Detecting unfolded regions in protein sequences. Anne Poupon Génomique Structurale de la Levure IBBMC Université Paris-Sud / CNRS France
|
|
- Hilda Davidson
- 5 years ago
- Views:
Transcription
1 Detecting unfolded regions in protein sequences Anne Poupon Génomique Structurale de la Levure IBBMC Université Paris-Sud / CNRS France
2 Large proteins and complexes: a domain approach Structural studies large proteins difficult to produce in sufficient quantities difficult to crystallize (inter domain mobility) Domains are the evolutionary units of proteins discovery of new domains discovery of new structures/functions Domain approach rewarding for the study of complexes combined with electron microscopy
3 objectives bioinformatics tools for the automatic detection of domains identification linker regions genetic engineering for creation of meaningful fragment libraries screening for soluble folded fragments apply to large proteins involved in DNA remodeling/repair multiprotein complexes
4 Unfolded fragments Induced conformational change Linker region between two structural domains
5 Unfolded fragments Induced conformational change Linker region between two structural domains
6 Unfolded fragments and crystallography gene cloning expression solubility crystals Most prediction methods predict regions that might be unfolded under certain c We want to predict regions that are always unfolded
7 E Q E G N A T A I F F L P D G K L H L N E L F E L G N A T A I F L P D E G K Q H L N E L I R S TKF LENEDR F F LPDEGKLQHLENELTHD I GNAT I G N A I F F L P D G H L L E A T K L E N E Q Principles and limits of HCA
8 Principles and limits of HCA Folded Unfolded Folded Requires a lot of manpower and expertise Not automated No statistics
9 Principles and limits of HCA «Why» do we see the unfolded regions on the HCA diagram? Because the «textures» of folded and unfolded regions are different The amino acid composition is different The hydrophobic clusters are different These differences have to be quantified and exploited
10 Data set Swisprot sequence PDB sequence Linker set (L) N-ter fragment Internal fragment C-ter fragment residues residues Set U Prelink chains aa Disopred 75 chains 459 aa
11 Data set PDB seq PDB seq 2 PDB seq 3 PDB seq 3 Only sequences that are unfolded in all homolog PDB sequences are retai
12
13 Amino acid compositions G N A T I F F L P D E G K L Q H L E N E L T H D I I T K F L E N E D R R S aa Probabilities of occurence of this 2 aa sequence in linker (PL) and structured (PS) regions n! PL = n V! n I!... n G! pl V n v pl I n I... pl G n G n! PS = n V! n I!... n G! ps V n v ps I n I... ps G n G
14 I R S TKF LENEDR F F LPDEGKLQHLENELTHD I GNAT I Cluster distance Sequence Differences in hydrophobic clusters
15 Computed parameters G N A T I F F L P D E G K L Q H L E N E L T H D I I T K F L E N E D R R S aa For this residue Ratio Cluster distance Product R = PL/PS d P = R.d These 3 parameters are ploted for all residues in a protein sequence
16 Calibrating on PDB ratio FP : false positives real FP : the regions that are unfolded under certain conditions are removed > aa Rule FP real FP R R R
17 Calibrating on PDB ratio R product P 5 > aa 5<ratio< product> > aa FP Rule Rule 2 5 R R 3 R 2 R P P real FP 6
18 Calibrating on PDB Length < >3 total N-ter Fragments Nb fragments Predicted (%) C-ter Fragments Nb fragments Predicted (%) Internal fragments Nbfragments
19 Calibrating on PDB 3 ratio R product P 5 Rule 3 : P 3 > aa 5<ratio< product> > aa > aa produit>3 Length < >3 total Nbfragments Rules Rules
20 Testing on CASP5 Sensitivity = TP/(TP +FN) Specificity = TN/(TN+FP) Group Sensitivity (%) Sensibility (%) Prelink
21 Testing on Yeast proteins Nb proteins Nb with linker predicted False positives False negative Unfolded 4 7 Structured 6 Soluble not crystallized Chorismate synthase (saccharomyces cerevisiae)
22 Yeast DNA repair protein SET SET 8 Not expressed Not soluble Soluble Crystallized (structure)
23 Limitations Ratio Ratio Ratio Sequence Sequence P922 P523 P Sequence How to account for the «shape» of the curve?
24 Perspectives Not all parameters have been optimized: window length thresholds More parameters are needed neighborhood The rules have been determined empirically We should use statistical learning algorythms We should also try tree learning algorithms
25 Thanks to... Karen Coeytaux Herman van Tilbeurgh Joël Janin Julie Bernauer Sophie Cheruel... and the rest of the Yeast Structural Genomics team.
Copyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years.
Structure Determination and Sequence Analysis The vast majority of the experimentally determined three-dimensional protein structures have been solved by one of two methods: X-ray diffraction and Nuclear
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationPREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS
PREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS T. Z. SEN, A. KLOCZKOWSKI, R. L. JERNIGAN L.H. Baker Center for Bioinformatics and Biological Statistics, Iowa State University Ames, IA
More information#33 - Genomics 11/09/07
BCB 444/544 Required Reading (before lecture) Lecture 33 Mon Nov 5 - Lecture 31 Phylogenetics Parsimony and ML Chp 11 - pp 142 169 Genomics Wed Nov 7 - Lecture 32 Machine Learning Fri Nov 9 - Lecture 33
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More informationMultiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins
Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins J. Baussand, C. Deremble, A. Carbone Analytical Genomics Laboratoire d Immuno-Biologie Cellulaire
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison
CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture
More informationMolecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007
Molecular Modeling Prediction of Protein 3D Structure from Sequence Vimalkumar Velayudhan Jain Institute of Vocational and Advanced Studies May 21, 2007 Vimalkumar Velayudhan Molecular Modeling 1/23 Outline
More informationProtein Structure Analysis and Verification. Course S Basics for Biosystems of the Cell exercise work. Maija Nevala, BIO, 67485U 16.1.
Protein Structure Analysis and Verification Course S-114.2500 Basics for Biosystems of the Cell exercise work Maija Nevala, BIO, 67485U 16.1.2008 1. Preface When faced with an unknown protein, scientists
More informationHomology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB
Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded
More information2013 Eric Pitman Summer Workshop in Computational Science....an introduction to R, statistics, programming, and getting to know datasets
2013 Eric Pitman Summer Workshop in Computational Science...an introduction to R, statistics, programming, and getting to know datasets Introducing the Workshop Project Here's what we'll cover: The story
More informationBioinformatics: Secondary Structure Prediction
Bioinformatics: Secondary Structure Prediction Prof. David Jones d.jones@cs.ucl.ac.uk LMLSTQNPALLKRNIIYWNNVALLWEAGSD The greatest unsolved problem in molecular biology:the Protein Folding Problem? Entries
More informationSequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
More informationBioinformatics. Macromolecular structure
Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure Structure analysis Structure alignment Domain
More informationQuantifying sequence similarity
Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure
More informationImproving De novo Protein Structure Prediction using Contact Maps Information
CIBCB 2017 IEEE Conference on Computational Intelligence in Bioinformatics and Computational Biology Improving De novo Protein Structure Prediction using Contact Maps Information Karina Baptista dos Santos
More informationProteomics. Yeast two hybrid. Proteomics - PAGE techniques. Data obtained. What is it?
Proteomics What is it? Reveal protein interactions Protein profiling in a sample Yeast two hybrid screening High throughput 2D PAGE Automatic analysis of 2D Page Yeast two hybrid Use two mating strains
More informationBioinformatics 2. Yeast two hybrid. Proteomics. Proteomics
GENOME Bioinformatics 2 Proteomics protein-gene PROTEOME protein-protein METABOLISM Slide from http://www.nd.edu/~networks/ Citrate Cycle Bio-chemical reactions What is it? Proteomics Reveal protein Protein
More informationComputational methods for predicting protein-protein interactions
Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational
More informationCS612 - Algorithms in Bioinformatics
Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available
More informationA DNA Sequence 2017/12/6 1
A DNA Sequence ccgtacgtacgtagagtgctagtctagtcgtagcgccgtagtcgatcgtgtgg gtagtagctgatatgatgcgaggtaggggataggatagcaacagatgagc ggatgctgagtgcagtggcatgcgatgtcgatgatagcggtaggtagacttc gcgcataaagctgcgcgagatgattgcaaagragttagatgagctgatgcta
More informationEric Pitman Summer Workshop in Computational Science
Eric Pitman Summer Workshop in Computational Science Intro to Project Introduction Jeanette Sperhac & Amanda Ruby Introducing the Workshop Project Here's what we'll cover: The story of the HWI protein
More informationProtein Structure Prediction
Page 1 Protein Structure Prediction Russ B. Altman BMI 214 CS 274 Protein Folding is different from structure prediction --Folding is concerned with the process of taking the 3D shape, usually based on
More informationLarge-Scale Genomic Surveys
Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction
More information1-D Predictions. Prediction of local features: Secondary structure & surface exposure
1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local
More informationComputational Biology From The Perspective Of A Physical Scientist
Computational Biology From The Perspective Of A Physical Scientist Dr. Arthur Dong PP1@TUM 26 November 2013 Bioinformatics Education Curriculum Math, Physics, Computer Science (Statistics and Programming)
More informationCMPS 3110: Bioinformatics. Tertiary Structure Prediction
CMPS 3110: Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the laws of physics! Conformation space is finite
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction
CMPS 6630: Introduction to Computational Biology and Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the
More informationProtein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.
Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein
More informationCSCE555 Bioinformatics. Protein Function Annotation
CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The
More informationIntroduction to Evolutionary Concepts
Introduction to Evolutionary Concepts and VMD/MultiSeq - Part I Zaida (Zan) Luthey-Schulten Dept. Chemistry, Beckman Institute, Biophysics, Institute of Genomics Biology, & Physics NIH Workshop 2009 VMD/MultiSeq
More informationStructure to Function. Molecular Bioinformatics, X3, 2006
Structure to Function Molecular Bioinformatics, X3, 2006 Structural GeNOMICS Structural Genomics project aims at determination of 3D structures of all proteins: - organize known proteins into families
More informationNext Generation Computational Chemistry Tools to Predict Toxicity of CWAs
Next Generation Computational Chemistry Tools to Predict Toxicity of CWAs William (Bill) Welsh welshwj@umdnj.edu Prospective Funding by DTRA/JSTO-CBD CBIS Conference 1 A State-wide, Regional and National
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More information09/06/25. Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Non-uniform distribution of folds. Scheme of protein structure predicition
Sequence identity Structural similarity Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Fold recognition Sommersemester 2009 Peter Güntert Structural similarity X Sequence identity Non-uniform
More informationChapter 5. Proteomics and the analysis of protein sequence Ⅱ
Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and
More informationGenomics and bioinformatics summary. Finding genes -- computer searches
Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence
More informationProtein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods
Cell communication channel Bioinformatics Methods Iosif Vaisman Email: ivaisman@gmu.edu SEQUENCE STRUCTURE DNA Sequence Protein Sequence Protein Structure Protein structure ATGAAATTTGGAAACTTCCTTCTCACTTATCAGCCACCT...
More informationAccurate Prediction of Protein Disordered Regions by Mining Protein Structure Data
Data Mining and Knowledge Discovery, 11, 213 222, 2005 c 2005 Springer Science + Business Media, Inc. Manufactured in The Netherlands. DOI: 10.1007/s10618-005-0001-y Accurate Prediction of Protein Disordered
More informationCONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018
CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of
More informationProteins: Structure & Function. Ulf Leser
Proteins: Structure & Function Ulf Leser This Lecture Proteins Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding
More informationBIOINFORMATICS: An Introduction
BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More information3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT
3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationOrientational degeneracy in the presence of one alignment tensor.
Orientational degeneracy in the presence of one alignment tensor. Rotation about the x, y and z axes can be performed in the aligned mode of the program to examine the four degenerate orientations of two
More informationDetection of Protein Binding Sites II
Detection of Protein Binding Sites II Goal: Given a protein structure, predict where a ligand might bind Thomas Funkhouser Princeton University CS597A, Fall 2007 1hld Geometric, chemical, evolutionary
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More informationStructural biomathematics: an overview of molecular simulations and protein structure prediction
: an overview of molecular simulations and protein structure prediction Figure: Parc de Recerca Biomèdica de Barcelona (PRBB). Contents 1 A Glance at Structural Biology 2 3 1 A Glance at Structural Biology
More informationMotif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
More informationREPORT ON THE RESEARCH UNIT: Laboratory of Molecular and Cellular Biology of Eukaryotes (LBMCE)
Research evaluation REPORT ON THE RESEARCH UNIT: Laboratory of Molecular and Cellular Biology of Eukaryotes (LBMCE) UNDER THE SUPERVISION OF THE FOLLOWING INSTITUTIONS AND RESEARCH BODIES: Université Pierre
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2013 Week3: Blast Algorithm, theory and practice Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and Systems Biology
More informationGraphical Models and Bayesian Methods in Bioinformatics: From Structural to Systems Biology
Graphical Models and Bayesian Methods in Bioinformatics: From Structural to Systems Biology David L. Wild Keck Graduate Institute of Applied Life Sciences, Claremont, CA, USA October 3, 2005 Outline 1
More informationExamples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE
Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To
More informationDifferential Scanning Fluorimetry: Detection of ligands and conditions that promote protein stability and crystallization
Differential Scanning Fluorimetry: Detection of ligands and conditions that promote protein stability and crystallization Frank Niesen PX school 2008, Como, Italy Method introduction Topics Applications
More informationLast updated: Copyright
Last updated: 2012-08-20 Copyright 2004-2012 plabel (v2.4) User s Manual by Bioinformatics Group, Institute of Computing Technology, Chinese Academy of Sciences Tel: 86-10-62601016 Email: zhangkun01@ict.ac.cn,
More informationIntroduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationComputational Biology: Basics & Interesting Problems
Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information
More informationHomology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
More informationproteins Comparison of structure-based and threading-based approaches to protein functional annotation Michal Brylinski, and Jeffrey Skolnick*
proteins STRUCTURE O FUNCTION O BIOINFORMATICS Comparison of structure-based and threading-based approaches to protein functional annotation Michal Brylinski, and Jeffrey Skolnick* Center for the Study
More informationReceptor Based Drug Design (1)
Induced Fit Model For more than 100 years, the behaviour of enzymes had been explained by the "lock-and-key" mechanism developed by pioneering German chemist Emil Fischer. Fischer thought that the chemicals
More information2 Genome evolution: gene fusion versus gene fission
2 Genome evolution: gene fusion versus gene fission Berend Snel, Peer Bork and Martijn A. Huynen Trends in Genetics 16 (2000) 9-11 13 Chapter 2 Introduction With the advent of complete genome sequencing,
More informationDesign of a Novel Globular Protein Fold with Atomic-Level Accuracy
Design of a Novel Globular Protein Fold with Atomic-Level Accuracy Brian Kuhlman, Gautam Dantas, Gregory C. Ireton, Gabriele Varani, Barry L. Stoddard, David Baker Presented by Kate Stafford 4 May 05 Protein
More informationAmino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1
Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings
More informationBioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre
Bioinformatics Scoring Matrices David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Learning Objectives To explain the requirement
More informationChemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller
Chemogenomic: Approaches to Rational Drug Design Jonas Skjødt Møller Chemogenomic Chemistry Biology Chemical biology Medical chemistry Chemical genetics Chemoinformatics Bioinformatics Chemoproteomics
More informationUSING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES
USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES HOW CAN BIOINFORMATICS BE USED AS A TOOL TO DETERMINE EVOLUTIONARY RELATIONSHPS AND TO BETTER UNDERSTAND PROTEIN HERITAGE?
More informationBioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment
Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value
More informationSupplementing information theory with opposite polarity of amino acids for protein contact prediction
Supplementing information theory with opposite polarity of amino acids for protein contact prediction Yancy Liao 1, Jeremy Selengut 1 1 Department of Computer Science, University of Maryland - College
More informationUsing AutoDock for Virtual Screening
Using AutoDock for Virtual Screening CUHK Croucher ASI Workshop 2011 Stefano Forli, PhD Prof. Arthur J. Olson, Ph.D Molecular Graphics Lab Screening and Virtual Screening The ultimate tool for identifying
More informationProtein Structure Determination
Protein Structure Determination Given a protein sequence, determine its 3D structure 1 MIKLGIVMDP IANINIKKDS SFAMLLEAQR RGYELHYMEM GDLYLINGEA 51 RAHTRTLNVK QNYEEWFSFV GEQDLPLADL DVILMRKDPP FDTEFIYATY 101
More informationAnalysis of Escherichia coli amino acid transporters
Ph.D thesis Analysis of Escherichia coli amino acid transporters Presented by Attila Szvetnik Supervisor: Dr. Miklós Kálmán Biology Ph.D School University of Szeged Bay Zoltán Foundation for Applied Research
More informationProtein Structure Prediction Using Neural Networks
Protein Structure Prediction Using Neural Networks Martha Mercaldi Kasia Wilamowska Literature Review December 16, 2003 The Protein Folding Problem Evolution of Neural Networks Neural networks originally
More informationProtein function prediction based on sequence analysis
Performing sequence searches Post-Blast analysis, Using profiles and pattern-matching Protein function prediction based on sequence analysis Slides from a lecture on MOL204 - Applied Bioinformatics 18-Oct-2005
More informationNeural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha
Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this
More informationIntroduction to Bioinformatics
CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics
More informationMicroarray Data Analysis: Discovery
Microarray Data Analysis: Discovery Lecture 5 Classification Classification vs. Clustering Classification: Goal: Placing objects (e.g. genes) into meaningful classes Supervised Clustering: Goal: Discover
More informationChristian Sigrist. November 14 Protein Bioinformatics: Sequence-Structure-Function 2018 Basel
Christian Sigrist General Definition on Conserved Regions Conserved regions in proteins can be classified into 5 different groups: Domains: specific combination of secondary structures organized into a
More informationProtein Structure: Data Bases and Classification Ingo Ruczinski
Protein Structure: Data Bases and Classification Ingo Ruczinski Department of Biostatistics, Johns Hopkins University Reference Bourne and Weissig Structural Bioinformatics Wiley, 2003 More References
More informationPreparing a PDB File
Figure 1: Schematic view of the ligand-binding domain from the vitamin D receptor (PDB file 1IE9). The crystallographic waters are shown as small spheres and the bound ligand is shown as a CPK model. HO
More informationBackground: Imagine it is time for your lunch break, you take your sandwich outside and you sit down to enjoy your lunch with a beautiful view of
Background: Imagine it is time for your lunch break, you take your sandwich outside and you sit down to enjoy your lunch with a beautiful view of Montana s Rocky Mountains. As you look up, you see what
More informationRietveld Structure Refinement of Protein Powder Diffraction Data using GSAS
Rietveld Structure Refinement of Protein Powder Diffraction Data using GSAS Jon Wright ESRF, Grenoble, France Plan This is a users perspective Cover the protein specific aspects (assuming knowledge of
More informationProtein NMR spectroscopy
Protein NMR spectroscopy Perttu Permi National Biological NMR Center, Institute of Biotechnology, University of elsinki Protein NMR spectroscopy course, 19th January 2009 1 spectrum of 20 kda Ca-binding
More informationBiological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor
Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms
More informationMatrix-based pattern discovery algorithms
Regulatory Sequence Analysis Matrix-based pattern discovery algorithms Jacques.van.Helden@ulb.ac.be Université Libre de Bruxelles, Belgique Laboratoire de Bioinformatique des Génomes et des Réseaux (BiGRe)
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationAutomated Identification of Protein Structural Features
Automated Identification of Protein Structural Features Chandrasekhar Mamidipally 1, Santosh B. Noronha 1, Sumantra Dutta Roy 2 1 Dept. of Chemical Engg., IIT Bombay, Powai, Mumbai - 400 076, INDIA. chandra
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationEBI web resources II: Ensembl and InterPro
EBI web resources II: Ensembl and InterPro Yanbin Yin http://www.ebi.ac.uk/training/online/course/ 1 Homework 3 Go to http://www.ebi.ac.uk/interpro/training.htmland finish the second online training course
More informationProcedure to Create NCBI KOGS
Procedure to Create NCBI KOGS full details in: Tatusov et al (2003) BMC Bioinformatics 4:41. 1. Detect and mask typical repetitive domains Reason: masking prevents spurious lumping of non-orthologs based
More informationIntroduction to Bioinformatics. Shifra Ben-Dor Irit Orr
Introduction to Bioinformatics Shifra Ben-Dor Irit Orr Lecture Outline: Technical Course Items Introduction to Bioinformatics Introduction to Databases This week and next week What is bioinformatics? A
More informationLipid transfer proteins confer resistance to trichothecenes
Lipid transfer proteins confer resistance to trichothecenes John McLaughlin and Anwar Bin-Umer Tumer Laboratory National Fusarium Head Blight Forum December 6th, 2012 FY09-11: Identify trichothecene resistance
More informationDATA ANALYTICS IN NANOMATERIALS DISCOVERY
DATA ANALYTICS IN NANOMATERIALS DISCOVERY Michael Fernandez OCE-Postdoctoral Fellow September 2016 www.data61.csiro.au Materials Discovery Process Materials Genome Project Integrating computational methods
More informationProtein Structure Prediction Using Multiple Artificial Neural Network Classifier *
Protein Structure Prediction Using Multiple Artificial Neural Network Classifier * Hemashree Bordoloi and Kandarpa Kumar Sarma Abstract. Protein secondary structure prediction is the method of extracting
More informationLecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)
Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from
More informationProtein Structures. 11/19/2002 Lecture 24 1
Protein Structures 11/19/2002 Lecture 24 1 All 3 figures are cartoons of an amino acid residue. 11/19/2002 Lecture 24 2 Peptide bonds in chains of residues 11/19/2002 Lecture 24 3 Angles φ and ψ in the
More informationModule: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment
Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand
More information