biology Essential Knowledge Cards BIG IDEA 1 Essential knowledge 1.A.1: Natural selection is a major mechanism of evolution. Essential knowledge 1.A.4: Biological evolution is supported by scientific
More informationResource acquisition and transport in vascular plants
Resource acquisition and transport in vascular plants Overview of what a plant does Chapter 36 CO 2 O 2 O 2 and and CO 2 CO 2 O 2 Sugar Light Shoots are optimized to capture light and reduce water loss
More informationAP Biology. Transport in plants. Chapter 36. Transport in Plants. Transport in plants. Transport in plants. Transport in plants. Transport in plants
Chapter 36. Transport in Plants evaporation, adhesion & cohesion negative pressure evaporation, adhesion & cohesion negative pressure transport in phloem bulk flow Calvin cycle in leaves loads sucrose
More information! E EUKARYOTE CYTOLOGY INTERCELLULAR SPACE MIDDLE LAMELLA PEROXISOME PLASMODESMATA VACUOLE CYTOSOL CELL WALL GOLGI BODY MIDDLE LAMELLA NUCLEUS
EUKARYOTE CYTOLOGY INTERCELLULAR SPACE! E PEROXISOME VACUOLE CELL WALL MIDDLE LAMELLA CHLOROPLAST CYTOPLASMIC STRAND CYTOSOL CELL MEMBRANE MIDDLE LAMELLA PLASMODESMATA CYTOSOL GOLGI BODY NUCLEUS MITOCHONDRION
More informationBig Idea 1: The process of evolution drives the diversity and unity of life.
Big Idea 1: The process of evolution drives the diversity and unity of life. understanding 1.A: Change in the genetic makeup of a population over time is evolution. 1.A.1: Natural selection is a major
More informationAP Curriculum Framework with Learning Objectives
Big Ideas Big Idea 1: The process of evolution drives the diversity and unity of life. AP Curriculum Framework with Learning Objectives Understanding 1.A: Change in the genetic makeup of a population over
More informationCONTROL OF GROWTH BY HORMONES
CONTROL OF GROWTH BY HORMONES Growth and organogenesis are controlled......by genes (independent of environment): e.g., number of primary vascular bundles, general shape of a leaf or flower...by genes
More informationCONTROL OF PLANT GROWTH AND DEVELOPMENT BI-2232 RIZKITA R E
CONTROL OF PLANT GROWTH AND DEVELOPMENT BI-2232 RIZKITA R E The development of a plant the series of progressive changes that take place throughout its life is regulated in complex ways. Factors take part
More informationMembrane Protein Channels
Membrane Protein Channels Potassium ions queuing up in the potassium channel Pumps: 1000 s -1 Channels: 1000000 s -1 Pumps & Channels The lipid bilayer of biological membranes is intrinsically impermeable
More informationWater Relations in Viticulture BRIANNA HOGE AND JIM KAMAS
Water Relations in Viticulture BRIANNA HOGE AND JIM KAMAS Overview Introduction Important Concepts for Understanding water Movement through Vines Osmosis Water Potential Cell Expansion and the Acid Growth
More informationReceptors and Ion Channels
Receptors and Ion Channels Laurie Kellaway Senior Lecturer Department of Human Biology Laurie@curie.uct.ac.za Tel. +27 +21 4066 271 What are the two types of Neurotransmitter receptors Ionotropic receptors
More informationMarine Resources Development Foundation/MarineLab Grades: 9, 10, 11, 12 States: AP Biology Course Description Subjects: Science
Marine Resources Development Foundation/MarineLab Grades: 9, 10, 11, 12 States: AP Biology Course Description Subjects: Science Highlighted components are included in Tallahassee Museum s 2016 program
More informationCHAPTER 32 TRANSPORT IN PLANTS OUTLINE OBJECTIVES
CHAPTER 32 TRANSPORT IN PLANTS OUTLINE I. The traffic of water and solutes occurs on cellular, organ, and whole-plant levels: an overview of transport in plants A. Transport at the Cellular Level B. Short
More informationIntroduction to Physiology II: Control of Cell Volume and Membrane Potential
Introduction to Physiology II: Control of Cell Volume and Membrane Potential J. P. Keener Mathematics Department Math Physiology p.1/23 Basic Problem The cell is full of stuff: Proteins, ions, fats, etc.
More informationFigure 18.1 Blue-light stimulated phototropism Blue light Inhibits seedling hypocotyl elongation
Blue Light and Photomorphogenesis Q: Figure 18.3 Blue light responses - phototropsim of growing Corn Coleoptile 1. How do we know plants respond to blue light? 2. What are the functions of multiple BL
More informationHomework for Monday: Correct potometer questions Complete transport in plants worksheet
Transport in plants Homework for Monday: Correct potometer questions Complete transport in plants worksheet Transpiration the loss of water from a plant through evaporation Did you know? A 15m maple tree
More informationA A A A B B1
LEARNING OBJECTIVES FOR EACH BIG IDEA WITH ASSOCIATED SCIENCE PRACTICES AND ESSENTIAL KNOWLEDGE Learning Objectives will be the target for AP Biology exam questions Learning Objectives Sci Prac Es Knowl
More informationPOTASSIUM IN PLANT GROWTH AND YIELD. by Ismail Cakmak Sabanci University Istanbul, Turkey
POTASSIUM IN PLANT GROWTH AND YIELD by Ismail Cakmak Sabanci University Istanbul, Turkey Low K High K High K Low K Low K High K Low K High K Control K Deficiency Cakmak et al., 1994, J. Experimental Bot.
More informationVisual pigments. Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2015
Visual pigments Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2015 References Photoreceptors and visual pigments Webvision: The Organization of the Retina and Visual System (http://www.ncbi.nlm.nih.gov/books/nbk11522/#a127)
More informationPhotosynthesis: Life from Light and Air. Regents Biology
Photosynthesis: Life from Light and Air Plants are energy producers Like animals, plants need energy to live unlike animals, plants don t need to eat food to make that energy Plants make both FOOD & ENERGY
More informationIdentification number: TÁMOP /1/A
Manifestation of Novel Social Challenges of the European Union in the Teaching Material of Medical Biotechnology Master s Programmes at the University of Pécs and at the University of Debrecen Identification
More informationEssential knowledge 1.A.2: Natural selection
Appendix C AP Biology Concepts at a Glance Big Idea 1: The process of evolution drives the diversity and unity of life. Enduring understanding 1.A: Change in the genetic makeup of a population over time
More informationResource Acquisition and Transport in Vascular Plants
Chapter 36 Resource Acquisition and Transport in Vascular Plants PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley
More informationBiology 1030 Winter 2009
Meeting Tissue Needs II Chapter 36 (738-755) Chapter 37 (756-770) Cellular Currency Plants harvest solar energy Photosynthesis Produces sugars Proteins, nucleic acids, lipids? H 2 O CO 2 Plants cells still
More information(by Ken Robinson, revised 2009 by NPelaez)
Biology 13100 (by Ken Robinson, revised 2009 by NPelaez) The Transport of Water in Higher Plants, and Ca 2+ as Cellular Regulator (including problem set 3) The movement of water across a cell membrane
More informationStatistical mechanics of biological processes
Statistical mechanics of biological processes 1 Modeling biological processes Describing biological processes requires models. If reaction occurs on timescales much faster than that of connected processes
More informationStomata and water fluxes through plants
Stomata and water fluxes through plants Bill Davies The Lancaster Environment Centre, UK Summary Stomata and responses to the environment Conductance, a function of frequency and aperture Measuring/estimating
More informationImportance of Protein sorting. A clue from plastid development
Importance of Protein sorting Cell organization depend on sorting proteins to their right destination. Cell functions depend on sorting proteins to their right destination. Examples: A. Energy production
More informationMembrane Protein Pumps
Membrane Protein Pumps Learning objectives You should be able to understand & discuss: Active transport-na + /K + ATPase ABC transporters Metabolite transport by lactose permease 1. Ion pumps: ATP-driven
More informationMolecular Cell Biology 5068 In Class Exam 2 November 8, 2016
Molecular Cell Biology 5068 In Class Exam 2 November 8, 2016 Exam Number: Please print your name: Instructions: Please write only on these pages, in the spaces allotted and not on the back. Write your
More informationCELLS NOT YOUR CELL PHONE HOMEOSTASIS: LESSON 5 OVERVIEW TEKS
Lesson 5: Active Transport Protein Pumps Objectives: In this lesson the student will: CELLS NOT YOUR CELL PHONE HOMEOSTASIS: LESSON 5 OVERVIEW 1. Identify how the unique structure of the cell membrane
More information1. What is the source of the oxygen released into the air as a product of photosynthesis? D. Both water and carbon dioxide (Total 1 mark)
2.9 Photosynthesis Paper 1 Possible Mult Choice Questions 1. What is the source of the oxygen released into the air as a product of photosynthesis? A. Chlorophyll B. Carbon dioxide only C. Water only D.
More informationValley Central School District 944 State Route 17K Montgomery, NY Telephone Number: (845) ext Fax Number: (845)
Valley Central School District 944 State Route 17K Montgomery, NY 12549 Telephone Number: (845)457-2400 ext. 18121 Fax Number: (845)457-4254 Advance Placement Biology Presented to the Board of Education
More informationCBSE Quick Revision Notes (Class-11 Biology) CHAPTER-11 TRANSPORT IN PLANTS
CBSE Quick Revision Notes (Class-11 Biology) CHAPTER-11 TRANSPORT IN PLANTS Plant transport various substance like gases, minerals, water, hormones, photosynthetes and organic solutes to short distance
More informationPart I => CARBS and LIPIDS. 1.5 MEMBRANE TRANSPORT 1.5a Passive Transport 1.5b Facilitated Transport 1.5c Active Transport
Part I => CARBS and LIPIDS 1.5 MEMBRANE TRANSPORT 1.5a Passive Transport 1.5b Facilitated Transport 1.5c Active Transport Section 1.5a: Passive Transport Synopsis 1.5a - Passive transport (or passive diffusion)
More informationNeurophysiology. Danil Hammoudi.MD
Neurophysiology Danil Hammoudi.MD ACTION POTENTIAL An action potential is a wave of electrical discharge that travels along the membrane of a cell. Action potentials are an essential feature of animal
More informationBiology Exam #1 Study Guide. True/False Indicate whether the statement is true or false. F 1. All living things are composed of many cells.
Biology Exam #1 Study Guide True/False Indicate whether the statement is true or false. F 1. All living things are composed of many cells. T 2. Membranes are selectively permeable if they allow only certain
More informationChapter 12 & 13 Transport, Soil and Mineral Nutrition
Chapter 12 & 13 Transport, Soil and Mineral Nutrition Topics Methods of transport Xylem transport Phloem transport Soils properties and nutrient absorption Macro and micro essential nutrient elements Too
More informationMuscle regulation and Actin Topics: Tropomyosin and Troponin, Actin Assembly, Actin-dependent Movement
1 Muscle regulation and Actin Topics: Tropomyosin and Troponin, Actin Assembly, Actin-dependent Movement In the last lecture, we saw that a repeating alternation between chemical (ATP hydrolysis) and vectorial
More information1. (a) Why are the two kinds of self-incompatibiltiy (SI) mechanisms called sporophytic and gametophytic?
Bio 328 -Spring 2005 NAME: Test #1 Please provide succinct answers in the space provided under each question. Unless otherwise noted in the margin the value of each question is 3 points. 1. (a) Why are
More informationReception The target cell s detection of a signal coming from outside the cell May Occur by: Direct connect Through signal molecules
Why Do Cells Communicate? Regulation Cells need to control cellular processes In multicellular organism, cells signaling pathways coordinate the activities within individual cells that support the function
More informationDrug interactions. (Efficacy is a measure of the size of response produced by receptor activation)
Drug interactions Receptor A signal transducer, modifying cell function in response to an extracellular signal. - Membrane proteins e.g. AChR, - Cytoplasmic proteins e.g. steroid receptors Drugs usually
More informationSignal Transduction Phosphorylation Protein kinases. Misfolding diseases. Protein Engineering Lysozyme variants
Signal Transduction Phosphorylation Protein kinases Misfolding diseases Protein Engineering Lysozyme variants Cells and Signals Regulation The cell must be able to respond to stimuli Cellular activities
More informationEndocrine Physiology. Introduction to Endocrine Principles
Endocrine Physiology Introduction to Endocrine Principles There are TWO major groups of hormones Peptide and protein hormones Amine hormones Peptide and protein hormones act through cell membrane receptors
More informationRenal handling of substances. Dr.Charushila Rukadikar Assistance Professor Physiology
Renal handling of substances Dr.Charushila Rukadikar Assistance Professor Physiology GENERAL PRINCIPLES OF RENAL TUBULAR TRANSPORT Transport mechanisms across cell membrane 1) Passive transport i. Diffusion
More informationThe circle and the basics of signal transduction. Course Outline. Topic #! Topic lecture! Silverthorn! Membranes (pre-requisite material)" "
Homeostasis 03 The goal of this lecture is to discuss the concept of homeostasis and to introduce basic signal transduction mechanisms involved in homeostatic regulation The sections for this lecture are:
More informationTime allowed: 2 hours Answer ALL questions in Section A, ALL PARTS of the question in Section B and ONE question from Section C.
UNIVERSITY OF EAST ANGLIA School of Biological Sciences Main Series UG Examination 2015-2016 FUNDAMENTALS OF CELL BIOLOGY AND BIOCHEMISTRY BIO-4004B Time allowed: 2 hours Answer ALL questions in Section
More information