Table S1. Theoretical and apparent molecular weights of the proteins and protein complexes used for ITC analysis

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-

ml. ph 7.5 ph 6.5 ph 5.5 ph 4.5. β 2 AR-Gs complex + GDP β 2 AR-Gs complex + GTPγS

a UV28 absorption (mau) 9 8 7 5 3 β 2 AR-Gs complex β 2 AR-Gs complex + GDP β 2 AR-Gs complex + GTPγS β 2 AR-Gs complex dissociated complex excess nucleotides b 9 8 7 5 3 β 2 AR-Gs complex β 2 AR-Gs complex

IgE binds asymmetrically to its B cell receptor CD23

Supplementary Information IgE binds asymmetrically to its B cell receptor CD23 Balvinder Dhaliwal 1*, Marie O. Y. Pang 2, Anthony H. Keeble 2,3, Louisa K. James 2,4, Hannah J. Gould 2, James M. McDonnell

Supplemental Experimental Procedures

Cell, Volume 136 Supplemental Data Large-Scale Structural Analysis of the Classical Human Protein Tyrosine Phosphatome Alastair J. Barr, Emilie Ugochukwu, Wen Hwa Lee, Oliver N. F. King, Panagis Filippakopoulos,

Supplementary Figure 1. Biochemical and sequence alignment analyses the

Supplementary Figure 1. Biochemical and sequence alignment analyses the interaction of OPTN and TBK1. (a) Analytical gel filtration chromatography analysis of the interaction between TBK1 CTD and OPTN(1-119).

Supplementary figure 1. Comparison of unbound ogm-csf and ogm-csf as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine

Supplementary figure 1. Comparison of unbound and as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine GM-CSF (slate) with bound GM-CSF in the GIF:GM-CSF complex (GIF: green,

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11539 Supplementary Figure 1 Schematic representation of plant (A) and mammalian (B) P 2B -ATPase domain organization. Actuator (A-), nucleotide binding (N-),

SUPPLEMENTARY INFORMATION

Supplementary materials Figure S1 Fusion protein of Sulfolobus solfataricus SRP54 and a signal peptide. a, Expression vector for the fusion protein. The signal peptide of yeast dipeptidyl aminopeptidase

SI Text S1 Solution Scattering Data Collection and Analysis. SI references

SI Text S1 Solution Scattering Data Collection and Analysis. The X-ray photon energy was set to 8 kev. The PILATUS hybrid pixel array detector (RIGAKU) was positioned at a distance of 606 mm from the sample.

Supplementary Information. The protease GtgE from Salmonella exclusively targets. inactive Rab GTPases

Supplementary Information The protease GtgE from Salmonella exclusively targets inactive Rab GTPases Table of Contents Supplementary Figures... 2 Supplementary Figure 1... 2 Supplementary Figure 2... 3

SUPPLEMENTARY INFORMATION

Supplementary Table 1: Amplitudes of three current levels. Level 0 (pa) Level 1 (pa) Level 2 (pa) TrkA- TrkH WT 200 K 0.01 ± 0.01 9.5 ± 0.01 18.7 ± 0.03 200 Na * 0.001 ± 0.01 3.9 ± 0.01 12.5 ± 0.03 200

Use of SEC-MALS. (Size Exclusion Chromatography - Multi Angle. Light Scattering) for protein quality and characterization

Use of SEC-MALS (Size Exclusion Chromatography - Multi Angle Light Scattering) for protein quality and characterization Methods for protein characterization Analytical SEC is a common method to characterize

Crystal Structure of Fibroblast Growth Factor 9 (FGF9) Reveals Regions. Implicated in Dimerization and Autoinhibition

JBC Papers in Press. Published on November 1, 2000 as Manuscript M006502200 Crystal Structure of Fibroblast Growth Factor 9 (FGF9) Reveals Regions Implicated in Dimerization and Autoinhibition 1 Copyright

Nitrogenase MoFe protein from Clostridium pasteurianum at 1.08 Å resolution: comparison with the Azotobacter vinelandii MoFe protein

Acta Cryst. (2015). D71, 274-282, doi:10.1107/s1399004714025243 Supporting information Volume 71 (2015) Supporting information for article: Nitrogenase MoFe protein from Clostridium pasteurianum at 1.08

Supplementary Figures

1 Supplementary Figures Supplementary Figure 1 Type I FGFR1 inhibitors (a) Chemical structures of a pyrazolylaminopyrimidine inhibitor (henceforth referred to as PAPI; PDB-code of the FGFR1-PAPI complex:

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2

Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell

SUPPLEMENTARY INFORMATION

UPPEER ORO doi:10.1038/nature10753 D D D D P E ntracellular C1 W P P C EC1 D Q R H C D W D R C C2 D E D E C R Q Q W P W W R P P EC2 EC3 P C C P W P W W P C W H R C R E C3 P R R P P P C Extracellular embrane

SUPPLEMENTARY INFORMATION. doi: /nature07461

Figure S1 Electrophysiology. a ph-activation of. Two-electrode voltage clamp recordings of Xenopus oocytes expressing in comparison to waterinjected oocytes. Currents were recorded at 40 mv. The ph of

Supporting Information

Supporting Information Structural Analysis of the Binding of Type I, I 1/2, and II Inhibitors to Eph Tyrosine Kinases Jing Dong, *1 Hongtao Zhao, 1 Ting Zhou, 1 Dimitrios Spiliotopoulos, 1 Chitra Rajendran,

type GroEL-GroES complex. Crystals were grown in buffer D (100 mm HEPES, ph 7.5,

Supplementary Material Supplementary Materials and Methods Structure Determination of SR1-GroES-ADP AlF x SR1-GroES-ADP AlF x was purified as described in Materials and Methods for the wild type GroEL-GroES

Gas Chromatography. Vaporization of sample Gas-solid Physical absorption Gas-liquid Liquid immobilized on inert solid

Gas Chromatography Vaporization of sample Gas-solid Physical absorption Gas-liquid Liquid immobilized on inert solid Principles Instrumentation Applications 18-1 Retention Volumes Volumes rather than times

Supplemental Information. Structural and Mechanistic Paradigm. of Leptin Receptor Activation Revealed

Structure, Volume 22 Supplemental Information Structural and Mechanistic Paradigm of Leptin Receptor Activation Revealed by Complexes with Wild-Type and Antagonist Leptins Kedar Moharana, Lennart Zabeau,

Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps

Cell Reports Supplemental Information Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps Chih-Chia Su, Jani Reddy Bolla, Nitin Kumar, Abhijith Radhakrishnan,

SUPPLEMENTARY INFORMATION

Supplementary Table 1: Data collection, phasing and refinement statistics ChbC/Ta 6 Br 12 Native ChbC Data collection Space group P4 3 2 1 2 P4 3 2 1 2 Cell dimensions a, c (Å) 132.75, 453.57 132.81, 452.95

Supporting Online Material for

www.sciencemag.org/cgi/content/full/310/5751/1159/dc1 Supporting Online Material for Structure of the Quaternary Complex of Interleukin-2 with Its α, β, and γ c Receptors Xinquan Wang, Mathias Rickert,

Supplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization

Supplementary Information Structural basis for precursor protein-directed ribosomal peptide macrocyclization Kunhua Li 1,3, Heather L. Condurso 1,3, Gengnan Li 1, Yousong Ding 2 and Steven D. Bruner 1*

Other Cells. Hormones. Viruses. Toxins. Cell. Bacteria

Other Cells Hormones Viruses Toxins Cell Bacteria ΔH < 0 reaction is exothermic, tells us nothing about the spontaneity of the reaction Δ H > 0 reaction is endothermic, tells us nothing about the spontaneity

Sample preparation and characterization around SAXS

Sample preparation and characterization around SAXS Experimental verification and validation? Rob Meijers EMBL Hamburg Garbage in? The right stuff Molecular weight Oligomerization state Monodispersity

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11524 Supplementary discussion Functional analysis of the sugar porter family (SP) signature motifs. As seen in Fig. 5c, single point mutation of the conserved

Supplemental Information. Molecular Basis of Spectral Diversity. in Near-Infrared Phytochrome-Based. Fluorescent Proteins

Chemistry & Biology, Volume 22 Supplemental Information Molecular Basis of Spectral Diversity in Near-Infrared Phytochrome-Based Fluorescent Proteins Daria M. Shcherbakova, Mikhail Baloban, Sergei Pletnev,

SUPPLEMENTARY INFORMATION

www.nature.com/nature 1 Figure S1 Sequence alignment. a Structure based alignment of the plgic of E. chrysanthemi (ELIC), the acetylcholine binding protein from the snail Lymnea stagnalis (AchBP, PDB code

Proteins are not rigid structures: Protein dynamics, conformational variability, and thermodynamic stability

Proteins are not rigid structures: Protein dynamics, conformational variability, and thermodynamic stability Dr. Andrew Lee UNC School of Pharmacy (Div. Chemical Biology and Medicinal Chemistry) UNC Med

MEASURING PROTEIN AGGREGATION WITH THE VISCOTEK SEC-MALS 20

MEASURING PROTEIN AGGREGATION WITH THE VISCOTEK SEC-MALS 20 Introduction Protein aggregation is recognised as a major issue in the biopharmaceutical industry. Proteins have a tendency to aggregate over

Supporting Information

Supporting Information Oxaliplatin binding to human copper chaperone Atox1 and protein dimerization Benny D. Belviso, 1 Angela Galliani, 2 Alessia Lasorsa, 2 Valentina Mirabelli, 1,3 Rocco Caliandro, 1

Protein supramolecular complex formation by site-specific avidin-biotin interactions

Protein supramolecular complex formation by site-specific avidin-biotin interactions Yutaro Mori, 1 Masahiro Goto, 1, 2 and Noriho Kamiya 1, 2 * 1 Department of Applied Chemistry, Graduate School of Engineering,

Harris: Quantitative Chemical Analysis, Eight Edition CHAPTER 25: CHROMATOGRAPHIC METHODS AND CAPILLARY ELECTROPHORESIS

Harris: Quantitative Chemical Analysis, Eight Edition CHAPTER 25: CHROMATOGRAPHIC METHODS AND CAPILLARY ELECTROPHORESIS CHAPTER 25: Opener Aa CHAPTER 25: Opener Ab CHAPTER 25: Opener B 25-1 Ion-Exchange

SUPPLEMENTARY INFORMATION

Dph2 SeMet (iron-free) # Dph2 (iron-free) Dph2-[4Fe-4S] Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell dimensions a, b, c (Å) 58.26, 82.08, 160.42 58.74, 81.87, 160.01 55.70, 80.53,

Supporting Information

Supporting Information Structural Basis of the Antiproliferative Activity of Largazole, a Depsipeptide Inhibitor of the Histone Deacetylases Kathryn E. Cole 1, Daniel P. Dowling 1,2, Matthew A. Boone 3,

High-resolution crystal structure of ERAP1 with bound phosphinic transition-state analogue inhibitor

High-resolution crystal structure of ERAP1 with bound phosphinic transition-state analogue inhibitor Petros Giastas 1, Margarete Neu 2, Paul Rowland 2, and Efstratios Stratikos 1 1 National Center for

Supplemental Information. Structures of the Zika Virus. Envelope Protein and Its Complex. with a Flavivirus Broadly Protective Antibody

Cell Host & Microbe, Volume 19 Supplemental Information Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody Lianpan Dai, Jian Song, Xishan Lu, Yong-Qiang

Advantages of Agilent AdvanceBio SEC Columns for Biopharmaceutical Analysis

Advantages of Agilent AdvanceBio SEC Columns for Biopharmaceutical Analysis Comparing Columns from Different Vendors to Improve Data Quality Technical Overview Introduction Size exclusion chromatography

SAXS and SANS facilities and experimental practice. Clement Blanchet

SAXS and SANS facilities and experimental practice Clement Blanchet SAS experiment Detector X-ray or neutron Beam Sample 2 s Buffer X-rays Roengten, 1895 Electromagnetic wave The electromagnetic spectrum

SUPPLEMENTARY INFORMATION

doi:1.138/nature1737 Supplementary Table 1 variant Description FSEC - 2B12 a FSEC - 6A1 a K d (leucine) c Leucine uptake e K (wild-type like) K (Y18F) K (TS) K (TSY) K288A mutant, lipid facing side chain

The structure of vanadium nitrogenase reveals an unusual bridging ligand

SUPPLEMENTARY INFORMATION The structure of vanadium nitrogenase reveals an unusual bridging ligand Daniel Sippel and Oliver Einsle Lehrstuhl Biochemie, Institut für Biochemie, Albert-Ludwigs-Universität

Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits. AhpC and AhpF from Escherichia coli

Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits AhpC and AhpF from Escherichia coli Phat Vinh Dip 1,#, Neelagandan Kamariah 2,#, Malathy Sony Subramanian Manimekalai

Examples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE

Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To

6. Reaction Chemistry

6. Reaction Chemistry 6.1 Chemical Elements 6.2 Chemical Bonding 6.3 Chemical Reactions 6.4 Thermodynamics 6.5 Properties of Water 6.6 Important Biomolecules 6.1 Chemical Elements It is common for elements

The copper active site in CBM33 polysaccharide oxygenases

Supporting Information for: The copper active site in CBM33 polysaccharide oxygenases Glyn R. Hemsworth, Edward J. Taylor, Robbert Q. Kim, Rebecca C. Gregory, Sally J. Lewis, Johan P. Turkenburg, Alison

DSC Characterization of the Structure/Function Relationship for Proteins

DSC Characterization of the Structure/Function Relationship for Proteins Differential Scanning Calorimetry (DSC) DSC is recognized as Gold Std technique for measuring molecular thermal stability and structure

Sunhats for plants. How plants detect dangerous ultraviolet rays

Sunhats for plants How plants detect dangerous ultraviolet rays Anyone who has ever suffered sunburn will know about the effects of too much ultraviolet (UV) radiation, in particular UV-B (from 280-315

Supplemental Methods. Protein expression and purification

Supplemental Methods Protein expression and purification The isolated collagen-binding domain of hlair-1, amino acid 22-122, was cloned into pet3xa using introduced BamHI and NotI sites at the 5 and 3

SUPPLEMENTARY INFORMATION

Table of Contents Page Supplementary Table 1. Diffraction data collection statistics 2 Supplementary Table 2. Crystallographic refinement statistics 3 Supplementary Fig. 1. casic1mfc packing in the R3

THE CRYSTAL STRUCTURE OF THE SGT1-SKP1 COMPLEX: THE LINK BETWEEN

THE CRYSTAL STRUCTURE OF THE SGT1-SKP1 COMPLEX: THE LINK BETWEEN HSP90 AND BOTH SCF E3 UBIQUITIN LIGASES AND KINETOCHORES Oliver Willhoft, Richard Kerr, Dipali Patel, Wenjuan Zhang, Caezar Al-Jassar, Tina

Chapter 27: Gas Chromatography

Chapter 27: Gas Chromatography Gas Chromatography Mobile phase (carrier gas): gas (He, N 2, H 2 ) - do not interact with analytes - only transport the analyte through the column Analyte: volatile liquid

ENZYME MECHANISMS, PROTEASES, STRUCTURAL BIOLOGY

Supplementary Information SUBJECT AREAS: ENZYME MECHANISMS, PROTEASES, STRUCTURAL BIOLOGY Correspondence and requests for materials should be addressed to N.T. (ntanaka@pharm.showa-u.ac.jp) or W.O. (owataru@vos.nagaokaut.ac.jp)

Supplementary Figure 1. Stability constants of metal monohydroxides. The log K values are summarized according to the atomic number of each element

Supplementary Figure 1. Stability constants of metal monohydroxides. The log K values are summarized according to the atomic number of each element as determined in a previous study 1. The log K value

Gel Permeation Chromatography (GPC) or Size Exclusion Chromatography (SEC)

Gel Permeation Chromatography (GPC) or Size Exclusion Chromatography (SEC) Size Exclusion Chromatography (SEC) is a non-interaction based separation mechanism in which compounds are retained for different

SGE is excited to launch a new HPLC product line under the ProteCol brand.

The Role of Pore Size in Reversed Phase HPLC SGE is excited to launch a new HPLC product line under the ProteCol brand. Fundamental to the new ProteCol line of columns is the continued focus on inert column

Chem 321 Name Answer Key D. Miller

1. For a reversed-phase chromatography experiment, it is noted that the retention time of an analyte decreases as the percent of acetonitrile (CH 3 CN) increases in a CH 3 CN/H 2 O mobile phase. Explain

Crystal lattice Real Space. Reflections Reciprocal Space. I. Solving Phases II. Model Building for CHEM 645. Purified Protein. Build model.

I. Solving Phases II. Model Building for CHEM 645 Purified Protein Solve Phase Build model and refine Crystal lattice Real Space Reflections Reciprocal Space ρ (x, y, z) pronounced rho F hkl 2 I F (h,

Protein-Ligand Interactions: hydrodynamics and calorimetry

Protein-Ligand Interactions: hydrodynamics and calorimetry Approach Stephen E. Harding Babur Z. Chowdhry OXFORD UNIVERSITY PRESS , New York Oxford University Press, 2001 978-0-19-963746-1 List of protocols

Supplementary Information

Supplementary Information Structural analysis of leader peptide binding enables leaderfree cyanobactin processing Jesko Koehnke 1,2, Greg Mann 1,2, Andrew F Bent 1,2, Hannes Ludewig 1, Sally Shirran 1,

Chromatographic Analysis

Chromatographic Analysis Distribution of Analytes between Phases An analyte is in equilibrium between the two phases [S 1 ] [S 2 ] (in phase 1) (in phase 2) AS [S2 ] K 2 A S [S1 ] 1 AS, A 1 S Activity

Supporting Information

Supporting Information Gold Nanoparticle Dimers for Plasmon Sensing Yunan Cheng, 1,2,3 Mang Wang, 1 Gustaaf Borghs, * 2,3 Hongzheng Chen * 1 1. MOE Key Laboratory of Macromolecule Synthesis and Functionalization,

S2004 Methods for characterization of biomolecular interactions - classical versus modern

S2004 Methods for characterization of biomolecular interactions - classical versus modern Isothermal Titration Calorimetry (ITC) Eva Dubská email: eva.dubska@ceitec.cz Outline Calorimetry - history + a

16 years ago TODAY (9/11) at 8:46, the first tower was hit at 9:03, the second tower was hit. Lecture 2 (9/11/17)

16 years ago TODAY (9/11) at 8:46, the first tower was hit at 9:03, the second tower was hit By Anthony Quintano - https://www.flickr.com/photos/quintanomedia/15071865580, CC BY 2.0, https://commons.wikimedia.org/w/index.php?curid=38538291

Solutions and Non-Covalent Binding Forces

Chapter 3 Solutions and Non-Covalent Binding Forces 3.1 Solvent and solution properties Molecules stick together using the following forces: dipole-dipole, dipole-induced dipole, hydrogen bond, van der

Big Idea 1: Structure of Matter Learning Objective Check List

Big Idea 1: Structure of Matter Learning Objective Check List Structure of Matter Mole Concept: Empirical Formula, Percent Composition, Stoichiometry Learning objective 1.1 The student can justify the

Lecture 4 : Gel Permeation or Size Exclusion Chromatography

Lecture 4 : Gel Permeation or Size Exclusion Chromatography Polymer Fractionation Sedimentation Centrifugation Evaporation of the solvent Gel permeation chromatography Gel Permeation Chromatography (GPC)

schematic diagram; EGF binding, dimerization, phosphorylation, Grb2 binding, etc.

Lecture 1: Noncovalent Biomolecular Interactions Bioengineering and Modeling of biological processes -e.g. tissue engineering, cancer, autoimmune disease Example: RTK signaling, e.g. EGFR Growth responses

Name: Date: A) B) C) D) E)

Name: Date: 1. A microwave oven operating at 1.22 10 8 nm is used to heat 150 ml of water from 20ºC to 100ºC. What is the number of photons needed if all the microwave energy is converted to thermal energy

specified quantity of a solvent at a given temperature. To deconvolute the value from the

S.1 Calculations of Dilution Enthalpy and Enthalpic Interaction Coefficients. When a solute is dissolved in a solvent a solution is formed. During dissolution of a solute in any solvent, heat is either

Microcalorimetry for the Life Sciences

Microcalorimetry for the Life Sciences Why Microcalorimetry? Microcalorimetry is universal detector Heat is generated or absorbed in every chemical process In-solution No molecular weight limitations Label-free

SUPPLEMENTARY INFORMATION

doi:10.1038/nature10458 Active Site Remodeling in the Bifunctional Fructose-1,6- bisphosphate aldolase/phosphatase Juan Du, Rafael F. Say, Wei Lü, Georg Fuchs & Oliver Einsle SUPPLEMENTARY FIGURES Figure

BSc and MSc Degree Examinations

Examination Candidate Number: Desk Number: BSc and MSc Degree Examinations 2018-9 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes Marking

Acta Crystallographica Section D

Supporting information Acta Crystallographica Section D Volume 70 (2014) Supporting information for article: Structural basis of the heterodimerization of the MST and RASSF SARAH domains in the Hippo signalling

Interaction of Gold Nanoparticle with Proteins

Chapter 7 Interaction of Gold Nanoparticle with Proteins 7.1. Introduction The interfacing of nanoparticle with biomolecules such as protein is useful for applications ranging from nano-biotechnology (molecular

Electronic Supplementary Information (ESI) for Chem. Commun. Unveiling the three- dimensional structure of the green pigment of nitrite- cured meat

Electronic Supplementary Information (ESI) for Chem. Commun. Unveiling the three- dimensional structure of the green pigment of nitrite- cured meat Jun Yi* and George B. Richter- Addo* Department of Chemistry

Chromatography Outline

Chem 2001 Summer 2004 Outline What is? The Chromatogram Optimization of Column Performance Why Do Bands Spread? Gas High-Performance Liquid Ion-Exchange 2 What is? In chromatography, separation is achieved

Diphthamide biosynthesis requires a radical iron-sulfur enzyme. Pennsylvania State University, University Park, Pennsylvania 16802, USA

Diphthamide biosynthesis requires a radical iron-sulfur enzyme Yang Zhang, 1,4 Xuling Zhu, 1,4 Andrew T. Torelli, 1 Michael Lee, 2 Boris Dzikovski, 1 Rachel Koralewski, 1 Eileen Wang, 1 Jack Freed, 1 Carsten

Solvent & geometric effects on non-covalent interactions

Solvent & geometric effects on non-covalent interactions Scott L. Cockroft PhysChem Forum 10, Syngenta, Jealott s Hill, 23 rd March 11 QSAR & Physical Organic Chemistry Quantifiable Physicochemical Properties

8. Methods in Developing Mobile Phase Condition for C18 Column

I. HPLC Columns Technical Information 8. Methods in Developing Mobile Phase Condition for C18 Column Introduction In reversed phase HPLC, octadecyl group bonded silica columns (C18, ODS) are the most widely

According to the manufacture s direction (Pierce), RNA and DNA

Supplementary method Electrophoretic Mobility-shift assay (EMSA) According to the manufacture s direction (Pierce), RNA and DNA oligonuleotides were firstly labeled by biotin. TAVb (1pM) was incubated

Basic Chemistry 2014 Timberlake

A Correlation of Basic Chemistry Timberlake Advanced Placement Chemistry Topics AP is a trademark registered and/or owned by the College Board, which was not involved in the production of, and does not

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11744 Supplementary Table 1. Crystallographic data collection and refinement statistics. Wild-type Se-Met-BcsA-B SmCl 3 -soaked EMTS-soaked Data collection Space

Dental Biochemistry EXAM I

Dental Biochemistry EXAM I August 29, 2005 In the reaction below: CH 3 -CH 2 OH -~ ethanol CH 3 -CHO acetaldehyde A. acetoacetate is being produced B. ethanol is being oxidized to acetaldehyde C. acetaldehyde

Comparison of Polymer Separation by Size Exclusion Chromatography and Asymmetric Flow Field Flow Fractionation

Comparison of Polymer Separation by Size Exclusion Chromatography and Asymmetric Flow Field Flow Fractionation Stepan Podzimek, 1 Christoph Johann 2 1 SYNPO / University of Pardubice, Czech Republic, stepan.podzimek@synpo.cz

Biological Anion Receptors

Binding of Anions 1 Binding of Anions 2 Biological Anion Receptors 3 Concepts in Anion Host Design FACTORS WITCH AFFECT ANION COMPLEXATION Prevailing interactions which take place in anion binding: hydrogen

ID14-EH3. Adam Round

Bio-SAXS @ ID14-EH3 Adam Round Contents What can be obtained from Bio-SAXS Measurable parameters Modelling strategies How to collect data at Bio-SAXS Procedure Data collection tests Data Verification and

Helpful resources for all X ray lectures Crystallization http://www.hamptonresearch.com under tech support: crystal growth 101 literature Spacegroup tables http://img.chem.ucl.ac.uk/sgp/mainmenu.htm Crystallography

Stabilizing the CH2 domain of an Antibody by Engineering in an Enhanced Aromatic Sequon

Stabilizing the CH2 domain of an Antibody by Engineering in an Enhanced Aromatic Sequon Wentao Chen,, Leopold Kong, Stephen Connelly, Julia M. Dendle,, Yu Liu,, Ian A. Wilson,#, Evan T. Powers, *, Jeffery

A single crystal investigation of L-tryptophan with Z = 16

1 A single crystal investigation of L-tryptophan with Z = 16 Carl Henrik Görbitz, Karl Wilhelm Törnroos and Graeme Day Supplementary material 1. Figure 1S (below). Overlay of the eight molecules A, B,

RNA protects a nucleoprotein complex against radiation damage

Supporting information Volume 72 (2016) Supporting information for article: RNA protects a nucleoprotein complex against radiation damage Charles S. Bury, John E. McGeehan, Alfred A. Antson, Ian Carmichael,

Energetics of chitooligosaccharide binding to pumpkin (Cucurbita maxima) phloem exudate Lectin

Chapter 3 Energetics of chitooligosaccharide binding to pumpkin (Cucurbita maxima) phloem exudate Lectin 50 Chapter 3 Energetics of 51 Summary Binding of chitooligosaccharides [(GlcNAc) 2-6 ] to pumpkin

1. Ion exchange chromatography

1. Ion exchange chromatography Ion Exchange Chromatography Most popular method for the separation or purification of charged molecules. In cation exchange chromatography, positively charged molecules are

Classroom: 318 Subject: AP Chemistry Quarter 2 Teacher: van Balveren, Suzanne

Livingston American School Quarterly Lesson Plan Concept / Topic To Teach: Week 1 Week 2 Week 3 Week 4 Bonding: General concepts Covalent Bonding: Orbitals Properties of solutions Properties of solutions

Chemistry Instrumental Analysis Lecture 28. Chem 4631

Chemistry 4631 Instrumental Analysis Lecture 28 High Performance Liquid Chromatography () Instrumentation Normal Phase Chromatography Normal Phase - a polar stationary phase with a less polar mobile phase.

Redox-Responsive Complexation between a. Pillar[5]arene with Mono ethylene oxide Substituents. and Paraquat

Redox-Responsive Complexation between a Pillar[5]arene with Mono ethylene oxide Substituents and Paraquat Xiaodong Chi, Min Xue, Yong Yao and Feihe Huang* MOE Key Laboratory of Macromolecular Synthesis

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature12242 C. thermophilum 666 RPAVLDNVYIRPALE-GKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQN S. pombe 659 RPAHINDVYVRPAID-GKRLPGFIEIHQNGIRYQSPLRSDSHIDLLFSNMKHLFFQPCEG

Static and dynamic light scattering. Cy Jeffries EMBL Hamburg

Static and dynamic light scattering. Cy Jeffries EMBL Hamburg Introduction. The electromagnetic spectrum. visible 10-16 10-10 10-8 10-4 10-2 10 4 (l m) g-rays X-rays UV IR micro wave Long radio waves 400