, Work in progress
|
|
- Ernest Matthews
- 5 years ago
- Views:
Transcription
1 , Work in progress Samuel Blanquart, CR2 INRIA, EPI Bonsai 12 juin 2012
2 Researches, animation and teaching Animation : Phylogeny-days, next week! Teaching : Algorithm and Application for 28 master 1 students (24h). Teaching : Phylogenetics for Ecology and Environment master 1 students (4 hours). Teaching : coaching 3 Individual Projects (PJI), 6 master 1 students (how many hours?). Researches : Invention and conservation of alternative splicings in mammalians (INSERM Lille), Researches : Last answers on the PopPhyl ERC project (ISEM, Montpellier), Researches : The oldest resurrected yet functional enzyme (Regensburg University), Researches : Adaptation to hyper-halophily through enzyme resurrection, still looking for...funding... Other awaiting projects and collaborations.
3 Virtuamium, an eco-info project fossilized since 2002 PJI students, Cyril Capilliez and Clément Boidin. Context : Agent Oriented (AO) logic might be helpful in modeling population genetics, demographics and evolution. Current objective : Implementing a generalized model for arbitrarily complex and evolvable ecological relationships. Perspective : What are tree shapes under realistic ecological models? What about emergence phenomenons? etc.
4 Virtuamium, an eco-info project fossilized since 2002 Separating life-parameters which are specific to species and individuals from a generalized pedator-prey behavior mechanism. Description of a universal pedator-prey automaton executing individuals actions given a species and an individual context. Cloning or sexual reproduction introducing random evolvability over mutable parameter (hunting/hunted-by list, speeds, mass...)
5 Collaboration with Gabriel Bidaux, Laboratory of cell physiology, INSERM U1003 Lille Context : Gabriel has identified many unknown exons in the human TRPM8. Current objective : Determining when those newly identified exons did appear during terrestrial vertebrate evolution. Methods : Full gene region alignment (MAUVE) and alignment analysis.
6 Splicing : Conservation of splice-acceptor sites
7 Splicing : Conservation of splice-donor sites
8 Traduction : Conservation of START codon
9 Traduction : Conservation of STOP codon To be done know : Analyse 3 UTR poly A queues, Validation of prediction in Mus musculus, Writing the paper...
10 ERC PopPhyl, identifying systematic biases in empirical matrices of amino acid replacement 25 empirical replacement matrices were built for 25 metazoan taxonomic levels.
11 ERC PopPhyl, identifying systematic biases in empirical matrices of amino acid replacement How do they differ from each others?
12 ERC PopPhyl, identifying systematic biases in empirical matrices of amino acid replacement First axis of the PCA correlates with replacement rates of amino-acids having codons differing at all 3 positions.
13 Tools for ancestral sequences analysis? PJI, master 1 students : Benoît-Charles Detuncq, Yannick Leroy, Thomas Clément : Viewers for modern and ancestral sequence alignments, and for phylogenetic trees are combined into a same interface, 2012 : introduction of PDB 3D protein models into the interface. Objective : save structural-biologists from madness...
14 a LUCA s Tim barrel resurrected? Computational and Experimental Evidence for the Evolution of a (αβ)8-barrel Protein from an Ancestral Quarter-Barrel Stabilised by Disulfide Bonds. Richter et al JMB.
15 a LUCA s Tim barrel resurrected? In Richter et al 2010, we proposed a scenario of the HisF evolutionary history based on the inferred ancestral sequences, with monomer duplications and gene fusions.
16 a LUCA s Tim barrel resurrected? The ancestral HisF inferred at the bacterial and archaeal MRCA (presumably close to the LUCA) has now been synthesized. It is functional, has the same catalytic activity as modern enzymes, and is stable up to 70 C.
17 Ancestral MalDH of hyperthermophilic Archaea are still waiting for funds! Collaboration with IBS Grenoble, LBBE Lyon, and Ecole Polytechnique Paris. Waiting for ANR acceptance (7 th on waiting list this year...)
18 Other awaiting works and collaborations Many paper to write now. Still need to maintain, hotline, finish, optimize and parallelize a few models of molecular evolution. Pursue the work on genomes rearrangement started with JS, Aïda and GEPV (waiting for Aïda, and for region funds), Evolution of NRPS with Maude, some interesting preliminary results of Aurélien about the domains phylogeny. Beside of my results in the ERC PopPhyl with implication for taxonomic annotation of metagenomes : building a 2000 metazoan mitochondrial genes tree and generalize the taxa-sampling approach for the computation of large but reliable phylogenies.
, Work in progress
2012-2013, Work in progress Samuel Blanquart, CR2 INRIA, EPI Bonsai 10 juin 2013 2012 2013 : Researches, animation and teaching Teaching : Algorithm and Application for 20 master 1 students (24h). Teaching
More informationThe practice of naming and classifying organisms is called taxonomy.
Chapter 18 Key Idea: Biologists use taxonomic systems to organize their knowledge of organisms. These systems attempt to provide consistent ways to name and categorize organisms. The practice of naming
More informationCHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
More informationChapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
More informationSCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
More informationChapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
More informationWarm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab
Date: Agenda Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Ask questions based on 5.1 and 5.2 Quiz on 5.1 and 5.2 How
More informationName: Class: Date: ID: A
Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change
More informationPhylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
More informationMicrobial Taxonomy and the Evolution of Diversity
19 Microbial Taxonomy and the Evolution of Diversity Copyright McGraw-Hill Global Education Holdings, LLC. Permission required for reproduction or display. 1 Taxonomy Introduction to Microbial Taxonomy
More informationO 3 O 4 O 5. q 3. q 4. Transition
Hidden Markov Models Hidden Markov models (HMM) were developed in the early part of the 1970 s and at that time mostly applied in the area of computerized speech recognition. They are first described in
More information10 Biodiversity Support. AQA Biology. Biodiversity. Specification reference. Learning objectives. Introduction. Background
Biodiversity Specification reference 3.4.5 3.4.6 3.4.7 Learning objectives After completing this worksheet you should be able to: recall the definition of a species and know how the binomial system is
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationLowndes County Biology II Pacing Guide Approximate
Lowndes County Biology II Pacing Guide 2009-2010 MS Frameworks Pacing Guide Worksheet Grade Level: Biology II Grading Period: 1 st 9 weeks Chapter/Unit Lesson Topic Objective Number 1 The Process of 1.
More informationAP BIOLOGY SUMMER ASSIGNMENT
AP BIOLOGY SUMMER ASSIGNMENT Welcome to EDHS Advanced Placement Biology! The attached summer assignment is required for all AP Biology students for the 2011-2012 school year. The assignment consists of
More informationMACROEVOLUTION Student Packet SUMMARY EVOLUTION IS A CHANGE IN THE GENETIC MAKEUP OF A POPULATION OVER TIME Macroevolution refers to large-scale
MACROEVOLUTION Student Packet SUMMARY EVOLUTION IS A CHANGE IN THE GENETIC MAKEUP OF A POPULATION OVER TIME Macroevolution refers to large-scale evolutionary changes such as speciation events, origin of
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationOutline. Genome Evolution. Genome. Genome Architecture. Constraints on Genome Evolution. New Evolutionary Synthesis 11/8/16
Genome Evolution Outline 1. What: Patterns of Genome Evolution Carol Eunmi Lee Evolution 410 University of Wisconsin 2. Why? Evolution of Genome Complexity and the interaction between Natural Selection
More informationNGSS UNIT OVERVIEW EVOLUTION
UNIT SPECIFIC RESOURCES TEACHER RESOURCES IV NGSS UNIT OVERVIEW EVOLUTION Performance Expectation MS-LS4-1: Analyze interpret data for patterns in the fossil record that document the existence, diversity,
More informationADVANCED PLACEMENT BIOLOGY
ADVANCED PLACEMENT BIOLOGY Description Advanced Placement Biology is designed to be the equivalent of a two-semester college introductory course for Biology majors. The course meets seven periods per week
More informationPrentice Hall. Biology: Concepts and Connections, 6th edition 2009, (Campbell, et. al) High School
Prentice Hall Biology: Concepts and Connections, 6th edition 2009, (Campbell, et. al) High School C O R R E L A T E D T O Correlation to the Mississippi Curriculum Frameworks - Biology II (High School)
More informationSPECIATION. REPRODUCTIVE BARRIERS PREZYGOTIC: Barriers that prevent fertilization. Habitat isolation Populations can t get together
SPECIATION Origin of new species=speciation -Process by which one species splits into two or more species, accounts for both the unity and diversity of life SPECIES BIOLOGICAL CONCEPT Population or groups
More information8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
More informationOutline. Genome Evolution. Genome. Genome Architecture. Constraints on Genome Evolution. New Evolutionary Synthesis 11/1/18
Genome Evolution Outline 1. What: Patterns of Genome Evolution Carol Eunmi Lee Evolution 410 University of Wisconsin 2. Why? Evolution of Genome Complexity and the interaction between Natural Selection
More informationTaxonomy. Content. How to determine & classify a species. Phylogeny and evolution
Taxonomy Content Why Taxonomy? How to determine & classify a species Domains versus Kingdoms Phylogeny and evolution Why Taxonomy? Classification Arrangement in groups or taxa (taxon = group) Nomenclature
More informationBiology 211 (2) Week 1 KEY!
Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of
More informationThe Science of Biology. Chapter 1
The Science of Biology Chapter 1 Properties of Life Living organisms: are composed of cells are complex and ordered respond to their environment can grow and reproduce obtain and use energy maintain internal
More informationMacroevolution Part I: Phylogenies
Macroevolution Part I: Phylogenies Taxonomy Classification originated with Carolus Linnaeus in the 18 th century. Based on structural (outward and inward) similarities Hierarchal scheme, the largest most
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationPhylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
More informationUnit # - Title Intro to Biology Unit 1 - Scientific Method Unit 2 - Chemistry
Intro to Biology Unit 1 - Scientific Method Unit 2 - Chemistry What is Biology? What is Science? What tools, skills, knowledge, and dispositions are needed to conduct scientific inquiry? How do the rules
More informationR.S. Kittrell Biology Wk 10. Date Skill Plan
Day of Wee k Date Skill Plan M 11/10/14 Unit 3:DNA, Protein Synthesis, Genetics and Biotechnology ALL Obj. #= 3.2.2 Unit? = # 1,3, 'I will' = # 6,7 Obj = Individual Focus Opening: Discuss Ghost in your
More informationChapter 19: Taxonomy, Systematics, and Phylogeny
Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand
More informationChapter 19 Organizing Information About Species: Taxonomy and Cladistics
Chapter 19 Organizing Information About Species: Taxonomy and Cladistics An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics
More informationChapter 16: Reconstructing and Using Phylogenies
Chapter Review 1. Use the phylogenetic tree shown at the right to complete the following. a. Explain how many clades are indicated: Three: (1) chimpanzee/human, (2) chimpanzee/ human/gorilla, and (3)chimpanzee/human/
More informationIntroduction to Digital Evolution Handout Answers
Introduction to Digital Evolution Handout Answers Note to teacher: The questions in this handout and the suggested answers (in red, below) are meant to guide discussion, not be an assessment. It is recommended
More informationReconstructing the history of lineages
Reconstructing the history of lineages Class outline Systematics Phylogenetic systematics Phylogenetic trees and maps Class outline Definitions Systematics Phylogenetic systematics/cladistics Systematics
More informationMiller & Levine Biology 2014
A Correlation of Miller & Levine Biology To the Essential Standards for Biology High School Introduction This document demonstrates how meets the North Carolina Essential Standards for Biology, grades
More informationSEQUENCE DIVERGENCE,FUNCTIONAL CONSTRAINT, AND SELECTION IN PROTEIN EVOLUTION
Annu. Rev. Genomics Hum. Genet. 2003. 4:213 35 doi: 10.1146/annurev.genom.4.020303.162528 Copyright c 2003 by Annual Reviews. All rights reserved First published online as a Review in Advance on June 4,
More informationBiology Curriculum Pacing Guide MONTGOMERY COUNTY PUBLIC SCHOOLS
MONTGOMERY COUNTY PUBLIC SCHOOLS Biology Curriculum Pacing Guide 1 st 9 Weeks SOL Objectives Vocabulary 7 Days 14 Days BIO.1 The student will demonstrate an understanding of scientific reasoning, logic,
More informationC.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
More informationTopics. Antibiotic resistance, changing environment LITERACY MATHEMATICS. Traits, variation, population MATHEMATICS
UNIT OVERVIEW EVOLUTION Listed below is a summary of the activities in this unit. Note that the total teaching time is listed as 9 34 periods of approximately 45 50 minutes (approximately 6-7 weeks). 1.
More informationMiGA: The Microbial Genome Atlas
December 12 th 2017 MiGA: The Microbial Genome Atlas Jim Cole Center for Microbial Ecology Dept. of Plant, Soil & Microbial Sciences Michigan State University East Lansing, Michigan U.S.A. Where I m From
More informationHow should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
More informationGRADE 6 SCIENCE REVISED 2014
QUARTER 1 Developing and Using Models Develop and use a model to describe phenomena. (MS-LS1-2) Develop a model to describe unobservable mechanisms. (MS-LS1-7) Planning and Carrying Out Investigations
More informationElements of Bioinformatics 14F01 TP5 -Phylogenetic analysis
Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila
More informationMETHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
More informationAP Biology Notes Outline Enduring Understanding 1.B. Big Idea 1: The process of evolution drives the diversity and unity of life.
AP Biology Notes Outline Enduring Understanding 1.B Big Idea 1: The process of evolution drives the diversity and unity of life. Enduring Understanding 1.B: Organisms are linked by lines of descent from
More informationPhylogeny is the evolutionary history of a group of organisms. Based on the idea that organisms are related by evolution
Bio 1M: Phylogeny and the history of life 1 Phylogeny S25.1; Bioskill 11 (2ndEd S27.1; Bioskills 3) Bioskills are in the back of your book Phylogeny is the evolutionary history of a group of organisms
More informationBIOLOGY 432 Midterm I - 30 April PART I. Multiple choice questions (3 points each, 42 points total). Single best answer.
BIOLOGY 432 Midterm I - 30 April 2012 Name PART I. Multiple choice questions (3 points each, 42 points total). Single best answer. 1. Over time even the most highly conserved gene sequence will fix mutations.
More informationUnderstanding relationship between homologous sequences
Molecular Evolution Molecular Evolution How and when were genes and proteins created? How old is a gene? How can we calculate the age of a gene? How did the gene evolve to the present form? What selective
More informationOrigins of Life. Fundamental Properties of Life. Conditions on Early Earth. Evolution of Cells. The Tree of Life
The Tree of Life Chapter 26 Origins of Life The Earth formed as a hot mass of molten rock about 4.5 billion years ago (BYA) -As it cooled, chemically-rich oceans were formed from water condensation Life
More informationMissouri Educator Gateway Assessments
Missouri Educator Gateway Assessments June 2014 Content Domain Range of Competencies Approximate Percentage of Test Score I. Science and Engineering Practices 0001 0003 21% II. Biochemistry and Cell Biology
More informationUoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)
- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the
More informationSCOTCAT Credits: 20 SCQF Level 7 Semester 1 Academic year: 2018/ am, Practical classes one per week pm Mon, Tue, or Wed
Biology (BL) modules BL1101 Biology 1 SCOTCAT Credits: 20 SCQF Level 7 Semester 1 10.00 am; Practical classes one per week 2.00-5.00 pm Mon, Tue, or Wed This module is an introduction to molecular and
More informationCollege of Arts and Sciences, University of Oregon (Fall 2014)
Curriculum map Biology B.S./B.A. (Marine Biology LOs on page 4) Learning outcomes (LOs): Having completed a major in Biology, a student will demonstrate: 1. A broad-based knowledge of biology at multiple
More informationGoal 1: Develop knowledge and understanding of core content in biology
Indiana State University» College of Arts & Sciences» Biology BA/BS in Biology Standing Requirements s Library Goal 1: Develop knowledge and understanding of core content in biology 1: Illustrate and examine
More informationMicrobes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible.
Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional
More informationMicrobial Taxonomy. Slowly evolving molecules (e.g., rrna) used for large-scale structure; "fast- clock" molecules for fine-structure.
Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional
More informationOutline. Classification of Living Things
Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics
More informationLecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationFor Classroom Trial Testing
For Classroom Trial Testing Video Description Secrets of the Sequence, Show 141, Episode 2 From Slime to Sublime approximately 10 minutes viewing time While we are similar to our fellow man in size, shape,
More informationCourse Name: Biology Level: A Points: 5 Teacher Name: Claire E. Boudreau
Course Name: Biology Level: A Points: 5 Teacher Name: Claire E. Boudreau Texts/Instructional Materials: Biology : Concepts and Connections 5 th edition Campbell, Reece, Taylor and Simon Pearson Syllabus:
More informationMajor questions of evolutionary genetics. Experimental tools of evolutionary genetics. Theoretical population genetics.
Evolutionary Genetics (for Encyclopedia of Biodiversity) Sergey Gavrilets Departments of Ecology and Evolutionary Biology and Mathematics, University of Tennessee, Knoxville, TN 37996-6 USA Evolutionary
More informationHMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM
I529: Machine Learning in Bioinformatics (Spring 2017) HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University, Bloomington
More informationPhylogeny & Systematics
Phylogeny & Systematics Phylogeny & Systematics An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics has revealed that despite
More informationWhat can sequences tell us?
Bioinformatics What can sequences tell us? AGACCTGAGATAACCGATAC By themselves? Not a heck of a lot...* *Indeed, one of the key results learned from the Human Genome Project is that disease is much more
More informationText of objective. Investigate and describe the structure and functions of cells including: Cell organelles
This document is designed to help North Carolina educators teach the s (Standard Course of Study). NCDPI staff are continually updating and improving these tools to better serve teachers. Biology 2009-to-2004
More informationFundamentals of Biology Valencia College BSC1010C
1 Fundamentals of Biology Valencia College BSC1010C 1 Studying Life Chapter objectives: What Is Biology? Is All Life on Earth Related? How Do Biologists Investigate Life? How Does Biology Influence Public
More informationProperties of Life. Levels of Organization. Levels of Organization. Levels of Organization. Levels of Organization. The Science of Biology.
The Science of Biology Chapter 1 Properties of Life Living organisms: are composed of cells are complex and ordered respond to their environment can grow and reproduce obtain and use energy maintain internal
More informationChapter 19. Microbial Taxonomy
Chapter 19 Microbial Taxonomy 12-17-2008 Taxonomy science of biological classification consists of three separate but interrelated parts classification arrangement of organisms into groups (taxa; s.,taxon)
More informationMultiple Choice Review- Eukaryotic Gene Expression
Multiple Choice Review- Eukaryotic Gene Expression 1. Which of the following is the Central Dogma of cell biology? a. DNA Nucleic Acid Protein Amino Acid b. Prokaryote Bacteria - Eukaryote c. Atom Molecule
More informationPHYLOGENY AND SYSTEMATICS
AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study
More informationPatterns of Evolution
Patterns of Evolution A tree that represents an estimate (hypothesis) of evolutionary relatedness is a phylogeny Classifications can be based on groupings within a phylogeny Groupings can be categorized
More informationSex accelerates adaptation
Molecular Evolution Sex accelerates adaptation A study confirms the classic theory that sex increases the rate of adaptive evolution by accelerating the speed at which beneficial mutations sweep through
More informationI519 Introduction to Bioinformatics, Genome Comparison. Yuzhen Ye School of Informatics & Computing, IUB
I519 Introduction to Bioinformatics, 2015 Genome Comparison Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Whole genome comparison/alignment Build better phylogenies Identify polymorphism
More informationCENTER FOR BIOLOGICAL SEQUENCE ANALYSIS. Introduction to the Theory of Evolution: Common Descent
Introduction to the Theory of Evolution: Common Descent Classification: Linnaeus Carl Linnaeus 1707-1778 Classification: Linnaeus Hierarchical system Kingdom! Phylum! Class! Order! Family! Genus! Species!
More informationClassifications can be based on groupings g within a phylogeny
Patterns of Evolution A tree that represents an estimate (hypothesis) of evolutionary relatedness is a phylogeny Classifications can be based on groupings g within a phylogeny y Groupings can be categorized
More informationC3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
More informationI. Molecules and Cells: Cells are the structural and functional units of life; cellular processes are based on physical and chemical changes.
I. Molecules and Cells: Cells are the structural and functional units of life; cellular processes are based on physical and chemical changes. A. Chemistry of Life B. Cells 1. Water How do the unique chemical
More informationMolecular evolution - Part 1. Pawan Dhar BII
Molecular evolution - Part 1 Pawan Dhar BII Theodosius Dobzhansky Nothing in biology makes sense except in the light of evolution Age of life on earth: 3.85 billion years Formation of planet: 4.5 billion
More information3/1/17. Content. TWINSCAN model. Example. TWINSCAN algorithm. HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM
I529: Machine Learning in Bioinformatics (Spring 2017) Content HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University,
More informationRange of Competencies
BIOLOGY Content Domain Range of Competencies l. Nature of Science 0001 0003 20% ll. Biochemistry and Cell Biology 0004 0005 13% lll. Genetics and Evolution 0006 0009 27% lv. Biological Unity and Diversity
More informationThe Science of Biology. Chapter 1
The Science of Biology Chapter 1 Properties of Life Living organisms: are composed of cells are complex and ordered respond to their environment can grow and reproduce obtain and use energy maintain internal
More informationClassification, Phylogeny yand Evolutionary History
Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize
More informationChapter Chemical Uniqueness 1/23/2009. The Uses of Principles. Zoology: the Study of Animal Life. Fig. 1.1
Fig. 1.1 Chapter 1 Life: Biological Principles and the Science of Zoology BIO 2402 General Zoology Copyright The McGraw Hill Companies, Inc. Permission required for reproduction or display. The Uses of
More informationNewly made RNA is called primary transcript and is modified in three ways before leaving the nucleus:
m Eukaryotic mrna processing Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: Cap structure a modified guanine base is added to the 5 end. Poly-A tail
More informationPhylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
More informationUnit of Study: Genetics, Evolution and Classification
Biology 3 rd Nine Weeks TEKS Unit of Study: Genetics, Evolution and Classification B.1) Scientific Processes. The student, for at least 40% of instructional time, conducts laboratory and field investigations
More informationEukaryotic vs. Prokaryotic genes
BIO 5099: Molecular Biology for Computer Scientists (et al) Lecture 18: Eukaryotic genes http://compbio.uchsc.edu/hunter/bio5099 Larry.Hunter@uchsc.edu Eukaryotic vs. Prokaryotic genes Like in prokaryotes,
More informationBiology, Ongoing Expectations
2017.18 Biology, Ongoing Expectations Big Ideas/Key Concepts: Understandings about scientific inquiry and the ability to conduct inquiry are essential for living in the 21 st century. Society benefits
More informationCurriculum Map. Biology, Quarter 1 Big Ideas: From Molecules to Organisms: Structures and Processes (BIO1.LS1)
1 Biology, Quarter 1 Big Ideas: From Molecules to Organisms: Structures and Processes (BIO1.LS1) Focus Standards BIO1.LS1.2 Evaluate comparative models of various cell types with a focus on organic molecules
More informationFUNDAMENTALS OF MOLECULAR EVOLUTION
FUNDAMENTALS OF MOLECULAR EVOLUTION Second Edition Dan Graur TELAVIV UNIVERSITY Wen-Hsiung Li UNIVERSITY OF CHICAGO SINAUER ASSOCIATES, INC., Publishers Sunderland, Massachusetts Contents Preface xiii
More informationChapters 25 and 26. Searching for Homology. Phylogeny
Chapters 25 and 26 The Origin of Life as we know it. Phylogeny traces evolutionary history of taxa Systematics- analyzes relationships (modern and past) of organisms Figure 25.1 A gallery of fossils The
More informationBIOLOGY (BIOL) Biology (BIOL) 1. BIOL 155 Introductory Microbiology Laboratory 1 credits
Biology (BIOL) 1 BIOLOGY (BIOL) BIOL 101 Perspectives in Biology Open only to majors. Intro to the disciplines in the fields of biology; current research topics. BIOL 102 Biology and Society Not open to
More informationIntraspecific gene genealogies: trees grafting into networks
Intraspecific gene genealogies: trees grafting into networks by David Posada & Keith A. Crandall Kessy Abarenkov Tartu, 2004 Article describes: Population genetics principles Intraspecific genetic variation
More informationCharacteristics of Life
UNIT 2 BIODIVERSITY Chapter 4- Patterns of Life Biology 2201 Characteristics of Life All living things share some basic characteristics: 1) living things are organized systems made up of one or more cells
More informationAnnouncements KEY CONCEPTS
What do these things have in common? Announcements Lab this week: bring textbook and photo atlas. Relevant reading BEFORE lab: Ch. 30 http://i.cnn.net/cnn/specials/2001/trade.center/images/anthrax.jpg
More informationGenomes and Their Evolution
Chapter 21 Genomes and Their Evolution PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
More information