Binding Studies on Trafficking Proteins Using Microcalorimetry McMahon lab
|
|
- Adam McCormick
- 5 years ago
- Views:
Transcription
1 Binding Studies on Trafficking Proteins Using Microcalorimetry McMahon lab Neurobiology Division Laboratory of Molecular Biology Cambridge
2 Clathrin Mediated Endocytosis Binding Recruitment Coating Budding Uncoating Receptor Ligand AP adaptor complex Regulatory adaptor Clathrin Dynamin
3 Receptor Mediated Endocytosis a b c a) Yolk protein (Gilbert und Perry 1979) b) Low Density Lipoprotein (Anderson et al. 1977) c) Virus particle (Matlin et al. 1981) Replica of the inner membrane surface (Heuser and Anderson 1989)
4 AP Adaptor Complex β 1-4 α, γ, δ, ε Appendage binds regulators Hinge binds clathrin µ 1-4 σ 1-4 Trunk binds lipids and membrane proteins AP-1 (γ): TGN / Endosome AP-2 (α): Plasma membrane AP-3 (δ): Lysosome AP-4 (ε): TGN Collins et al. 22
5 AP Trafficking Pathways Plasma membrane AP-2 Endosome Lysosome AP-3 Lysosome-related Organelle AP-4 GGA AP-1 AP-3 Trans-Golgi-Network
6 AP Appendage Domains FxDxF DP(F/W) DP(F/W) DPW FxxF α-adaptin β-adaptin γ-adaptin Owen et al Brett et al. 22 Owen et al. 2 Kent et al. 22 Nogi et al. 22
7 Regulatory Adaptors Epsin1 EpsinR AP18 Dab2 Eps15 Amphiphysin1 Aminoacid DOMAIN SH3 PTB ANTH/ENTH BAR EH Clathin-Box DxF/W NPF PxxPxR PARTNER PxxPxR Receptor and Lipids Lipids Lipids NPF Clathrin α- and β-adaptin EH SH3
8 Interactions in Trafficking Amphiphysin Receptor Lipids YxxΦ or LL LLDLD AP-Complex DxF or FxxF Clathrin Eps15 LLDLD NPF Epsin1 EpsinR AP18 Dab2
9 Determination of Binding Constants Definition of Association and Dissociation Constants: k 1 [P] f ree = conc. of free protein For a binding reaction at equilibrium: P + L PL [L] f ree = conc. of free ligand k -1 [PL] = conc. of PA complex k 1 = rate constant for formation of [PL] k -1 = rate constant for breakdown of [PL] The rate of formation of [PL] is k 1 [P] f ree [L] f ree, where k 1 is a second order rate constant with units of l/mol -1 s -1. The rate of breakdown of [PL] is k -1 [PL], where k -1 is a first order rate constant with units of s -1. At equilibrium, the rate of formation of [PL] equals the rate of its breakdown, so k 1 [P] f ree [L] f ree = k -1 [PL]. Also recall that: K D = k -1 / k 1 = [P] f ree [L] f ree / [PL] = 1 / K A K D is given in units of concentration (e.g., mol/l) Or, in terms of fraction of protein binding sites occupied (y), which is often convenient to measure: y = [PL] / ([P] f ree + [PL]) = [L] f ree / ([L] f ree + K D ) Use [PL] = K A [P] f ree [L] f ree Divide through by K A Replace K A by 1 / K D
10 Determination of Binding Constants Special cases: y = [L] f ree / ([L] f ree + K D ) For [L] f ree = : y = For [L] f ree : y = 1 For [L] f ree = K D : y =.5 nothing bound full occupancy half occupancy Two possible ways to determine binding constants: 1. Measure bound and free ligand at equilibrium as a function of concentration 2. Measure association and dissociation rate constants and use these to calculate binding constants
11 Methods to determine Binding Constants Signal Information Advantage Disadvantage Spectroscopy change of absorption K D ( M) in solution probe needed (Fluorescence, UV/Vis, CD) or emission of light Microcalorimetry heat of binding K D ( M) no labels, large sample H, S, n in solution direct access to H direct access to n Surface Plasmon Resonance change of refractive K D ( M) small sample, surface coupled, index due to mass k 1, k -1 automated ligand must have large mass Stopped-Flow coupled to spectroscopy K D ( M) fast probe needed k 1, k -1 Analytical Ultracentrifugation absorption at different K D ( M) good for slow radii for different times homomeric interactions Nuclear Magnetic Resonance shift of magnetic K D ( M) in solution, slow, resonance frequency structural large sample, information expensive Binding Assays various, e.g. SDS-PAGE, K D ( M) can be most sometimes densitometry, radio- sensitive inaccurate activity
12 Isothermal Titration Calorimetry (ITC)
13 Isothermal Titration Calorimetry (ITC) Taken from Micro Cal website
14 Isothermal Titration Calorimetry (ITC) Review of Free Energies, Enthalpies, and Entropies of Binding G bind = RT lnk D (where R= 1.98 cal mol 1 K -1 ; T= K, and RT =.62 kcal/mol at 37 C) Note log relationship between free energy and binding constants Recall that G bind is relative to standard conditions (typically 1M reactants, 25 C, standard salt) A convenient rule of thumb is that a 1-fold change in binding constant corresponds to 1.4 kcal / mol. G A1-A2 = RT ln(k D A1 / K D A2)= (.62 kcal / mol)ln(1-8 M / 1-7 M) = -1.4 kcal / mol How many kcal / mol change in free energy do you need to change K D 1-fold?
15 Isothermal Titration Calorimetry (ITC) Review of Free Energies, Enthalpies, and Entropies of Binding G bind = RT lnk D (where R= 1.98 cal mol 1 K -1 ; T= K, and RT =.62 kcal/mol at 37 C) Note log relationship between free energy and binding constants Recall that G bind is relative to standard conditions (typically 1M reactants, 25 C, standard salt) A convenient rule of thumb is that a 1-fold change in binding constant corresponds to 1.4 kcal / mol. G A1-A2 = RT ln(k D A1 / K D A2)= (.62 kcal / mol)ln(1-8 M / 1-7 M) = -1.4 kcal / mol How many kcal / mol change in free energy do you need to change K D 1-fold? kcal / mol
16 Isothermal Titration Calorimetry (ITC) Review of Free Energies, Enthalpies, and Entropies of Binding G bind = RT lnk D (where R= 1.98 cal mol 1 K -1 ; T= K, and RT =.62 kcal/mol at 37 C) Note log relationship between free energy and binding constants Recall that G bind is relative to standard conditions (typically 1M reactants, 25 C, standard salt) A convenient rule of thumb is that a 1-fold change in binding constant corresponds to 1.4 kcal / mol. G A1-A2 = RT ln(k D A1 / K D A2)= (.62 kcal / mol)ln(1-8 M / 1-7 M) = -1.4 kcal / mol How many kcal / mol change in free energy do you need to change K D 1-fold? kcal / mol Recall also that free energy has enthalpy and entropy components: G = H -T S (and therefore) RTlnK A = H -T S When is an interaction strong? G must be large and negative H must be large and negative (gain new bonds) S must be large and positive (gain more entropy)
17 Isothermal Titration Calorimetry (ITC) Time (min) µcal/s -2 kcal/mol Ligand affinity: 1/K d stochiometry: N enthalpy: H Ligand / Protein
18 Isothermal Titration Calorimetry (ITC) Time (min) µcal/s -2 kcal/mol Ligand affinity: 1/K d stochiometry: N enthalpy: H G= Ligand / Protein H= 19.9 T S= 5.8
19 Binding Specificity α-adaptin and Amphiphysin Amph DNF-SGA DPF-SGA DNF+DPF-SGA Extract Amph DNF-ANF DNF-DPF DNF-RPF DNF-DPP DNF-DPW DNF-DGF DNF-DIF DNF-DLF DNF-DAF DNF-DDF DNF-DSF DNF-EPL Extract α -Adaptin α -Adaptin β-adaptin β-adaptin Sequence ramphiphysin1 INFFEDNFVPEINVTTPSQNEVLEVKKEE TLLDLDFDPFKPDVTPAGSAAATHSPMSQTLPWDLW ramphiphysin2 LSLFDDAFVPEISVTTPSQFEAPGPFSEQASLLDLDFEPLPPVASPVKAPTPSG QSIPWDLW Praefcke et al. 24 Olesen et al. 27
20 5 7 Time (min) Binding Specificity α-adaptin and Amphiphysin DxF Peptide Sequence K D (µm) µcal/s kcal/mol Peptide DNF-Peptide / α-appendage DNF 7mer FEDNFVP 21 DNF to RNF 7mer FERNFVP no binding DNF 8mer FEDNFVPE 28 DNF 12mer INFFEDNFVPEI 2.5 DNF to DPF 12mer INFFEDPFVPEI 12 DNF to DAF 12mer INFFEDAFVPEI 21 DNF FE-change INFEFDNFVPEI 18 DPF 12mer LDLDFDPFKPDV 19 DPF to DNF-12mer LDLDFDNFKPDV no binding Sequence ramphiphysin1 INFFEDNFVPEINVTTPSQNEVLEVKKEE TLLDLDFDPFKPDVTPAGSAAATHSPMSQTLPWDLW ramphiphysin2 LSLFDDAFVPEISVTTPSQFEAPGPFSEQASLLDLDFEPLPPVASPVKAPTPSG QSIPWDLW Praefcke et al. 24 Olesen et al. 27
21 5 Time (min) Binding Specificity α-adaptin and Amphiphysin 7 DxF Peptide Sequence K D (µm) µcal/s kcal/mol Peptide DNF-Peptide / α-appendage DNF 7mer FEDNFVP 21 DNF to RNF 7mer FERNFVP no binding DNF 8mer FEDNFVPE 28 DNF 12mer INFFEDNFVPEI 2.5 DNF to DPF 12mer INFFEDPFVPEI 12 DNF to DAF 12mer INFFEDAFVPEI 21 DNF FE-change INFEFDNFVPEI 18 DPF 12mer LDLDFDPFKPDV 19 DPF to DNF-12mer LDLDFDNFKPDV no binding Synaptojanin LDGFEDNFDLQS 4.5 HIP1 DNKFDDIFGSSF 1 Dab2 QSNFLDLFKGNA no binding DNF-site is 8 fold stronger than DPF-site Very good correlation between Western Blots and ITC Residue at position 4 in FxDxF is important (N>S>A>I>P>L) Prediction for other proteins possible Praefcke et al. 24 Olesen et al. 27
22 Lipid Binding Epsin1 ENTH domain PtdCho PtdEth PtdIns(5)P PtdIns(4)P PtdIns(3)P PtdIns LysoPtdCho LysoPtdAcid Blank PtdSer PtdAcid PtdIns(3,4,5)P 3 PtdIns(3,5)P 2 PtdIns(4,5)P 2 PtdIns(3,4)P 2 Sphing-1-P P S P S P S P S P S P S P S Ford et al. 22
23 Time (min) Lipid Binding Epsin1 ENTH domain kcal/mol InsP x µcal/s K D (µm) Ins(1,4)P 2 >1, Ins(1,5)P 2 >1, Ins(1,3,5)P 3 12 Ins(1,4,5)P Ins(1,3,4,5)P InsP 6.55 dic 8 PtdIns(4,5)P InsP x / Epsin1 ENTH Good correlation between ITC and other binding assays Head groups are a good model for the lipid molecules Ford et al. 22
24 kcal/mol Protein µcal/s Epsin1 Disabled2 Time (min) Protein / PI(4,5)P 2 in outer leaflet Lipid Binding Epsin1 ENTH domain Liposomes Liposomes + ENTH Data for Epsin1-ENTH with liposomes is different from control protein ITC reveals tubulation of liposomes by the ENTH domain Ford et al. 22
25 Truncations Point Mutations Multiple Binding Sites EpsinR and γ-adaptin D325R D328R D349R D371R E391R D422R Clathrin γ-adaptin (291)AHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGSAAASGS <325 <328 <334 <345 <349 <371 <379 <391 <397 <422 FPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDL(426) Mills et al. 23
26 Time (min) Multiple Binding Sites EpsinR and γ-adaptin kcal/mol EpsinR µcal/s EpsinR / γ-adaptin-appendage One Site Model N K D (µm) Two Site Model N1 K D (µm) N2 K D (µm) Mills et al. 23
27 Multiple Binding Sites EpsinR and γ-adaptin Time (min) Time (min) kcal/mol EpsinR µcal/s EpsinR / γ-adaptin-appendage µcal/s kcal/mol γ-adaptin γ-adaptin-appendage / EpsinR One Site Model N K D (µm) Two Site Model N1 K D (µm) N2 K D (µm) swap cell and syringe content One Site Model N K D (µm) Two Site Model N1 K D (µm).9.72 N2 K D (µm) Mills et al. 23
28 µcal/s kcal/mol Peptide P3 P5 P3 P5 Time (min) EpsinR Peptide / Adaptin-Appendage Multiple Binding Sites EpsinR and γ-adaptin Peptide K D (µm) EpsinR γ-adaptin P1-SGDLVDLFDGTS no binding P2-TGGSADLFGGFA 23 P3-SADLFGGFADFG 11 P4-FGGFADFGSAAA > 22 P5-TSGNGDFGDWSA (AHY)TGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGSAAASGS P1 P2 P3 P4 FPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDL(426) P5 Mills et al. 23
29 µcal/s kcal/mol Peptide P3 P5 γsy P3 P5 γsy Time (min) EpsinR Peptide / Adaptin-Appendage Multiple Binding Sites EpsinR and γ-adaptin Peptide K D (µm) EpsinR γ-adaptin P1-SGDLVDLFDGTS no binding P2-TGGSADLFGGFA 23 P3-SADLFGGFADFG 11 P4-FGGFADFGSAAA > 22 P5-TSGNGDFGDWSA 48 γ-synergin PEEDDFQDFQDA 13 Eps15 SFGDGFADFSTL 18 Epsin1 EPDEFSDFDRLR 2 EF-hand NEDDFGDFGDFG 8 291(AHY)TGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGSAAASGS P3 <371 FPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDL(426) P5 Mills et al. 23 <349
30 µcal/s kcal/mol Peptide P3 P5 γsy P3 P5 γsy Time (min) EpsinR Peptide / Adaptin-Appendage Multiple Binding Sites EpsinR and γ-adaptin Peptide K D (µm) EpsinR γ-adaptin P1-SGDLVDLFDGTS no binding P2-TGGSADLFGGFA 23 P3-SADLFGGFADFG 11 P4-FGGFADFGSAAA > 22 P5-TSGNGDFGDWSA 48 γ-synergin PEEDDFQDFQDA 13 Eps15 SFGDGFADFSTL 18 Epsin1 EPDEFSDFDRLR 2 EF-hand NEDDFGDFGDFG 8 EpsinR contains two binding sites for γ-adaptin Identification of consensus motif using peptides Motif is also present in other trafficking proteins
31 Isothermal Calorimetry Titration with EpsinR N3 cons truct N1 N2 K D 1 K D 2 ² H1 ² H2 T² S1 T² S2 N3 + γ-appendage Average N3 D342R + γ-appendage Average N3 D349R + γ-appendage Average N3 D371R + γ-appendage Average N3 + α-appendage Average N3 D342R + α-appendage β-appendage + N { +173 } GST-GGA1 + N K D (µm) H (cal mol -1 ) T S (cal mol -1 ) Exothermic Decrease in Entropy Except in{..} Mills et al. 23
32 Temperature Dependence Synaptotagmin C2A domain and Calcium Time (min) kcal/mol Ca 2+ µcal/s C 25 C Ca2+ / Synaptotagmin C2A 1 C 25 C N K D (µm) H (cal/mol) Two calcium binding sites per C2A domain No robust fit for two site model
33 Temperature Dependence Synaptotagmin C2A domain and Calcium Time (min) kcal/mol Ca 2+ µcal/s C 25 C 37 C Ca2+ / Synaptotagmin C2A 1 C 25 C 37 C N K D 1 (µm) H1 (cal/mol) N2.9 K D 2 (µm) 41 H2 (cal/mol) +377 At higher temperature the reaction is more exothermic At 37 C the two sites can be fitted and resolved
34 Summary Microcalorimetry is a versatile technique to study biological interactions in solution is applicable to ligands such as proteins, peptides, lipids, liposomes, DNA, ions, gives direct access to all thermodynamic parameters from one single experiment allows for the precise determination of stochiometry of binding reactions
Biological Thermodynamics
Biological Thermodynamics Classical thermodynamics is the only physical theory of universal content concerning which I am convinced that, within the framework of applicability of its basic contents, will
More informationPresentation Microcalorimetry for Life Science Research
Presentation Microcalorimetry for Life Science Research MicroCalorimetry The Universal Detector Heat is either generated or absorbed in every chemical process Capable of thermal measurements over a wide
More informationProblem Set 5 Question 1
2.32 Problem Set 5 Question As discussed in class, drug discovery often involves screening large libraries of small molecules to identify those that have favorable interactions with a certain druggable
More informationMicrocalorimetry for the Life Sciences
Microcalorimetry for the Life Sciences Why Microcalorimetry? Microcalorimetry is universal detector Heat is generated or absorbed in every chemical process In-solution No molecular weight limitations Label-free
More information13-3. Synthesis-Secretory pathway: Sort lumenal proteins, Secrete proteins, Sort membrane proteins
13-3. Synthesis-Secretory pathway: Sort lumenal proteins, Secrete proteins, Sort membrane proteins Molecular sorting: specific budding, vesicular transport, fusion 1. Why is this important? A. Form and
More informationProblem solving steps
Problem solving steps Determine the reaction Write the (balanced) equation ΔG K v Write the equilibrium constant v Find the equilibrium constant using v If necessary, solve for components K K = [ p ] ν
More informationIsothermal titration calorimetry (ITC)
Isothermal titration calorimetry (ITC) Peter.gimeson@malvern.com Why microcalorimetry? Label-free Broad dynamic range Information rich Ease-of-use Direct measurement of heat change (ITC) Direct measurement
More informationS2004 Methods for characterization of biomolecular interactions - classical versus modern
S2004 Methods for characterization of biomolecular interactions - classical versus modern Isothermal Titration Calorimetry (ITC) Eva Dubská email: eva.dubska@ceitec.cz Outline Calorimetry - history + a
More informationIsothermal Titration Calorimetry in Drug Discovery. Geoff Holdgate Structure & Biophysics, Discovery Sciences, AstraZeneca October 2017
Isothermal Titration Calorimetry in Drug Discovery Geoff Holdgate Structure & Biophysics, Discovery Sciences, AstraZeneca October 217 Introduction Introduction to ITC Strengths / weaknesses & what is required
More informationCELB40060 Membrane Trafficking in Animal Cells. Prof. Jeremy C. Simpson. Lecture 2 COPII and export from the ER
CELB40060 Membrane Trafficking in Animal Cells Prof. Jeremy C. Simpson Lecture 2 COPII and export from the ER Today s lecture... The COPII coat - localisation and subunits Formation of the COPII coat at
More informationClathrin-mediated endocytosis (CME) is an important vesicle
Vol 448j23 August 2007jdoi:10.1038/nature06031 ANALYSIS Integrating molecular and network biology to decode endocytosis Eva M. Schmid 1 & Harvey T. McMahon 1 The strength of network biology lies in its
More informationschematic diagram; EGF binding, dimerization, phosphorylation, Grb2 binding, etc.
Lecture 1: Noncovalent Biomolecular Interactions Bioengineering and Modeling of biological processes -e.g. tissue engineering, cancer, autoimmune disease Example: RTK signaling, e.g. EGFR Growth responses
More informationLecture 6 - Intracellular compartments and transport I
01.26.11 Lecture 6 - Intracellular compartments and transport I Intracellular transport and compartments 1. Protein sorting: How proteins get to their appropriate destinations within the cell 2. Vesicular
More information!"#$%&'%()*%+*,,%-&,./*%01%02%/*/3452*%3&.26%&4752*,,*1%%
!"#$%&'%()*%+*,,%-&,./*%01%02%/*/3452*%3&.26%&4752*,,*1%% !"#$%&'(")*++*%,*'-&'./%/,*#01#%-2)#3&)/% 4'(")*++*% % %5"0)%-2)#3&) %%% %67'2#72'*%%%%%%%%%%%%%%%%%%%%%%%4'(")0/./% % 8$+&'&,+"/7 % %,$&7&/9)7$*/0/%%%%%%%%%%
More informationSupplementary Figures
1 Supplementary Figures Supplementary Figure 1 Type I FGFR1 inhibitors (a) Chemical structures of a pyrazolylaminopyrimidine inhibitor (henceforth referred to as PAPI; PDB-code of the FGFR1-PAPI complex:
More informationTable 1. Kinetic data obtained from SPR analysis of domain 11 mutants interacting with IGF-II. Kinetic parameters K D 1.
Kinetics and Thermodynamics of the Insulin-like Growth Factor II (IGF-II) Interaction with IGF-II/Mannose 6-phosphate Receptor and the function of CD and AB Loop Solvent-exposed Residues. Research Team:
More informationMicrocalorimetric techniques
Microcalorimetric techniques Isothermal titration calorimetry (ITC) Differential scanning calorimetry (DSC) Filip Šupljika Filip.Supljika@irb.hr Laboratory for the study of interactions of biomacromolecules
More informationAnalysis of Macromolecular Interactions by Isothermal Titration Calorimetry
Analysis of Macromolecular Interactions by Isothermal Titration Calorimetry A primer on the experimental thermodynamic charaterisation of binding of biomolecules Gonzalo Obal Protein Biophysics Unit Structural
More informationSerine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition
Supplementary Information to Serine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition Nadine Czudnochowski 1,2, *, Christian A. Bösken 1, * & Matthias Geyer 1 1 Max-Planck-Institut
More informationProtein Sorting, Intracellular Trafficking, and Vesicular Transport
Protein Sorting, Intracellular Trafficking, and Vesicular Transport Noemi Polgar, Ph.D. Department of Anatomy, Biochemistry and Physiology Email: polgar@hawaii.edu Phone: 692-1422 Outline Part 1- Trafficking
More informationProtein-Ligand Interactions: hydrodynamics and calorimetry
Protein-Ligand Interactions: hydrodynamics and calorimetry Approach Stephen E. Harding Babur Z. Chowdhry OXFORD UNIVERSITY PRESS , New York Oxford University Press, 2001 978-0-19-963746-1 List of protocols
More informationChapter 1. Topic: Overview of basic principles
Chapter 1 Topic: Overview of basic principles Four major themes of biochemistry I. What are living organism made from? II. How do organism acquire and use energy? III. How does an organism maintain its
More informationThe neuron as a secretory cell
The neuron as a secretory cell EXOCYTOSIS ENDOCYTOSIS The secretory pathway. Transport and sorting of proteins in the secretory pathway occur as they pass through the Golgi complex before reaching the
More informationActivation of a receptor. Assembly of the complex
Activation of a receptor ligand inactive, monomeric active, dimeric When activated by growth factor binding, the growth factor receptor tyrosine kinase phosphorylates the neighboring receptor. Assembly
More informationPrinciples of Physical Biochemistry
Principles of Physical Biochemistry Kensal E. van Hold e W. Curtis Johnso n P. Shing Ho Preface x i PART 1 MACROMOLECULAR STRUCTURE AND DYNAMICS 1 1 Biological Macromolecules 2 1.1 General Principles
More informationBE 159: Signal Transduction and Mechanics in Morphogenesis
BE 159: Signal Transduction and Mechanics in Morphogenesis Justin Bois Caltech Winter, 2018 2018 Justin Bois. This work is licensed under a Creative Commons Attribution License CC-BY 4.0. 5 Delta-Notch
More informationSubstrate-dependent switching of the allosteric binding mechanism of a dimeric enzyme
Supplementary Information: Substrate-dependent switching of the allosteric binding mechanism of a dimeric enzyme Lee Freiburger, 1 Teresa Miletti, 1 Siqi Zhu, 1 Oliver Baettig, Albert Berghuis, Karine
More informationEnergetics of chitooligosaccharide binding to pumpkin (Cucurbita maxima) phloem exudate Lectin
Chapter 3 Energetics of chitooligosaccharide binding to pumpkin (Cucurbita maxima) phloem exudate Lectin 50 Chapter 3 Energetics of 51 Summary Binding of chitooligosaccharides [(GlcNAc) 2-6 ] to pumpkin
More informationSupplementary Figure 1. Stability constants of metal monohydroxides. The log K values are summarized according to the atomic number of each element
Supplementary Figure 1. Stability constants of metal monohydroxides. The log K values are summarized according to the atomic number of each element as determined in a previous study 1. The log K value
More informationCalorimetry: differential scanning calorimetry (DSC), isothermal titration calorimetry (ITC)
Calorimetry: differential scanning calorimetry (DSC), isothermal titration calorimetry (ITC) Dr. Yin Li Department of Biophysics, Medical School University of Pecs Thermal Analysis IUPAC definition - a
More informationa) Write the reaction that occurs (pay attention to and label ends correctly) 5 AGCTG CAGCT > 5 AGCTG 3 3 TCGAC 5
Chem 315 Applications Practice Problem Set 1.As you learned in Chem 315, DNA higher order structure formation is a two step process. The first step, nucleation, is entropically the least favorable. The
More informationOther Cells. Hormones. Viruses. Toxins. Cell. Bacteria
Other Cells Hormones Viruses Toxins Cell Bacteria ΔH < 0 reaction is exothermic, tells us nothing about the spontaneity of the reaction Δ H > 0 reaction is endothermic, tells us nothing about the spontaneity
More informationTransport between cytosol and nucleus
of 60 3 Gated trans Lectures 9-15 MBLG 2071 The n GATED TRANSPORT transport between cytoplasm and nucleus (bidirectional) controlled by the nuclear pore complex active transport for macro molecules e.g.
More informationContents. xiii. Preface v
Contents Preface Chapter 1 Biological Macromolecules 1.1 General PrincipIes 1.1.1 Macrornolecules 1.2 1.1.2 Configuration and Conformation Molecular lnteractions in Macromolecular Structures 1.2.1 Weak
More informationI: Life and Energy. Lecture 2: Solutions and chemical potential; Osmotic pressure (B Lentz).
I: Life and Energy Lecture 1: What is life? An attempt at definition. Energy, heat, and work: Temperature and thermal equilibrium. The First Law. Thermodynamic states and state functions. Reversible and
More informationSchedule. Lecture 7: M-M bonds δ-bonds and bonding in metal clusters
Schedule Lecture 7: M-M bonds δ-bonds and bonding in metal clusters Lecture 8: Rates of reaction Ligand-exchange reactions, labile and inert metal ions Lecture 9: Redox reactions Inner and outer-sphere
More informationTypical examination questions (with answer notes)
Chemistry with Medicinal Chemistry (CMC)-3 Biophysical Chemistry Module Biomolecular Interactions (Professor Alan Cooper) Typical examination questions (with answer notes) The following questions are adapted
More informationCholera Toxin Invasion
Protein-carbohydrate interactions: Isothermal Titration Calorimetry Dr Bruce Turnbull School of Chemistry and Astbury Centre for Structural Molecular Biology University of Leeds Cholera Toxin Invasion
More informationFree energy, electrostatics, and the hydrophobic effect
Protein Physics 2016 Lecture 3, January 26 Free energy, electrostatics, and the hydrophobic effect Magnus Andersson magnus.andersson@scilifelab.se Theoretical & Computational Biophysics Recap Protein structure
More informationProtein Structure Determination using NMR Spectroscopy. Cesar Trinidad
Protein Structure Determination using NMR Spectroscopy Cesar Trinidad Introduction Protein NMR Involves the analysis and calculation of data collected from multiple NMR techniques Utilizes Nuclear Magnetic
More informationSupplemental Materials
Supplemental Materials Supp Methods Supp Fig. 1 Sequence conservation and surface accessibility of a-appendages Supp Fig. 2 Details of synaptojanin peptide interactions with the a-appendage Supp Fig. 3
More information17. Biomolecular Interaction
17. Biomolecular Interaction Methods for characterizing biomolecular interactions Sequence-specific DNA binding ligands Molecular mechanisms of drug action and drug resistance In silico compound design
More informationBi 8 Lecture 11. Quantitative aspects of transcription factor binding and gene regulatory circuit design. Ellen Rothenberg 9 February 2016
Bi 8 Lecture 11 Quantitative aspects of transcription factor binding and gene regulatory circuit design Ellen Rothenberg 9 February 2016 Major take-home messages from λ phage system that apply to many
More informationFree Energy. because H is negative doesn't mean that G will be negative and just because S is positive doesn't mean that G will be negative.
Biochemistry 462a Bioenergetics Reading - Lehninger Principles, Chapter 14, pp. 485-512 Practice problems - Chapter 14: 2-8, 10, 12, 13; Physical Chemistry extra problems, free energy problems Free Energy
More informationChemical Physics. Themodynamics Chemical Equilibria Ideal Gas Van der Waals Gas Phase Changes Ising Models Statistical Mechanics etc...
Chemical Physics Themodynamics Chemical Equilibria Ideal Gas Van der Waals Gas Phase Changes Ising Models Statistical Mechanics etc... http://www.nmc.ctc.com/images/project/proj15thumb.jpg http://nuclearweaponarchive.org/usa/tests/ukgrable2.jpg
More informationMicroCal itc 200. System MicroCal Auto-iTC 200. System. GE Healthcare Life Sciences. System design and description. provide:
GE Healthcare Life Sciences Data file 28-97822 AC MicroCal label-free interaction analysis MicroCal itc 2 System MicroCal Auto-iTC 2 System MicroCal itc 2 and MicroCal Auto-iTC 2 isothermal titration calorimetry
More informationCHAPTER 2 THE CHEMICAL BASIS OF LIFE
CHAPTER 2 THE CHEMICAL BASIS OF LIFE CHAPTER OVERVIEW This chapter introduces very basic concepts of chemistry, emphasizing the structure of atoms and how they combine (form bonds). The types of bonds,
More informationThermodynamics & kinetics
Zepelin Hindenburg 1937 Thermodynamics & kinetics H 2 + ½ O 2 H 2 O H = - 241 KJ/mol both spontaneous! R P but rates? R P 2Fe + O 2 + 2H 2 O 2 Fe (OH) 2 H = - 272 KJ/mol Reaction coordinate Thermodynamics
More informationThermodynamics of cationic and anionic surfactant interaction
Thermodynamics of cationic and anionic surfactant interaction Vytautas Petrauskas Department of Biothermodynamics and Drug Design Institute of Biotechnology, Vilnius University October 16, 2014 Vytautas
More informationBiophysics Service at the MPIB Biochemistry Core Facility Stephan Uebel, Biochemistry Core Facility
Biophysics Service at the MPIB Biochemistry Core Facility 30.11.2015 Stephan Uebel, Biochemistry Core Facility uebel@biochem.mpg.de Overview Peptide Chemistry - Peptide synthesis -Amino acid analysis -
More informationZimmerman AP Biology CBHS South Name Chapter 7&8 Guided Reading Assignment 1) What is resolving power and why is it important in biology?
Zimmerman AP Biology CBHS South Name Chapter 7&8 Guided Reading Assignment 1) What is resolving power and why is it important in biology? 2) How does an electron microscope work and what is the difference
More informationCHAPTER THERMODYNAMICS
54 CHAPTER THERMODYNAMICS 1. If ΔH is the change in enthalpy and ΔE the change in internal energy accompanying a gaseous reaction, then ΔHis always greater than ΔE ΔH< ΔE only if the number of moles of
More informationLABORATORY OF ELEMENTARY BIOPHYSICS. Isothermal Titration Calorimetry as a tool for determining thermodynamic parameters of chemical reactions
LABORATORY OF ELEMENTARY BIOPHYSICS Experimental exercises for III year of the First cycle studies Field: Applications of physics in biology and medicine Specialization: Molecular Biophysics Isothermal
More informationAdvanced Fluorescence Microscopy I: Fluorescence (Foster) Resonance Energy Transfer
Advanced Fluorescence Microscopy I: Fluorescence (Foster) Resonance Energy Transfer 3.0 Pax 2.5 2.0 1200 800 400 GFP- Pax GFP-Pax + FATmCherry FAT FAT 1.5 Lifetime (ns) 0 1500 2000 2500 3000 Average lifetime
More informationITC Expert User s Manual
ITC Expert User s Manual 1 Section 1: ITC Expert Background... 3 Minimal Heats and Injections... 3 C Parameter... 3 C Limitations... 4 High C... 4 Low C... 6 Concentrations Ratio... 6 Section 2: ITC Expert
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/3/4/e1600663/dc1 Supplementary Materials for A dynamic hydrophobic core orchestrates allostery in protein kinases Jonggul Kim, Lalima G. Ahuja, Fa-An Chao, Youlin
More informationIsothermal titration calorimetry to determine association constants for high-affinity ligands
Isothermal titration calorimetry to determine association constants for high-affinity ligands Adrian Velazquez-Campoy 1 & Ernesto Freire 2 1 Institute of Biocomputation and Complex Systems Physics, Corona
More informationMBLG lecture 5. The EGG! Visualising Molecules. Dr. Dale Hancock Lab 715
MBLG lecture 5 Dr. Dale Hancock D.Hancock@mmb.usyd.edu.au Lab 715 The EGG! Visualising Molecules In molecular biology and biochemistry it is better to view molecules as killer pythons rather than smarties.
More informationBiophysical characterization of SMALPs and nanodiscs
Biophysical characterization of SMALPs and nanodiscs Verna Frasca, Ph.D. Malvern Panalytical Verna.Frasca@Malvern.com Malvern Panalytical 2 SMALP April 11 2018 Malvern Panalytical Biosciences Group Solutions
More informationPhET Interactive Chemistry Simulations Aligned to an Example General Chemistry Curriculum
PhET Interactive Chemistry Simulations Aligned to an Example General Chemistry Curriculum Alignment is based on the topics and subtopics addressed by each sim. Sims that directly address the topic area
More informationBiology Chemistry & Physics of Biomolecules. Examination #1. Proteins Module. September 29, Answer Key
Biology 5357 Chemistry & Physics of Biomolecules Examination #1 Proteins Module September 29, 2017 Answer Key Question 1 (A) (5 points) Structure (b) is more common, as it contains the shorter connection
More information122-Biology Guide-5thPass 12/06/14. Topic 1 An overview of the topic
Topic 1 http://bioichiban.blogspot.com Cellular Functions 1.1 The eukaryotic cell* An overview of the topic Key idea 1: Cell Organelles Key idea 2: Plasma Membrane Key idea 3: Transport Across Membrane
More informationCHAPTER 3. Cell Structure and Genetic Control. Chapter 3 Outline
CHAPTER 3 Cell Structure and Genetic Control Chapter 3 Outline Plasma Membrane Cytoplasm and Its Organelles Cell Nucleus and Gene Expression Protein Synthesis and Secretion DNA Synthesis and Cell Division
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1. Different crystal forms obtained for Sky
Supplementary Figure 1 Different crystal forms obtained for Sky 1 353. (a) Crystal form 1 obtained in the presence of 20% PEG 3350 and 0.2 M ammonium citrate tribasic ph 7.0. (b) Crystal form 1 of the
More informationMOLECULAR MECHANISMS CONTROLLING DYNAMIN RECRUITMENT TO SITES OF ENDOCYTOSIS BY SH3-DOMAIN CONTAINING PROTEINS
DEPARTMENT OF NEUROSCIENCE Karolinska Institutet, Stockholm, Sweden MOLECULAR MECHANISMS CONTROLLING DYNAMIN RECRUITMENT TO SITES OF ENDOCYTOSIS BY SH3-DOMAIN CONTAINING PROTEINS Anna Sundborger Stockholm
More informationTransient kinetic methods. Biophysics seminars Kinga Futó
Transient kinetic methods Biophysics seminars Kinga Futó Fast kinetics Reaction kinetics: temporal description of reactions reactionmechanisms reaction dynamics (processes on molecular level) rate of reaction
More informationMOLECULAR DRUG TARGETS
MOLECULAR DRUG TARGETS LEARNING OUTCOMES At the end of this session student shall be able to: List different types of druggable targets Describe forces involved in drug-receptor interactions Describe theories
More informationBIOCHEMISTRY. František Vácha. JKU, Linz.
BIOCHEMISTRY František Vácha http://www.prf.jcu.cz/~vacha/ JKU, Linz Recommended reading: D.L. Nelson, M.M. Cox Lehninger Principles of Biochemistry D.J. Voet, J.G. Voet, C.W. Pratt Principles of Biochemistry
More informationChemistry 425 September 29, 2010 Exam 1 Solutions
Chemistry 425 September 29, 2010 Exam 1 Solutions Name: Instructions: Please do not start working on the exam until you are told to begin. Check the exam to make sure that it contains exactly 6 different
More informationLecture 2: Receptor-ligand binding and cooperativity
Lecture 2: Receptor-ligand binding and cooperativity Paul C Bressloff (Spring 209) A biochemical receptor is a protein molecule that receives a chemical signal in the form of ligand molecules. The ligands
More informationStructural basis of PROTAC cooperative recognition for selective protein degradation
SUPPLEMENTARY INFORMATION Structural basis of PROTAC cooperative recognition for selective protein degradation Morgan S. Gadd 1, Andrea Testa 1, Xavier Lucas 1, Kwok-Ho Chan, Wenzhang Chen, Douglas J.
More information2. The study of is the study of behavior (capture, storage, usage) of energy in living systems.
Cell Metabolism 1. Each of the significant properties of a cell, its growth, reproduction, and responsiveness to its environment requires. 2. The study of is the study of behavior (capture, storage, usage)
More informationBiological Process Term Enrichment
Biological Process Term Enrichment cellular protein localization cellular macromolecule localization intracellular protein transport intracellular transport generation of precursor metabolites and energy
More informationExothermic vs endothermic
Exothermic vs endothermic Problem: Calorimetric data on binding of several anti-hiv drugs to their common target, HIV protease, at T=300K is presented in the table. For how many drugs in the list, the
More informationCHAPTER 5. EQUILIBRIUM AND THERMODYNAMIC INVESTIGATION OF As(III) AND As(V) REMOVAL BY MAGNETITE NANOPARTICLES COATED SAND
CHAPTER 5 EQUILIBRIUM AND THERMODYNAMIC INVESTIGATION OF As(III) AND As(V) REMOVAL BY MAGNETITE NANOPARTICLES COATED SAND 85 86 5.1. INTRODUCTION Since temperature plays an important role in the adsorption
More information2015 AP Biology Unit 2 Quiz 1- Introduction to the Cell and Biochemistry Week of 28Sept- 08Oct
Name: Class: _ Date: _ 2015 AP Biology Unit 2 Quiz 1- Introduction to the Cell and Biochemistry Week of 28Sept- 08Oct Multiple Choice Identify the choice that best completes the statement or answers the
More informationDISCOVERIES OF MACHINERY REGULATING VESICLE TRAFFIC, A MAJOR TRANSPORT SYSTEM IN OUR CELLS. Scientific Background on the Nobel Prize in Medicine 2013
DISCOVERIES OF MACHINERY REGULATING VESICLE TRAFFIC, A MAJOR TRANSPORT SYSTEM IN OUR CELLS Scientific Background on the Nobel Prize in Medicine 2013 Daniela Scalet 6/12/2013 The Nobel Prize in Medicine
More informationOverview of Cells. Prokaryotes vs Eukaryotes The Cell Organelles The Endosymbiotic Theory
Overview of Cells Prokaryotes vs Eukaryotes The Cell Organelles The Endosymbiotic Theory Prokaryotic Cells Archaea Bacteria Come in many different shapes and sizes.5 µm 2 µm, up to 60 µm long Have large
More informationTopic 4: Equilibrium binding and chemical kinetics
Topic 4: Equilibrium binding and chemical kinetics Outline: Applications, applications, applications use Boltzmann to look at receptor-ligand binding use Boltzmann to look at PolII-DNA binding and gene
More informationCEE 370 Environmental Engineering Principles. Equilibrium Chemistry
Updated: 9 September 015 Print version CEE 370 Environmental Engineering Principles Lecture #6 Environmental Chemistry IV: Thermodynamics, Equilibria, Acids-bases I Reading: Mihelcic & Zimmerman, Chapter
More informationAS Biology Summer Work 2015
AS Biology Summer Work 2015 You will be following the OCR Biology A course and in preparation for this you are required to do the following for September 2015: Activity to complete Date done Purchased
More informationConcept review: Binding equilibria
Concept review: Binding equilibria 1 Binding equilibria and association/dissociation constants 2 The binding of a protein to a ligand at equilibrium can be written as: P + L PL And so the equilibrium constant
More informationREVIEW 2: CELLS & CELL COMMUNICATION. A. Top 10 If you learned anything from this unit, you should have learned:
Name AP Biology REVIEW 2: CELLS & CELL COMMUNICATION A. Top 10 If you learned anything from this unit, you should have learned: 1. Prokaryotes vs. eukaryotes No internal membranes vs. membrane-bound organelles
More informationSubject Overview Curriculum pathway
Subject Overview Curriculum pathway Course Summary Course: A Level Chemistry Overall Summary Unit / Module Exam / Controlled % of course UMS allocation Marks available UMS / RAW mark grade boundaries from
More informationCh 7: Cell Structure and Functions. AP Biology
Ch 7: Cell Structure and Functions AP Biology The Cell Theory 1. All living things are made of cells. 2. New cells come from existing cells. 3. Cells are the basic units of structure and function of living
More informationThermodynamic measurements
Thermoynamic measurements When stuying protein structure an function, it is essential to measure various physical quantities, incluing: thermal an chemical stability bining affinity to a ligan solubility
More informationChemical Equilibrium Review? Chemical Equilibrium
Chemical Equilibrium Review? Most chemical systems are governed by equilibria such that if: aa + bb cc + dd, then c ac ad a a a A b B K where K is the equilibrium constant, and a X is the activity of X
More informationHomework - I. Hand draw the structure of an eukaryotic cell with all organelles clearly drawn and describe the function of each organelle.
Homework - I Hand draw the structure of an eukaryotic cell with all organelles clearly drawn and describe the function of each organelle. Please get a book and read the chapter related to cell structure!!!
More informationSupplementary Materials: Probing the Ion Binding Site in a DNA Holliday Junction Using Förster Resonance Energy Transfer (FRET)
S1 of S5 Supplementary Materials: Probing the Ion Binding Site in a DNA Holliday Junction Using Förster Resonance Energy Transfer (FRET) Jacob L. Litke, Yan Li, Laura M. Nocka and Ishita Mukerji (a) (b)
More informationFrom Fragments to Actin: The Bistramide A Story. March 12 th, 2010
From Fragments to Actin: The Bistramide A Story March 12 th, 2010 Act I: The Protagonist Synthesis of Bistramide A Gillis, Wang, Davis, Fujii, Bromann Bistramide A Biological Activity Cell Cycle Regulation
More information5th CCPN Matt Crump. Thermodynamic quantities derived from protein dynamics
5th CCPN 2005 -Matt Crump Thermodynamic quantities derived from protein dynamics Relaxation in Liquids (briefly!) The fluctuations of each bond vector can be described in terms of an angular correlation
More informationProton Acidity. (b) For the following reaction, draw the arrowhead properly to indicate the position of the equilibrium: HA + K + B -
Proton Acidity A01 Given that acid A has a pk a of 15 and acid B has a pk a of 10, then: (a) Which of the two acids is stronger? (b) For the following reaction, draw the arrowhead properly to indicate
More informationDSC Characterization of the Structure/Function Relationship for Proteins
DSC Characterization of the Structure/Function Relationship for Proteins Differential Scanning Calorimetry (DSC) DSC is recognized as Gold Std technique for measuring molecular thermal stability and structure
More informationCHEM6416 Theory of Molecular Spectroscopy 2013Jan Spectroscopy frequency dependence of the interaction of light with matter
CHEM6416 Theory of Molecular Spectroscopy 2013Jan22 1 1. Spectroscopy frequency dependence of the interaction of light with matter 1.1. Absorption (excitation), emission, diffraction, scattering, refraction
More informationSUPPLEMENTARY INFORMATION
Figure S1. Secondary structure of CAP (in the camp 2 -bound state) 10. α-helices are shown as cylinders and β- strands as arrows. Labeling of secondary structure is indicated. CDB, DBD and the hinge are
More informationNMR Spectroscopy. Guangjin Hou
NMR Spectroscopy Guangjin Hou 22-04-2009 NMR History 1 H NMR spectra of water H NMR spectra of water (First NMR Spectra on Water, 1946) 1 H NMR spectra ethanol (First bservation of the Chemical Shift,
More informationSupplementary Information. Overlap between folding and functional energy landscapes for. adenylate kinase conformational change
Supplementary Information Overlap between folding and functional energy landscapes for adenylate kinase conformational change by Ulrika Olsson & Magnus Wolf-Watz Contents: 1. Supplementary Note 2. Supplementary
More informationWarm-Up Pairs Discuss the diagram What Where Which Why
Warm-Up In Pairs Discuss the diagram What is it? Where does it come from? Which parts can you label? (in pencil) Why do you think you will learn about it? 5 m Eukaryote: Organelles, Structure and Function
More informationspecified quantity of a solvent at a given temperature. To deconvolute the value from the
S.1 Calculations of Dilution Enthalpy and Enthalpic Interaction Coefficients. When a solute is dissolved in a solvent a solution is formed. During dissolution of a solute in any solvent, heat is either
More informationHigh Specificity and Reversibility
Lecture #8 The Cell as a Machine High Specificity and Reversibility In considering the problem of transcription factor binding in the nucleus and the great specificity that is called for to transcribe
More information