Detecting unfolded regions in protein sequences. Anne Poupon Génomique Structurale de la Levure IBBMC Université Paris-Sud / CNRS France

Size: px
Start display at page:

Download "Detecting unfolded regions in protein sequences. Anne Poupon Génomique Structurale de la Levure IBBMC Université Paris-Sud / CNRS France"

Transcription

1 Detecting unfolded regions in protein sequences Anne Poupon Génomique Structurale de la Levure IBBMC Université Paris-Sud / CNRS France

2 Large proteins and complexes: a domain approach Structural studies large proteins difficult to produce in sufficient quantities difficult to crystallize (inter domain mobility) Domains are the evolutionary units of proteins discovery of new domains discovery of new structures/functions Domain approach rewarding for the study of complexes combined with electron microscopy

3 objectives bioinformatics tools for the automatic detection of domains identification linker regions genetic engineering for creation of meaningful fragment libraries screening for soluble folded fragments apply to large proteins involved in DNA remodeling/repair multiprotein complexes

4 Unfolded fragments Induced conformational change Linker region between two structural domains

5 Unfolded fragments Induced conformational change Linker region between two structural domains

6 Unfolded fragments and crystallography gene cloning expression solubility crystals Most prediction methods predict regions that might be unfolded under certain c We want to predict regions that are always unfolded

7 E Q E G N A T A I F F L P D G K L H L N E L F E L G N A T A I F L P D E G K Q H L N E L I R S TKF LENEDR F F LPDEGKLQHLENELTHD I GNAT I G N A I F F L P D G H L L E A T K L E N E Q Principles and limits of HCA

8 Principles and limits of HCA Folded Unfolded Folded Requires a lot of manpower and expertise Not automated No statistics

9 Principles and limits of HCA «Why» do we see the unfolded regions on the HCA diagram? Because the «textures» of folded and unfolded regions are different The amino acid composition is different The hydrophobic clusters are different These differences have to be quantified and exploited

10 Data set Swisprot sequence PDB sequence Linker set (L) N-ter fragment Internal fragment C-ter fragment residues residues Set U Prelink chains aa Disopred 75 chains 459 aa

11 Data set PDB seq PDB seq 2 PDB seq 3 PDB seq 3 Only sequences that are unfolded in all homolog PDB sequences are retai

12

13 Amino acid compositions G N A T I F F L P D E G K L Q H L E N E L T H D I I T K F L E N E D R R S aa Probabilities of occurence of this 2 aa sequence in linker (PL) and structured (PS) regions n! PL = n V! n I!... n G! pl V n v pl I n I... pl G n G n! PS = n V! n I!... n G! ps V n v ps I n I... ps G n G

14 I R S TKF LENEDR F F LPDEGKLQHLENELTHD I GNAT I Cluster distance Sequence Differences in hydrophobic clusters

15 Computed parameters G N A T I F F L P D E G K L Q H L E N E L T H D I I T K F L E N E D R R S aa For this residue Ratio Cluster distance Product R = PL/PS d P = R.d These 3 parameters are ploted for all residues in a protein sequence

16 Calibrating on PDB ratio FP : false positives real FP : the regions that are unfolded under certain conditions are removed > aa Rule FP real FP R R R

17 Calibrating on PDB ratio R product P 5 > aa 5<ratio< product> > aa FP Rule Rule 2 5 R R 3 R 2 R P P real FP 6

18 Calibrating on PDB Length < >3 total N-ter Fragments Nb fragments Predicted (%) C-ter Fragments Nb fragments Predicted (%) Internal fragments Nbfragments

19 Calibrating on PDB 3 ratio R product P 5 Rule 3 : P 3 > aa 5<ratio< product> > aa > aa produit>3 Length < >3 total Nbfragments Rules Rules

20 Testing on CASP5 Sensitivity = TP/(TP +FN) Specificity = TN/(TN+FP) Group Sensitivity (%) Sensibility (%) Prelink

21 Testing on Yeast proteins Nb proteins Nb with linker predicted False positives False negative Unfolded 4 7 Structured 6 Soluble not crystallized Chorismate synthase (saccharomyces cerevisiae)

22 Yeast DNA repair protein SET SET 8 Not expressed Not soluble Soluble Crystallized (structure)

23 Limitations Ratio Ratio Ratio Sequence Sequence P922 P523 P Sequence How to account for the «shape» of the curve?

24 Perspectives Not all parameters have been optimized: window length thresholds More parameters are needed neighborhood The rules have been determined empirically We should use statistical learning algorythms We should also try tree learning algorithms

25 Thanks to... Karen Coeytaux Herman van Tilbeurgh Joël Janin Julie Bernauer Sophie Cheruel... and the rest of the Yeast Structural Genomics team.

Copyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years.

Copyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years. Structure Determination and Sequence Analysis The vast majority of the experimentally determined three-dimensional protein structures have been solved by one of two methods: X-ray diffraction and Nuclear

More information

Basics of protein structure

Basics of protein structure Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu

More information

PREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS

PREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS PREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS T. Z. SEN, A. KLOCZKOWSKI, R. L. JERNIGAN L.H. Baker Center for Bioinformatics and Biological Statistics, Iowa State University Ames, IA

More information

#33 - Genomics 11/09/07

#33 - Genomics 11/09/07 BCB 444/544 Required Reading (before lecture) Lecture 33 Mon Nov 5 - Lecture 31 Phylogenetics Parsimony and ML Chp 11 - pp 142 169 Genomics Wed Nov 7 - Lecture 32 Machine Learning Fri Nov 9 - Lecture 33

More information

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748 CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr

More information

Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins

Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins J. Baussand, C. Deremble, A. Carbone Analytical Genomics Laboratoire d Immuno-Biologie Cellulaire

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture

More information

Molecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007

Molecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007 Molecular Modeling Prediction of Protein 3D Structure from Sequence Vimalkumar Velayudhan Jain Institute of Vocational and Advanced Studies May 21, 2007 Vimalkumar Velayudhan Molecular Modeling 1/23 Outline

More information

Protein Structure Analysis and Verification. Course S Basics for Biosystems of the Cell exercise work. Maija Nevala, BIO, 67485U 16.1.

Protein Structure Analysis and Verification. Course S Basics for Biosystems of the Cell exercise work. Maija Nevala, BIO, 67485U 16.1. Protein Structure Analysis and Verification Course S-114.2500 Basics for Biosystems of the Cell exercise work Maija Nevala, BIO, 67485U 16.1.2008 1. Preface When faced with an unknown protein, scientists

More information

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded

More information

2013 Eric Pitman Summer Workshop in Computational Science....an introduction to R, statistics, programming, and getting to know datasets

2013 Eric Pitman Summer Workshop in Computational Science....an introduction to R, statistics, programming, and getting to know datasets 2013 Eric Pitman Summer Workshop in Computational Science...an introduction to R, statistics, programming, and getting to know datasets Introducing the Workshop Project Here's what we'll cover: The story

More information

Bioinformatics: Secondary Structure Prediction

Bioinformatics: Secondary Structure Prediction Bioinformatics: Secondary Structure Prediction Prof. David Jones d.jones@cs.ucl.ac.uk LMLSTQNPALLKRNIIYWNNVALLWEAGSD The greatest unsolved problem in molecular biology:the Protein Folding Problem? Entries

More information

Sequence analysis and comparison

Sequence analysis and comparison The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species

More information

Bioinformatics. Macromolecular structure

Bioinformatics. Macromolecular structure Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure Structure analysis Structure alignment Domain

More information

Quantifying sequence similarity

Quantifying sequence similarity Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity

More information

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure

More information

Improving De novo Protein Structure Prediction using Contact Maps Information

Improving De novo Protein Structure Prediction using Contact Maps Information CIBCB 2017 IEEE Conference on Computational Intelligence in Bioinformatics and Computational Biology Improving De novo Protein Structure Prediction using Contact Maps Information Karina Baptista dos Santos

More information

Proteomics. Yeast two hybrid. Proteomics - PAGE techniques. Data obtained. What is it?

Proteomics. Yeast two hybrid. Proteomics - PAGE techniques. Data obtained. What is it? Proteomics What is it? Reveal protein interactions Protein profiling in a sample Yeast two hybrid screening High throughput 2D PAGE Automatic analysis of 2D Page Yeast two hybrid Use two mating strains

More information

Bioinformatics 2. Yeast two hybrid. Proteomics. Proteomics

Bioinformatics 2. Yeast two hybrid. Proteomics. Proteomics GENOME Bioinformatics 2 Proteomics protein-gene PROTEOME protein-protein METABOLISM Slide from http://www.nd.edu/~networks/ Citrate Cycle Bio-chemical reactions What is it? Proteomics Reveal protein Protein

More information

Computational methods for predicting protein-protein interactions

Computational methods for predicting protein-protein interactions Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational

More information

CS612 - Algorithms in Bioinformatics

CS612 - Algorithms in Bioinformatics Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available

More information

A DNA Sequence 2017/12/6 1

A DNA Sequence 2017/12/6 1 A DNA Sequence ccgtacgtacgtagagtgctagtctagtcgtagcgccgtagtcgatcgtgtgg gtagtagctgatatgatgcgaggtaggggataggatagcaacagatgagc ggatgctgagtgcagtggcatgcgatgtcgatgatagcggtaggtagacttc gcgcataaagctgcgcgagatgattgcaaagragttagatgagctgatgcta

More information

Eric Pitman Summer Workshop in Computational Science

Eric Pitman Summer Workshop in Computational Science Eric Pitman Summer Workshop in Computational Science Intro to Project Introduction Jeanette Sperhac & Amanda Ruby Introducing the Workshop Project Here's what we'll cover: The story of the HWI protein

More information

Protein Structure Prediction

Protein Structure Prediction Page 1 Protein Structure Prediction Russ B. Altman BMI 214 CS 274 Protein Folding is different from structure prediction --Folding is concerned with the process of taking the 3D shape, usually based on

More information

Large-Scale Genomic Surveys

Large-Scale Genomic Surveys Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction

More information

1-D Predictions. Prediction of local features: Secondary structure & surface exposure

1-D Predictions. Prediction of local features: Secondary structure & surface exposure 1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local

More information

Computational Biology From The Perspective Of A Physical Scientist

Computational Biology From The Perspective Of A Physical Scientist Computational Biology From The Perspective Of A Physical Scientist Dr. Arthur Dong PP1@TUM 26 November 2013 Bioinformatics Education Curriculum Math, Physics, Computer Science (Statistics and Programming)

More information

CMPS 3110: Bioinformatics. Tertiary Structure Prediction

CMPS 3110: Bioinformatics. Tertiary Structure Prediction CMPS 3110: Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the laws of physics! Conformation space is finite

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction CMPS 6630: Introduction to Computational Biology and Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the

More information

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki. Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein

More information

CSCE555 Bioinformatics. Protein Function Annotation

CSCE555 Bioinformatics. Protein Function Annotation CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The

More information

Introduction to Evolutionary Concepts

Introduction to Evolutionary Concepts Introduction to Evolutionary Concepts and VMD/MultiSeq - Part I Zaida (Zan) Luthey-Schulten Dept. Chemistry, Beckman Institute, Biophysics, Institute of Genomics Biology, & Physics NIH Workshop 2009 VMD/MultiSeq

More information

Structure to Function. Molecular Bioinformatics, X3, 2006

Structure to Function. Molecular Bioinformatics, X3, 2006 Structure to Function Molecular Bioinformatics, X3, 2006 Structural GeNOMICS Structural Genomics project aims at determination of 3D structures of all proteins: - organize known proteins into families

More information

Next Generation Computational Chemistry Tools to Predict Toxicity of CWAs

Next Generation Computational Chemistry Tools to Predict Toxicity of CWAs Next Generation Computational Chemistry Tools to Predict Toxicity of CWAs William (Bill) Welsh welshwj@umdnj.edu Prospective Funding by DTRA/JSTO-CBD CBIS Conference 1 A State-wide, Regional and National

More information

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

09/06/25. Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Non-uniform distribution of folds. Scheme of protein structure predicition

09/06/25. Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Non-uniform distribution of folds. Scheme of protein structure predicition Sequence identity Structural similarity Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Fold recognition Sommersemester 2009 Peter Güntert Structural similarity X Sequence identity Non-uniform

More information

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and

More information

Genomics and bioinformatics summary. Finding genes -- computer searches

Genomics and bioinformatics summary. Finding genes -- computer searches Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence

More information

Protein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods

Protein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods Cell communication channel Bioinformatics Methods Iosif Vaisman Email: ivaisman@gmu.edu SEQUENCE STRUCTURE DNA Sequence Protein Sequence Protein Structure Protein structure ATGAAATTTGGAAACTTCCTTCTCACTTATCAGCCACCT...

More information

Accurate Prediction of Protein Disordered Regions by Mining Protein Structure Data

Accurate Prediction of Protein Disordered Regions by Mining Protein Structure Data Data Mining and Knowledge Discovery, 11, 213 222, 2005 c 2005 Springer Science + Business Media, Inc. Manufactured in The Netherlands. DOI: 10.1007/s10618-005-0001-y Accurate Prediction of Protein Disordered

More information

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018 CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of

More information

Proteins: Structure & Function. Ulf Leser

Proteins: Structure & Function. Ulf Leser Proteins: Structure & Function Ulf Leser This Lecture Proteins Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding

More information

BIOINFORMATICS: An Introduction

BIOINFORMATICS: An Introduction BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and

More information

CAP 5510 Lecture 3 Protein Structures

CAP 5510 Lecture 3 Protein Structures CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity

More information

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT 3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode

More information

Protein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.

Protein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small

More information

Orientational degeneracy in the presence of one alignment tensor.

Orientational degeneracy in the presence of one alignment tensor. Orientational degeneracy in the presence of one alignment tensor. Rotation about the x, y and z axes can be performed in the aligned mode of the program to examine the four degenerate orientations of two

More information

Detection of Protein Binding Sites II

Detection of Protein Binding Sites II Detection of Protein Binding Sites II Goal: Given a protein structure, predict where a ligand might bind Thomas Funkhouser Princeton University CS597A, Fall 2007 1hld Geometric, chemical, evolutionary

More information

Bioinformatics tools for phylogeny and visualization. Yanbin Yin

Bioinformatics tools for phylogeny and visualization. Yanbin Yin Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and

More information

Structural biomathematics: an overview of molecular simulations and protein structure prediction

Structural biomathematics: an overview of molecular simulations and protein structure prediction : an overview of molecular simulations and protein structure prediction Figure: Parc de Recerca Biomèdica de Barcelona (PRBB). Contents 1 A Glance at Structural Biology 2 3 1 A Glance at Structural Biology

More information

Motif Prediction in Amino Acid Interaction Networks

Motif Prediction in Amino Acid Interaction Networks Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions

More information

REPORT ON THE RESEARCH UNIT: Laboratory of Molecular and Cellular Biology of Eukaryotes (LBMCE)

REPORT ON THE RESEARCH UNIT: Laboratory of Molecular and Cellular Biology of Eukaryotes (LBMCE) Research evaluation REPORT ON THE RESEARCH UNIT: Laboratory of Molecular and Cellular Biology of Eukaryotes (LBMCE) UNDER THE SUPERVISION OF THE FOLLOWING INSTITUTIONS AND RESEARCH BODIES: Université Pierre

More information

Tools and Algorithms in Bioinformatics

Tools and Algorithms in Bioinformatics Tools and Algorithms in Bioinformatics GCBA815, Fall 2013 Week3: Blast Algorithm, theory and practice Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and Systems Biology

More information

Graphical Models and Bayesian Methods in Bioinformatics: From Structural to Systems Biology

Graphical Models and Bayesian Methods in Bioinformatics: From Structural to Systems Biology Graphical Models and Bayesian Methods in Bioinformatics: From Structural to Systems Biology David L. Wild Keck Graduate Institute of Applied Life Sciences, Claremont, CA, USA October 3, 2005 Outline 1

More information

Examples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE

Examples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To

More information

Differential Scanning Fluorimetry: Detection of ligands and conditions that promote protein stability and crystallization

Differential Scanning Fluorimetry: Detection of ligands and conditions that promote protein stability and crystallization Differential Scanning Fluorimetry: Detection of ligands and conditions that promote protein stability and crystallization Frank Niesen PX school 2008, Como, Italy Method introduction Topics Applications

More information

Last updated: Copyright

Last updated: Copyright Last updated: 2012-08-20 Copyright 2004-2012 plabel (v2.4) User s Manual by Bioinformatics Group, Institute of Computing Technology, Chinese Academy of Sciences Tel: 86-10-62601016 Email: zhangkun01@ict.ac.cn,

More information

Introduction to Bioinformatics Online Course: IBT

Introduction to Bioinformatics Online Course: IBT Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple

More information

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major

More information

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major

More information

Computational Biology: Basics & Interesting Problems

Computational Biology: Basics & Interesting Problems Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information

More information

Homology Modeling. Roberto Lins EPFL - summer semester 2005

Homology Modeling. Roberto Lins EPFL - summer semester 2005 Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,

More information

proteins Comparison of structure-based and threading-based approaches to protein functional annotation Michal Brylinski, and Jeffrey Skolnick*

proteins Comparison of structure-based and threading-based approaches to protein functional annotation Michal Brylinski, and Jeffrey Skolnick* proteins STRUCTURE O FUNCTION O BIOINFORMATICS Comparison of structure-based and threading-based approaches to protein functional annotation Michal Brylinski, and Jeffrey Skolnick* Center for the Study

More information

Receptor Based Drug Design (1)

Receptor Based Drug Design (1) Induced Fit Model For more than 100 years, the behaviour of enzymes had been explained by the "lock-and-key" mechanism developed by pioneering German chemist Emil Fischer. Fischer thought that the chemicals

More information

2 Genome evolution: gene fusion versus gene fission

2 Genome evolution: gene fusion versus gene fission 2 Genome evolution: gene fusion versus gene fission Berend Snel, Peer Bork and Martijn A. Huynen Trends in Genetics 16 (2000) 9-11 13 Chapter 2 Introduction With the advent of complete genome sequencing,

More information

Design of a Novel Globular Protein Fold with Atomic-Level Accuracy

Design of a Novel Globular Protein Fold with Atomic-Level Accuracy Design of a Novel Globular Protein Fold with Atomic-Level Accuracy Brian Kuhlman, Gautam Dantas, Gregory C. Ireton, Gabriele Varani, Barry L. Stoddard, David Baker Presented by Kate Stafford 4 May 05 Protein

More information

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings

More information

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre Bioinformatics Scoring Matrices David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Learning Objectives To explain the requirement

More information

Chemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller

Chemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller Chemogenomic: Approaches to Rational Drug Design Jonas Skjødt Møller Chemogenomic Chemistry Biology Chemical biology Medical chemistry Chemical genetics Chemoinformatics Bioinformatics Chemoproteomics

More information

USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES

USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES HOW CAN BIOINFORMATICS BE USED AS A TOOL TO DETERMINE EVOLUTIONARY RELATIONSHPS AND TO BETTER UNDERSTAND PROTEIN HERITAGE?

More information

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value

More information

Supplementing information theory with opposite polarity of amino acids for protein contact prediction

Supplementing information theory with opposite polarity of amino acids for protein contact prediction Supplementing information theory with opposite polarity of amino acids for protein contact prediction Yancy Liao 1, Jeremy Selengut 1 1 Department of Computer Science, University of Maryland - College

More information

Using AutoDock for Virtual Screening

Using AutoDock for Virtual Screening Using AutoDock for Virtual Screening CUHK Croucher ASI Workshop 2011 Stefano Forli, PhD Prof. Arthur J. Olson, Ph.D Molecular Graphics Lab Screening and Virtual Screening The ultimate tool for identifying

More information

Protein Structure Determination

Protein Structure Determination Protein Structure Determination Given a protein sequence, determine its 3D structure 1 MIKLGIVMDP IANINIKKDS SFAMLLEAQR RGYELHYMEM GDLYLINGEA 51 RAHTRTLNVK QNYEEWFSFV GEQDLPLADL DVILMRKDPP FDTEFIYATY 101

More information

Analysis of Escherichia coli amino acid transporters

Analysis of Escherichia coli amino acid transporters Ph.D thesis Analysis of Escherichia coli amino acid transporters Presented by Attila Szvetnik Supervisor: Dr. Miklós Kálmán Biology Ph.D School University of Szeged Bay Zoltán Foundation for Applied Research

More information

Protein Structure Prediction Using Neural Networks

Protein Structure Prediction Using Neural Networks Protein Structure Prediction Using Neural Networks Martha Mercaldi Kasia Wilamowska Literature Review December 16, 2003 The Protein Folding Problem Evolution of Neural Networks Neural networks originally

More information

Protein function prediction based on sequence analysis

Protein function prediction based on sequence analysis Performing sequence searches Post-Blast analysis, Using profiles and pattern-matching Protein function prediction based on sequence analysis Slides from a lecture on MOL204 - Applied Bioinformatics 18-Oct-2005

More information

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this

More information

Introduction to Bioinformatics

Introduction to Bioinformatics CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics

More information

Microarray Data Analysis: Discovery

Microarray Data Analysis: Discovery Microarray Data Analysis: Discovery Lecture 5 Classification Classification vs. Clustering Classification: Goal: Placing objects (e.g. genes) into meaningful classes Supervised Clustering: Goal: Discover

More information

Christian Sigrist. November 14 Protein Bioinformatics: Sequence-Structure-Function 2018 Basel

Christian Sigrist. November 14 Protein Bioinformatics: Sequence-Structure-Function 2018 Basel Christian Sigrist General Definition on Conserved Regions Conserved regions in proteins can be classified into 5 different groups: Domains: specific combination of secondary structures organized into a

More information

Protein Structure: Data Bases and Classification Ingo Ruczinski

Protein Structure: Data Bases and Classification Ingo Ruczinski Protein Structure: Data Bases and Classification Ingo Ruczinski Department of Biostatistics, Johns Hopkins University Reference Bourne and Weissig Structural Bioinformatics Wiley, 2003 More References

More information

Preparing a PDB File

Preparing a PDB File Figure 1: Schematic view of the ligand-binding domain from the vitamin D receptor (PDB file 1IE9). The crystallographic waters are shown as small spheres and the bound ligand is shown as a CPK model. HO

More information

Background: Imagine it is time for your lunch break, you take your sandwich outside and you sit down to enjoy your lunch with a beautiful view of

Background: Imagine it is time for your lunch break, you take your sandwich outside and you sit down to enjoy your lunch with a beautiful view of Background: Imagine it is time for your lunch break, you take your sandwich outside and you sit down to enjoy your lunch with a beautiful view of Montana s Rocky Mountains. As you look up, you see what

More information

Rietveld Structure Refinement of Protein Powder Diffraction Data using GSAS

Rietveld Structure Refinement of Protein Powder Diffraction Data using GSAS Rietveld Structure Refinement of Protein Powder Diffraction Data using GSAS Jon Wright ESRF, Grenoble, France Plan This is a users perspective Cover the protein specific aspects (assuming knowledge of

More information

Protein NMR spectroscopy

Protein NMR spectroscopy Protein NMR spectroscopy Perttu Permi National Biological NMR Center, Institute of Biotechnology, University of elsinki Protein NMR spectroscopy course, 19th January 2009 1 spectrum of 20 kda Ca-binding

More information

Biological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor

Biological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms

More information

Matrix-based pattern discovery algorithms

Matrix-based pattern discovery algorithms Regulatory Sequence Analysis Matrix-based pattern discovery algorithms Jacques.van.Helden@ulb.ac.be Université Libre de Bruxelles, Belgique Laboratoire de Bioinformatique des Génomes et des Réseaux (BiGRe)

More information

Introduction to" Protein Structure

Introduction to Protein Structure Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.

More information

Automated Identification of Protein Structural Features

Automated Identification of Protein Structural Features Automated Identification of Protein Structural Features Chandrasekhar Mamidipally 1, Santosh B. Noronha 1, Sumantra Dutta Roy 2 1 Dept. of Chemical Engg., IIT Bombay, Powai, Mumbai - 400 076, INDIA. chandra

More information

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its

More information

EBI web resources II: Ensembl and InterPro

EBI web resources II: Ensembl and InterPro EBI web resources II: Ensembl and InterPro Yanbin Yin http://www.ebi.ac.uk/training/online/course/ 1 Homework 3 Go to http://www.ebi.ac.uk/interpro/training.htmland finish the second online training course

More information

Procedure to Create NCBI KOGS

Procedure to Create NCBI KOGS Procedure to Create NCBI KOGS full details in: Tatusov et al (2003) BMC Bioinformatics 4:41. 1. Detect and mask typical repetitive domains Reason: masking prevents spurious lumping of non-orthologs based

More information

Introduction to Bioinformatics. Shifra Ben-Dor Irit Orr

Introduction to Bioinformatics. Shifra Ben-Dor Irit Orr Introduction to Bioinformatics Shifra Ben-Dor Irit Orr Lecture Outline: Technical Course Items Introduction to Bioinformatics Introduction to Databases This week and next week What is bioinformatics? A

More information

Lipid transfer proteins confer resistance to trichothecenes

Lipid transfer proteins confer resistance to trichothecenes Lipid transfer proteins confer resistance to trichothecenes John McLaughlin and Anwar Bin-Umer Tumer Laboratory National Fusarium Head Blight Forum December 6th, 2012 FY09-11: Identify trichothecene resistance

More information

DATA ANALYTICS IN NANOMATERIALS DISCOVERY

DATA ANALYTICS IN NANOMATERIALS DISCOVERY DATA ANALYTICS IN NANOMATERIALS DISCOVERY Michael Fernandez OCE-Postdoctoral Fellow September 2016 www.data61.csiro.au Materials Discovery Process Materials Genome Project Integrating computational methods

More information

Protein Structure Prediction Using Multiple Artificial Neural Network Classifier *

Protein Structure Prediction Using Multiple Artificial Neural Network Classifier * Protein Structure Prediction Using Multiple Artificial Neural Network Classifier * Hemashree Bordoloi and Kandarpa Kumar Sarma Abstract. Protein secondary structure prediction is the method of extracting

More information

Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)

Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from

More information

Protein Structures. 11/19/2002 Lecture 24 1

Protein Structures. 11/19/2002 Lecture 24 1 Protein Structures 11/19/2002 Lecture 24 1 All 3 figures are cartoons of an amino acid residue. 11/19/2002 Lecture 24 2 Peptide bonds in chains of residues 11/19/2002 Lecture 24 3 Angles φ and ψ in the

More information

Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment

Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand

More information