Protein Structure Prediction Using Multiple Artificial Neural Network Classifier *

Size: px
Start display at page:

Download "Protein Structure Prediction Using Multiple Artificial Neural Network Classifier *"

Transcription

1 Protein Structure Prediction Using Multiple Artificial Neural Network Classifier * Hemashree Bordoloi and Kandarpa Kumar Sarma Abstract. Protein secondary structure prediction is the method of extracting locally defined protein structures from the sequence of amino acids. It is a challenging and elucidating part of the field of bioinformatics. Several methods are attempting to meet these challenges. But the Artificial Neural Network (ANN) technique is turning out to be the most successful. In this work, an ANN based multi level classifier is designed for predicting secondary structure of the proteins. In this method ANNs are trained to make them capable of recognizing amino acids in a sequence following which from these amino acids secondary structures are derived. Then based on the majority of the secondary structure final structure is derived. This work shows the prediction of secondary structure of proteins employing ANNs though it is restricted initially to four structures only. Keywords: Artificial Neural network, Protein Structure Prediction. 1 Introduction Protein Secondary Structure Prediction (PSSP) is the most challenging and influencing area of research in the field of bioinformatics. It deals with the prediction and analysis of macromolecules i.e. DNA, RNA and protein. Proteins are the fundamental molecules of all organisms. They are unique chains of amino acids. They adopt unique three dimensional structures which allow them to carry out intricate biological functions. The specifications of each protein are given by Hemashree Bordoloi Deptt. of Electronics &Communication Technology Gauhati University, Guwahati e mail: hbmaini@gmail.com Kandarpa Kumar Sarma Deptt. of Electronics &Communication Technology Gauhati University, Guwahati e mail: kandarpaks@gmail.com S. Patnaik & Y.-M. Yang (Eds.): Soft Computing Techniques in Vision Sci., SCI 395, pp springerlink.com Springer-Verlag Berlin Heidelberg 2012

2 138 H. Bordoloi and K.K. Sarma the sequence of amino acids [1]. Proteins are the building blocks of all biological organisms. The basis of proteins is amino acids. There are 20 different amino acids which are made up of carbon, hydrogen, nitrogen, oxygen and sulphur. Basically proteins have four different structures Primary: Sequence of amino acids is the primary structure. Secondary: Locally defined highly regular sub structures. Alpha helix, beta sheets and coil are the three secondary structures of proteins. Tertiary: Three dimensional structure or spatial arrangement of secondary structure. Quaternary: Complex of several protein molecules or polypeptide chains. Fig. 1 Four protein Structures The general approach to predict the secondary structure of a protein is done by comparing the amino acid sequence of a particular protein to sequences of the known databases. In protein secondary structure prediction, amino acid sequences are inputs and the resulting output is conformation or the predicted structure which is the combination of alpha helices, beta sheets and loops. In this work an ANN is trained with Amino Acids to predict the protein sequence. After the prediction of the protein sequence, a second ANN classifier is configured to determine the secondary structures.

3 Protein Structure Prediction Using Multiple Artificial Neural Network Classifier Basic Biological Concept Notion of homology is the basis of bioinformatics. In genomic bioinformatics function of a gene is predicted by the homology technique. It follows the rule that if the sequence of gene A, whose function is known, is homologous to the sequence of gene B, whose function is unknown, one could infer that B may share A's function. In the structural bioinformatics, homology is used to determine which parts of a protein are important in structure formation and interaction with other proteins. In homology modeling technique, this information is used to predict the structure of a protein once the structure of a homologous protein is known. Presently it remains the only way to predict protein structures reliably. By determining the structures of viral proteins it would enable researchers design drugs for specific viruses [2]. The secondary structure has 3 regular forms: helical (alpha (α) helices), extended (beta (β) sheets) and loops (also called reverse turns or coils). In the protein secondary structure prediction, the inputs are the amino acid sequences while the output is the predicted structure also called conformation, which is the combination of alpha helices, beta sheets and loops [2]. A typical protein sequence and its conformation class are shown below: ProteinSequence: ABABABABCCQQFFFAAAQQAQQA Conformation Class: HHHH EEEE HHHHHHHH where H means Helical, E means Extended, and blanks are the remaining coiled conformations. A typical protein contains about 32% alpha helices, 21% beta sheets and 47% loops or non-regular structure [2]. With a given protein sequence of amino acids a 1, a 2,...,a n the problem of secondary structure prediction is to predict whether each amino acid a i is in a α- helix, a β-sheet or neither. If the actual secondary structure for each amino acid is known by the studies of structural biology then the three state accuracy is the percent of residues for which the prediction matches reality. It is refers to as three state because each residue can be in one of three states: α, β or other (0) [3].Three state accuracy is given by Q 3 = [(P α +P β +P coil )/T] 100% where P α, P β, and P loop are number of residues predicted correctly in state alpha helix, beta strand and loop respectively and T is the total number of residues [2]. 3 Necessities of PSSP PSSP becomes the most influencing area of research due to the following: The basis of an organism that DNA, RNA and proteins, also called macromolecules can be predicted and analyzed by PSSP. Structure function relationship can also be provided by PSSP. It means that a particular protein structure is responsible for particular function which is

4 140 H. Bordoloi and K.K. Sarma to be known by PSSP. So by changing the structure of the proteins or by synthesizing new proteins, functions could be added or removed or desired functions could be obtained [5]. PSSP can determine the structure of the viral proteins which leads to the design of drugs for specific viruses. PSSP reduces the sequence structure gap [4]. One of the best example of the sequence structure gap is the large scale sequencing projects such as Human Genome Project. In such type of projects, protein sequences are produced at a very fast speed which results in a large gap between the number of known protein sequences (>150,000) and the no. of known protein structures (>4,000). This gap is called sequence structure gap and PSSP can successfully reduce this gap. Experimental techniques are not capable of structure determination of some proteins such as membrane proteins. So the prediction of protein structure using computational tool is of great interest [6]. 4 Basics of Artificial Neural Network An Artificial Neural Network (ANN) is a massively parallel distributed processor that has a natural propensity for storing experimental knowledge and making it available for use. They are made up of simple processing units called artificial neurons. It resembles the brain in two respects-- Knowledge is acquired by the network from its environment through a learning process. Interneuron connection strengths known as synaptic weights, are used to store the acquired knowledge[4]. Fig. 2 An Artificial Neural Network 5 Methodology This work consists of several steps as described below:

5 Protein Structure Prediction Using Multiple Artificial Neural Network Classifier Data Set: In our work we have considered four proteins that are Hemoglobin, Sickle Cell Anemia and Myoglobin and Insulin. We have considered these four proteins because though their function is different, these three proteins are closely related to each other. 2. Coding of Proteins: Based on the chemical structure of the amino acids a coding scheme is generated. BCD codes are used for coding. There is a unique BCD code for each component or symbol in the chemical structure. Considering 20 amino acids, each amino acid is coded using the generated coding scheme. Then the four proteins i.e. Hemoglobin, Sickle Cell Anemia, Myoglobin and Insulin are coded with the help of coded amino acids. 3. Configuration of ANN: A fully connected Multi Layer Perceptron (MLP) feedforward neural network is used for our proposed work. Backpropagation algorithm is used to update the weight of the network. Network comprises of only one hidden layer. Three ANN classifiers are designed for our work. First network classifies the amino acids, the second network classifies the protein primary structure and the third network classifies the secondary structure of proteins. Table 1 Parameters of Proposed ANN ANN Data Set Size Training Type Maximum No.of Epochs Variance in Training Data MLP Training:1000 Testing:985 TRAINLM % 4. Training and Testing of ANN: The network is trained with four coded protein structures. Then testing is done with the coded data to obtain the results. 6 System Model The system model as shown in Figure 3 comprises of three classifiers. The system is formed by two level classifiers. The first level classifier uses amino acids as inputs and provides the identification of the Amino Acids. These are applied to the second level classifiers which contain two MLPs. These classifiers receive identified Amino Acids for predicting alpha, beta and coils.

6 142 H. Bordoloi and K.K. Sarma Fig. 3 System Model for proposed work EPOCH TIME MSE % RATE secs % secs % secs % secs % 7 Results With the four protein structures the ANN during training shows 100% accuracy while validating the learning phase with the same set. The ANN is configured to handle an input of length 985 holding coded values of the protein structure. Four such samples representing the classes where initially taken during training. The ANN successfully recognizes the required parameters. The training is carried out with (error) back propagation algorithm with Levenberg-Marquardt optimization. The ANN is given a performance goal of around 10-6 which is attained after certain number of session though the time taken is around 80 seconds. With variations of upto ±20% in the training sequence the ANN handles the recognition without any variation in performance. It shows its robustness to variations after it is trained properly. The results also validate the coding scheme used for the work. Some problems, however, were observed due to the larger data sets which the ANN classifier was given to handle. It generates certain computational constrains. This shall be removed in subsequent stages of the work and extend it for the prediction of some unknown protein structure with subclasses. Further we are trying to go for GUI approach of our work.

7 Protein Structure Prediction Using Multiple Artificial Neural Network Classifier 143 Fig. 4 Performance graph for goal 0.01 Fig. 5 Performance graph for goal 0.001

8 144 H. Bordoloi and K.K. Sarma Fig. 6 Performance of Hemoglobin in percent Fig. 7 Performance of Insulin in percent Insulin

9 Protein Structure Prediction Using Multiple Artificial Neural Network Classifier 145 Fig. 8 Performance of Myoglobin in percent Fig. 9 Performance of Sickel Cell Anemia in percent 8 Conclusions This work shows how multi level ANN classifier can be configured for PSSP. The work may be extended to include more protein structures which shall make it a reliable set up for research in bioinformatics.

10 146 H. Bordoloi and K.K. Sarma References [1] Xiu-fen, Z., Zi-shu, P., Lishan, K., Chu-yu, Z.: The Evolutionary computation Techniques for Protein Structure Prediction A Survey. WU411 Wuhan University Journal of Natural Sciences 8(1B), Article ID: (2003)01Pr (2003) [2] Akkaladevi, S., Katangur, A.K., Belkasim, S., Pan, Y.: GA Protein Secondary Structure Prediction using Neural Network and Simulated Annealing Algorithm. In: Proceedings of the 26th Annual International Conference of the IEEE EMBS, San Francisco, CA, USA, September 1-5 (2004) [3] Ghoting, A.: Protein Secondary Structure Prediction using Neural Networks [4] Haykin, S.: Neural Networks A Comprehensive Foundation, 2nd edn. Pearson Education, New Delhi (2003) [5] Kim, H., Park, H.: Protein secondary structure prediction based on an improved support vector machine approach. Protein Eng. 16(8), (2003) [6] Afzal, A.: Applications of neural networks in protein structure prediction

Basics of protein structure

Basics of protein structure Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu

More information

CAP 5510 Lecture 3 Protein Structures

CAP 5510 Lecture 3 Protein Structures CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity

More information

Artificial Neural Network Method of Rock Mass Blastability Classification

Artificial Neural Network Method of Rock Mass Blastability Classification Artificial Neural Network Method of Rock Mass Blastability Classification Jiang Han, Xu Weiya, Xie Shouyi Research Institute of Geotechnical Engineering, Hohai University, Nanjing, Jiangshu, P.R.China

More information

Neural Networks and the Back-propagation Algorithm

Neural Networks and the Back-propagation Algorithm Neural Networks and the Back-propagation Algorithm Francisco S. Melo In these notes, we provide a brief overview of the main concepts concerning neural networks and the back-propagation algorithm. We closely

More information

ANN and Statistical Theory Based Forecasting and Analysis of Power System Variables

ANN and Statistical Theory Based Forecasting and Analysis of Power System Variables ANN and Statistical Theory Based Forecasting and Analysis of Power System Variables Sruthi V. Nair 1, Poonam Kothari 2, Kushal Lodha 3 1,2,3 Lecturer, G. H. Raisoni Institute of Engineering & Technology,

More information

Keywords- Source coding, Huffman encoding, Artificial neural network, Multilayer perceptron, Backpropagation algorithm

Keywords- Source coding, Huffman encoding, Artificial neural network, Multilayer perceptron, Backpropagation algorithm Volume 4, Issue 5, May 2014 ISSN: 2277 128X International Journal of Advanced Research in Computer Science and Software Engineering Research Paper Available online at: www.ijarcsse.com Huffman Encoding

More information

From Amino Acids to Proteins - in 4 Easy Steps

From Amino Acids to Proteins - in 4 Easy Steps From Amino Acids to Proteins - in 4 Easy Steps Although protein structure appears to be overwhelmingly complex, you can provide your students with a basic understanding of how proteins fold by focusing

More information

Presentation Outline. Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy

Presentation Outline. Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy Burkhard Rost and Chris Sander By Kalyan C. Gopavarapu 1 Presentation Outline Major Terminology Problem Method

More information

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its

More information

Artificial Neural Network

Artificial Neural Network Artificial Neural Network Contents 2 What is ANN? Biological Neuron Structure of Neuron Types of Neuron Models of Neuron Analogy with human NN Perceptron OCR Multilayer Neural Network Back propagation

More information

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748 CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr

More information

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this

More information

What is the central dogma of biology?

What is the central dogma of biology? Bellringer What is the central dogma of biology? A. RNA DNA Protein B. DNA Protein Gene C. DNA Gene RNA D. DNA RNA Protein Review of DNA processes Replication (7.1) Transcription(7.2) Translation(7.3)

More information

Protein Structure. W. M. Grogan, Ph.D. OBJECTIVES

Protein Structure. W. M. Grogan, Ph.D. OBJECTIVES Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate

More information

ARTIFICIAL NEURAL NETWORK PART I HANIEH BORHANAZAD

ARTIFICIAL NEURAL NETWORK PART I HANIEH BORHANAZAD ARTIFICIAL NEURAL NETWORK PART I HANIEH BORHANAZAD WHAT IS A NEURAL NETWORK? The simplest definition of a neural network, more properly referred to as an 'artificial' neural network (ANN), is provided

More information

Ch 3: Chemistry of Life. Chemistry Water Macromolecules Enzymes

Ch 3: Chemistry of Life. Chemistry Water Macromolecules Enzymes Ch 3: Chemistry of Life Chemistry Water Macromolecules Enzymes Chemistry Atom = smallest unit of matter that cannot be broken down by chemical means Element = substances that have similar properties and

More information

Improved Protein Secondary Structure Prediction

Improved Protein Secondary Structure Prediction Improved Protein Secondary Structure Prediction Secondary Structure Prediction! Given a protein sequence a 1 a 2 a N, secondary structure prediction aims at defining the state of each amino acid ai as

More information

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL

More information

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK

More information

BIOINFORMATICS: An Introduction

BIOINFORMATICS: An Introduction BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and

More information

COMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University

COMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018

More information

Application of Artificial Neural Networks in Evaluation and Identification of Electrical Loss in Transformers According to the Energy Consumption

Application of Artificial Neural Networks in Evaluation and Identification of Electrical Loss in Transformers According to the Energy Consumption Application of Artificial Neural Networks in Evaluation and Identification of Electrical Loss in Transformers According to the Energy Consumption ANDRÉ NUNES DE SOUZA, JOSÉ ALFREDO C. ULSON, IVAN NUNES

More information

Unit 1: Chemistry - Guided Notes

Unit 1: Chemistry - Guided Notes Scientific Method Notes: Unit 1: Chemistry - Guided Notes 1 Common Elements in Biology: Atoms are made up of: 1. 2. 3. In order to be stable, an atom of an element needs a full valence shell of electrons.

More information

Application of Associative Matrices to Recognize DNA Sequences in Bioinformatics

Application of Associative Matrices to Recognize DNA Sequences in Bioinformatics Application of Associative Matrices to Recognize DNA Sequences in Bioinformatics 1. Introduction. Jorge L. Ortiz Department of Electrical and Computer Engineering College of Engineering University of Puerto

More information

Motif Prediction in Amino Acid Interaction Networks

Motif Prediction in Amino Acid Interaction Networks Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture

More information

HIV protease inhibitor. Certain level of function can be found without structure. But a structure is a key to understand the detailed mechanism.

HIV protease inhibitor. Certain level of function can be found without structure. But a structure is a key to understand the detailed mechanism. Proteins are linear polypeptide chains (one or more) Building blocks: 20 types of amino acids. Range from a few 10s-1000s They fold into varying three-dimensional shapes structure medicine Certain level

More information

Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics

Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia

More information

Protein Secondary Structure Prediction

Protein Secondary Structure Prediction part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 the goal is the prediction of the secondary structure conformation which is local each amino

More information

Human Biology. The Chemistry of Living Things. Concepts and Current Issues. All Matter Consists of Elements Made of Atoms

Human Biology. The Chemistry of Living Things. Concepts and Current Issues. All Matter Consists of Elements Made of Atoms 2 The Chemistry of Living Things PowerPoint Lecture Slide Presentation Robert J. Sullivan, Marist College Michael D. Johnson Human Biology Concepts and Current Issues THIRD EDITION Copyright 2006 Pearson

More information

Artifical Neural Networks

Artifical Neural Networks Neural Networks Artifical Neural Networks Neural Networks Biological Neural Networks.................................. Artificial Neural Networks................................... 3 ANN Structure...........................................

More information

An Artificial Neural Network Classifier for the Prediction of Protein Structural Classes

An Artificial Neural Network Classifier for the Prediction of Protein Structural Classes International Journal of Current Engineering and Technology E-ISSN 2277 4106, P-ISSN 2347 5161 2017 INPRESSCO, All Rights Reserved Available at http://inpressco.com/category/ijcet Research Article An Artificial

More information

Protein Secondary Structure Prediction

Protein Secondary Structure Prediction Protein Secondary Structure Prediction Doug Brutlag & Scott C. Schmidler Overview Goals and problem definition Existing approaches Classic methods Recent successful approaches Evaluating prediction algorithms

More information

Protein Secondary Structure Prediction using Pattern Recognition Neural Network

Protein Secondary Structure Prediction using Pattern Recognition Neural Network Protein Secondary Structure Prediction using Pattern Recognition Neural Network P.V. Nageswara Rao 1 (nagesh@gitam.edu), T. Uma Devi 1, DSVGK Kaladhar 1, G.R. Sridhar 2, Allam Appa Rao 3 1 GITAM University,

More information

The Structure and Functions of Proteins

The Structure and Functions of Proteins Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science and Engineering 2003 The Structure and Functions of Proteins Dan E. Krane Wright State University

More information

Artificial Intelligence (AI) Common AI Methods. Training. Signals to Perceptrons. Artificial Neural Networks (ANN) Artificial Intelligence

Artificial Intelligence (AI) Common AI Methods. Training. Signals to Perceptrons. Artificial Neural Networks (ANN) Artificial Intelligence Artificial Intelligence (AI) Artificial Intelligence AI is an attempt to reproduce intelligent reasoning using machines * * H. M. Cartwright, Applications of Artificial Intelligence in Chemistry, 1993,

More information

Radial Basis Function Neural Networks in Protein Sequence Classification ABSTRACT

Radial Basis Function Neural Networks in Protein Sequence Classification ABSTRACT (): 195-04 (008) Radial Basis Function Neural Networks in Protein Sequence Classification Zarita Zainuddin and Maragatham Kumar School of Mathematical Sciences, University Science Malaysia, 11800 USM Pulau

More information

Lecture 7 Artificial neural networks: Supervised learning

Lecture 7 Artificial neural networks: Supervised learning Lecture 7 Artificial neural networks: Supervised learning Introduction, or how the brain works The neuron as a simple computing element The perceptron Multilayer neural networks Accelerated learning in

More information

Protein Secondary Structure Prediction using Feed-Forward Neural Network

Protein Secondary Structure Prediction using Feed-Forward Neural Network COPYRIGHT 2010 JCIT, ISSN 2078-5828 (PRINT), ISSN 2218-5224 (ONLINE), VOLUME 01, ISSUE 01, MANUSCRIPT CODE: 100713 Protein Secondary Structure Prediction using Feed-Forward Neural Network M. A. Mottalib,

More information

Protein Structure Prediction Using Neural Networks

Protein Structure Prediction Using Neural Networks Protein Structure Prediction Using Neural Networks Martha Mercaldi Kasia Wilamowska Literature Review December 16, 2003 The Protein Folding Problem Evolution of Neural Networks Neural networks originally

More information

BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) PROTEINS

BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) PROTEINS BIOLOGY BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) NAME NAME PERIOD PROTEINS GENERAL CHARACTERISTICS AND IMPORTANCES: Polymers of amino acids Each has unique 3-D shape Vary in sequence of amino

More information

Computational Biology: Basics & Interesting Problems

Computational Biology: Basics & Interesting Problems Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information

More information

Supersecondary Structures (structural motifs)

Supersecondary Structures (structural motifs) Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric

More information

Introduction to" Protein Structure

Introduction to Protein Structure Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.

More information

Using Neural Networks for Identification and Control of Systems

Using Neural Networks for Identification and Control of Systems Using Neural Networks for Identification and Control of Systems Jhonatam Cordeiro Department of Industrial and Systems Engineering North Carolina A&T State University, Greensboro, NC 27411 jcrodrig@aggies.ncat.edu

More information

Protein Structure Basics

Protein Structure Basics Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes

More information

Biophysics II. Key points to be covered. Molecule and chemical bonding. Life: based on materials. Molecule and chemical bonding

Biophysics II. Key points to be covered. Molecule and chemical bonding. Life: based on materials. Molecule and chemical bonding Biophysics II Life: based on materials By A/Prof. Xiang Yang Liu Biophysics & Micro/nanostructures Lab Department of Physics, NUS Organelle, formed by a variety of molecules: protein, DNA, RNA, polysaccharides

More information

Convolutional Associative Memory: FIR Filter Model of Synapse

Convolutional Associative Memory: FIR Filter Model of Synapse Convolutional Associative Memory: FIR Filter Model of Synapse Rama Murthy Garimella 1, Sai Dileep Munugoti 2, Anil Rayala 1 1 International Institute of Information technology, Hyderabad, India. rammurthy@iiit.ac.in,

More information

Protein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds

Protein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino

More information

1. (5) Draw a diagram of an isomeric molecule to demonstrate a structural, geometric, and an enantiomer organization.

1. (5) Draw a diagram of an isomeric molecule to demonstrate a structural, geometric, and an enantiomer organization. Organic Chemistry Assignment Score. Name Sec.. Date. Working by yourself or in a group, answer the following questions about the Organic Chemistry material. This assignment is worth 35 points with the

More information

PROTEIN SECONDARY STRUCTURE PREDICTION: AN APPLICATION OF CHOU-FASMAN ALGORITHM IN A HYPOTHETICAL PROTEIN OF SARS VIRUS

PROTEIN SECONDARY STRUCTURE PREDICTION: AN APPLICATION OF CHOU-FASMAN ALGORITHM IN A HYPOTHETICAL PROTEIN OF SARS VIRUS Int. J. LifeSc. Bt & Pharm. Res. 2012 Kaladhar, 2012 Research Paper ISSN 2250-3137 www.ijlbpr.com Vol.1, Issue. 1, January 2012 2012 IJLBPR. All Rights Reserved PROTEIN SECONDARY STRUCTURE PREDICTION:

More information

Design Collocation Neural Network to Solve Singular Perturbed Problems with Initial Conditions

Design Collocation Neural Network to Solve Singular Perturbed Problems with Initial Conditions Article International Journal of Modern Engineering Sciences, 204, 3(): 29-38 International Journal of Modern Engineering Sciences Journal homepage:www.modernscientificpress.com/journals/ijmes.aspx ISSN:

More information

Protein Structure Prediction and Display

Protein Structure Prediction and Display Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each

More information

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding

More information

Analysis and Prediction of Protein Structure (I)

Analysis and Prediction of Protein Structure (I) Analysis and Prediction of Protein Structure (I) Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 2006 Free for academic use. Copyright @ Jianlin Cheng

More information

Proteins. Division Ave. High School Ms. Foglia AP Biology. Proteins. Proteins. Multipurpose molecules

Proteins. Division Ave. High School Ms. Foglia AP Biology. Proteins. Proteins. Multipurpose molecules Proteins Proteins Multipurpose molecules 2008-2009 Proteins Most structurally & functionally diverse group Function: involved in almost everything u enzymes (pepsin, DNA polymerase) u structure (keratin,

More information

Part 7 Bonds and Structural Supports

Part 7 Bonds and Structural Supports Part 7 Bonds and Structural Supports http://cbm.msoe.edu/newwebsite/learntomodel Introduction In addition to covalent bonds between atoms in a molecule, Jmol has the ability to render Hydrogen Bonds and

More information

Bonds and Structural Supports

Bonds and Structural Supports Bonds and Structural Supports Part of the Jmol Training Guide from the MSOE Center for BioMolecular Modeling Interactive version available at http://cbm.msoe.edu/teachingresources/jmol/jmoltraining/struts.html

More information

Combination of M-Estimators and Neural Network Model to Analyze Inside/Outside Bark Tree Diameters

Combination of M-Estimators and Neural Network Model to Analyze Inside/Outside Bark Tree Diameters Combination of M-Estimators and Neural Network Model to Analyze Inside/Outside Bark Tree Diameters Kyriaki Kitikidou, Elias Milios, Lazaros Iliadis, and Minas Kaymakis Democritus University of Thrace,

More information

Biomolecules. Energetics in biology. Biomolecules inside the cell

Biomolecules. Energetics in biology. Biomolecules inside the cell Biomolecules Energetics in biology Biomolecules inside the cell Energetics in biology The production of energy, its storage, and its use are central to the economy of the cell. Energy may be defined as

More information

Protein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods

Protein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods Cell communication channel Bioinformatics Methods Iosif Vaisman Email: ivaisman@gmu.edu SEQUENCE STRUCTURE DNA Sequence Protein Sequence Protein Structure Protein structure ATGAAATTTGGAAACTTCCTTCTCACTTATCAGCCACCT...

More information

Protein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1

Protein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1 Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2

More information

Figure ) Letter E represents a nucleic acid building block known as a. Answer: nucleotide Diff: 3 Page Ref: 54

Figure ) Letter E represents a nucleic acid building block known as a. Answer: nucleotide Diff: 3 Page Ref: 54 Essentials of Human Anatomy and Physiology, 10e (Marieb) Chapter 2 Basic Chemistry 2.1 Short Answer Figure 2.1 Using Figure 2.1, identify the following: 1) Which letter represents a carbohydrate polymer?

More information

PROTEIN SECONDARY STRUCTURE PREDICTION USING NEURAL NETWORKS AND SUPPORT VECTOR MACHINES

PROTEIN SECONDARY STRUCTURE PREDICTION USING NEURAL NETWORKS AND SUPPORT VECTOR MACHINES PROTEIN SECONDARY STRUCTURE PREDICTION USING NEURAL NETWORKS AND SUPPORT VECTOR MACHINES by Lipontseng Cecilia Tsilo A thesis submitted to Rhodes University in partial fulfillment of the requirements for

More information

Properties of amino acids in proteins

Properties of amino acids in proteins Properties of amino acids in proteins one of the primary roles of DNA (but not the only one!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids repeated

More information

Learning and Memory in Neural Networks

Learning and Memory in Neural Networks Learning and Memory in Neural Networks Guy Billings, Neuroinformatics Doctoral Training Centre, The School of Informatics, The University of Edinburgh, UK. Neural networks consist of computational units

More information

AP Biology. Proteins. AP Biology. Proteins. Multipurpose molecules

AP Biology. Proteins. AP Biology. Proteins. Multipurpose molecules Proteins Proteins Multipurpose molecules 2008-2009 1 Proteins Most structurally & functionally diverse group Function: involved in almost everything u enzymes (pepsin, DNA polymerase) u structure (keratin,

More information

Computational Biology 1

Computational Biology 1 Computational Biology 1 Protein Function & nzyme inetics Guna Rajagopal, Bioinformatics Institute, guna@bii.a-star.edu.sg References : Molecular Biology of the Cell, 4 th d. Alberts et. al. Pg. 129 190

More information

A New Similarity Measure among Protein Sequences

A New Similarity Measure among Protein Sequences A New Similarity Measure among Protein Sequences Kuen-Pin Wu, Hsin-Nan Lin, Ting-Yi Sung and Wen-Lian Hsu * Institute of Information Science Academia Sinica, Taipei 115, Taiwan Abstract Protein sequence

More information

Bi 8 Midterm Review. TAs: Sarah Cohen, Doo Young Lee, Erin Isaza, and Courtney Chen

Bi 8 Midterm Review. TAs: Sarah Cohen, Doo Young Lee, Erin Isaza, and Courtney Chen Bi 8 Midterm Review TAs: Sarah Cohen, Doo Young Lee, Erin Isaza, and Courtney Chen The Central Dogma Biology Fundamental! Prokaryotes and Eukaryotes Nucleic Acid Components Nucleic Acid Structure DNA Base

More information

Biological Macromolecules

Biological Macromolecules Introduction for Chem 493 Chemistry of Biological Macromolecules Dr. L. Luyt January 2008 Dr. L. Luyt Chem 493-2008 1 Biological macromolecules are the molecules of life allow for organization serve a

More information

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

ARTIFICIAL INTELLIGENCE. Artificial Neural Networks

ARTIFICIAL INTELLIGENCE. Artificial Neural Networks INFOB2KI 2017-2018 Utrecht University The Netherlands ARTIFICIAL INTELLIGENCE Artificial Neural Networks Lecturer: Silja Renooij These slides are part of the INFOB2KI Course Notes available from www.cs.uu.nl/docs/vakken/b2ki/schema.html

More information

ALL LECTURES IN SB Introduction

ALL LECTURES IN SB Introduction 1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL

More information

COMP-4360 Machine Learning Neural Networks

COMP-4360 Machine Learning Neural Networks COMP-4360 Machine Learning Neural Networks Jacky Baltes Autonomous Agents Lab University of Manitoba Winnipeg, Canada R3T 2N2 Email: jacky@cs.umanitoba.ca WWW: http://www.cs.umanitoba.ca/~jacky http://aalab.cs.umanitoba.ca

More information

Automated Assignment of Backbone NMR Data using Artificial Intelligence

Automated Assignment of Backbone NMR Data using Artificial Intelligence Automated Assignment of Backbone NMR Data using Artificial Intelligence John Emmons στ, Steven Johnson τ, Timothy Urness*, and Adina Kilpatrick* Department of Computer Science and Mathematics Department

More information

Bioinformatics: Secondary Structure Prediction

Bioinformatics: Secondary Structure Prediction Bioinformatics: Secondary Structure Prediction Prof. David Jones d.jones@cs.ucl.ac.uk LMLSTQNPALLKRNIIYWNNVALLWEAGSD The greatest unsolved problem in molecular biology:the Protein Folding Problem? Entries

More information

Reconstructing Amino Acid Interaction Networks by an Ant Colony Approach

Reconstructing Amino Acid Interaction Networks by an Ant Colony Approach Author manuscript, published in "Journal of Computational Intelligence in Bioinformatics 2, 2 (2009) 131-146" Reconstructing Amino Acid Interaction Networks by an Ant Colony Approach Omar GACI and Stefan

More information

Biomolecules: lecture 10

Biomolecules: lecture 10 Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet

More information

A General Method for Combining Predictors Tested on Protein Secondary Structure Prediction

A General Method for Combining Predictors Tested on Protein Secondary Structure Prediction A General Method for Combining Predictors Tested on Protein Secondary Structure Prediction Jakob V. Hansen Department of Computer Science, University of Aarhus Ny Munkegade, Bldg. 540, DK-8000 Aarhus C,

More information

EE04 804(B) Soft Computing Ver. 1.2 Class 2. Neural Networks - I Feb 23, Sasidharan Sreedharan

EE04 804(B) Soft Computing Ver. 1.2 Class 2. Neural Networks - I Feb 23, Sasidharan Sreedharan EE04 804(B) Soft Computing Ver. 1.2 Class 2. Neural Networks - I Feb 23, 2012 Sasidharan Sreedharan www.sasidharan.webs.com 3/1/2012 1 Syllabus Artificial Intelligence Systems- Neural Networks, fuzzy logic,

More information

BIRKBECK COLLEGE (University of London)

BIRKBECK COLLEGE (University of London) BIRKBECK COLLEGE (University of London) SCHOOL OF BIOLOGICAL SCIENCES M.Sc. EXAMINATION FOR INTERNAL STUDENTS ON: Postgraduate Certificate in Principles of Protein Structure MSc Structural Molecular Biology

More information

4. Multilayer Perceptrons

4. Multilayer Perceptrons 4. Multilayer Perceptrons This is a supervised error-correction learning algorithm. 1 4.1 Introduction A multilayer feedforward network consists of an input layer, one or more hidden layers, and an output

More information

Protein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror

Protein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror Protein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror Please interrupt if you have questions, and especially if you re confused! Assignment

More information

RNA and Protein Structure Prediction

RNA and Protein Structure Prediction RNA and Protein Structure Prediction Bioinformatics: Issues and Algorithms CSE 308-408 Spring 2007 Lecture 18-1- Outline Multi-Dimensional Nature of Life RNA Secondary Structure Prediction Protein Structure

More information

BA, BSc, and MSc Degree Examinations

BA, BSc, and MSc Degree Examinations Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes

More information

BME Engineering Molecular Cell Biology. Structure and Dynamics of Cellular Molecules. Basics of Cell Biology Literature Reading

BME Engineering Molecular Cell Biology. Structure and Dynamics of Cellular Molecules. Basics of Cell Biology Literature Reading BME 42-620 Engineering Molecular Cell Biology Lecture 05: Structure and Dynamics of Cellular Molecules Basics of Cell Biology Literature Reading BME42-620 Lecture 05, September 13, 2011 1 Outline Review:

More information

Enzyme Catalysis & Biotechnology

Enzyme Catalysis & Biotechnology L28-1 Enzyme Catalysis & Biotechnology Bovine Pancreatic RNase A Biochemistry, Life, and all that L28-2 A brief word about biochemistry traditionally, chemical engineers used organic and inorganic chemistry

More information

Model Mélange. Physical Models of Peptides and Proteins

Model Mélange. Physical Models of Peptides and Proteins Model Mélange Physical Models of Peptides and Proteins In the Model Mélange activity, you will visit four different stations each featuring a variety of different physical models of peptides or proteins.

More information

Bioinformatics: Secondary Structure Prediction

Bioinformatics: Secondary Structure Prediction Bioinformatics: Secondary Structure Prediction Prof. David Jones d.t.jones@ucl.ac.uk Possibly the greatest unsolved problem in molecular biology: The Protein Folding Problem MWMPPRPEEVARK LRRLGFVERMAKG

More information

SUPPLEMENTARY MATERIALS

SUPPLEMENTARY MATERIALS SUPPLEMENTARY MATERIALS Enhanced Recognition of Transmembrane Protein Domains with Prediction-based Structural Profiles Baoqiang Cao, Aleksey Porollo, Rafal Adamczak, Mark Jarrell and Jaroslaw Meller Contact:

More information

A Novel Activity Detection Method

A Novel Activity Detection Method A Novel Activity Detection Method Gismy George P.G. Student, Department of ECE, Ilahia College of,muvattupuzha, Kerala, India ABSTRACT: This paper presents an approach for activity state recognition of

More information

1/23/2012. Atoms. Atoms Atoms - Electron Shells. Chapter 2 Outline. Planetary Models of Elements Chemical Bonds

1/23/2012. Atoms. Atoms Atoms - Electron Shells. Chapter 2 Outline. Planetary Models of Elements Chemical Bonds Chapter 2 Outline Atoms Chemical Bonds Acids, Bases and the p Scale Organic Molecules Carbohydrates Lipids Proteins Nucleic Acids Are smallest units of the chemical elements Composed of protons, neutrons

More information

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure

More information

An ANN based Rotor Flux Estimator for Vector Controlled Induction Motor Drive

An ANN based Rotor Flux Estimator for Vector Controlled Induction Motor Drive International Journal of Electrical Engineering. ISSN 974-58 Volume 5, Number 4 (), pp. 47-46 International Research Publication House http://www.irphouse.com An based Rotor Flux Estimator for Vector Controlled

More information

Artificial Neural Network : Training

Artificial Neural Network : Training Artificial Neural Networ : Training Debasis Samanta IIT Kharagpur debasis.samanta.iitgp@gmail.com 06.04.2018 Debasis Samanta (IIT Kharagpur) Soft Computing Applications 06.04.2018 1 / 49 Learning of neural

More information

Rainfall Prediction using Back-Propagation Feed Forward Network

Rainfall Prediction using Back-Propagation Feed Forward Network Rainfall Prediction using Back-Propagation Feed Forward Network Ankit Chaturvedi Department of CSE DITMR (Faridabad) MDU Rohtak (hry). ABSTRACT Back propagation is most widely used in neural network projects

More information

Analysis of Multilayer Neural Network Modeling and Long Short-Term Memory

Analysis of Multilayer Neural Network Modeling and Long Short-Term Memory Analysis of Multilayer Neural Network Modeling and Long Short-Term Memory Danilo López, Nelson Vera, Luis Pedraza International Science Index, Mathematical and Computational Sciences waset.org/publication/10006216

More information

MATHEMATICAL MODELS - Vol. III - Mathematical Modeling and the Human Genome - Hilary S. Booth MATHEMATICAL MODELING AND THE HUMAN GENOME

MATHEMATICAL MODELS - Vol. III - Mathematical Modeling and the Human Genome - Hilary S. Booth MATHEMATICAL MODELING AND THE HUMAN GENOME MATHEMATICAL MODELING AND THE HUMAN GENOME Hilary S. Booth Australian National University, Australia Keywords: Human genome, DNA, bioinformatics, sequence analysis, evolution. Contents 1. Introduction:

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction CMPS 6630: Introduction to Computational Biology and Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the

More information