Overview of Research at Bioinformatics Lab
|
|
- Gerald Sullivan
- 6 years ago
- Views:
Transcription
1 Overview of Research at Bioinformatics Lab Li Liao Develop new algorithms and (statistical) learning methods that help solve biological problems > Capable of incorporating domain knowledge > Effective, Expressive, Interpretable 1
2 Motivations Understanding correlations between genotype and phenotype Predicting genotype <=> phenotype Some Phenotype examples: Protein function Drug/therapy response Drug-drug interactions for expression Drug mechanism Interacting pathways of metabolism 2
3 Bioinformatics in a cell 3
4 Credit:Kellis & Indyk 4
5 Projects Genome sequencing and assembly (funded by NSF) Homology detection, protein family classification (funded by a DuPont S&E award) Support Vector Machines Hidden Markov models Graph theoretic methods Probabilistic modeling for BioSequence (funded by NIH) HMMs, and beyond Motifs finding Secondary structure Systems Bioinformatics Prediction of Protein-Protein Interactions Inference of Gene Regulatory Networks Prediction of other regulatory elements Pattern analysis for RNAi (funded by UDRF) Comparative Genomics Identify genome features for diagnostic and therapeutic purposes (funded by an Army grant) 5
6 People Current members: - Roger Craig (PhD student) - Alvaro Gonzalez (PhD student) - Kevin McCormick (PhD student) - Colin Kern (PhD student) Past members: - Dr. Wen-Zhong Wang (Postdoc Fellow) - Robel Kahsay (Ph.D. currently at DuPont Central Research & Development) - Kishore Narra (M.S. currently at VistaPrint, Inc.) - Arpita Gandhi (M.S. currently at Colgate-Palmolive Company) - Gaurav Jain (M.S. currently at Institute of Genomics, Univ. of Maryland) - Shivakundan Singh Tej (M.S.) - Tapan Patel (B.S. currently in MD/PhD program at U Penn) - Laura Shankman (B.S., currently in PhD program at U Virginia) 6
7 7
8 8
9 Hybrid Hierarchical Assembly Three types of reads: Sanger (~1000bp), 454 (~100bp), and SBS (~30bp). Assembly of individual types using the best suited assemblers. Phrap, TIGR, etc. for Sanger reads Euler assembler and Newbler for 454 reads Euler short, Shorty for SBS reads Hybrid and hierarchical Use longer reads as scaffolding to resolve repeat regions that are difficult for shorter reads Use contigs from shorter reads (pyrosequencing) as pseudoreads to bridge gaps (nonclonable and hard stops) with Sanger reads. 9
10 Major Findings Hybrid hierarchical assembly is proved to be an effective way for assembling short reads Incremental approach to selecting ABI reads is more effective than random approach in generating high coverage contigs Staged assembly using Phrap is an effective alternative to the proprietary Newbler assembler. Publications: Gonzalez & Liao, BMC Bioinformatics 2008, 9:
11 Blue lines are contigs generated from hybrid assembly 11
12 Detect remote homologues Attributes: - Sequence similarity, Aggregate statistics (e.g., protein families), Pattern/motif, and more attributes (presence at phylogenetic tree). How to incorporate domain specific knowledge into the model so a classifier can be more accurate? Results: - Quasi-consensus based comparison of profile HMM for protein sequences (Kahsay et al, Bioinformatics 2005) - Using extended phylogenetic profiles and support vector machines for protein family classification (Narra & Liao, SNPD04, Craig & Liao, ICMLA 05, Craig & Liao SAC 06, Craig & Liao, Int l J. Bioinfo & DM 2007) - Combining Pairwise Sequence Similarity and Support Vector Machines for Detecting Remote Protein Evolutionary and Structural Relationships (JCB 2003) 12
13 Non-linear mapping to a feature space Φ( ) x j x i Φ(x i ) Φ(x j ) L( ) = i ½ i j y i y j Φ (x i ) Φ (x j ) 13
14 Hamming distance Tree-based distance Data: phylogenetic profiles - How to account for correlations among profile components? profile extension (Narra & Liao, SNPD 04) Transductive learning (Craig & Liao, ICMLA 05, SAC 06, IJBDM, 2007) x = y = z = = =
15 Post-order traversal
16 16
17 Sequence Models (HMMs and beyond) Motivations: What is responsible for the function? Patterns/motifs Secondary structure To capture long range correlations of bio sequences Transporter proteins RNA secondary structure Methods: generative versus discriminative Linear dependent processes Stochastic grammars Model equivalence 17
18 TMMOD: An improved hidden Markov model for predicting transmembrane topology (Kahsay, Gao & Liao. Bioinformatics 2005) 18
19 Mod. Reg. Data set Correct topology Correct location Sensitivity Specificity TMMOD 1 (a) (b) (c) S (78.3%) 51 (61.4%) 64 (77.1%) 67 (80.7%) 52 (62.7%) 65 (78.3%) 97.4% 71.3% 97.1% 97.4% 71.3% 97.1% TMMOD 2 (a) (b) (c) S (73.5%) 54 (65.1%) 54 (65.1%) 65 (78.3%) 61 (73.5%) 66 (79.5%) 99.4% 93.8% 99.7% 97.4% 71.3% 97.1% TMMOD 3 (a) (b) (c) S (84.3%) 64 (77.1%) 74 (89.2%) 71 (85.5%) 65 (78.3%) 74 (89.2%) 98.2% 95.3% 99.1% 97.4% 71.3% 97.1% TMHMM S (77.1%) 69 (83.1%) 96.2% 96.2% PHDtm S-83 (85.5%) (88.0%) 98.8% 95.2% TMMOD 1 (a) (b) (c) S (73.1%) 92 (57.5%) 117 (73.1%) 128 (80.0%) 103 (64.4%) 126 (78.8%) 97.4% 77.4% 96.1% 97.0% 80.8% 96.7% TMMOD 2 (a) (b) (c) S (75.0%) 97 (60.6%) 118 (73.8%) 132 (82.5%) 121 (75.6%) 135 (84.4%) 98.4% 97.7% 98.4% 97.2% 95.6% 97.2% TMMOD 3 (a) (b) (c) S (75.0%) 110 (68.8%) 135 (84.4%) 133 (83.1%) 124 (77.5%) 143 (89.4%) 97.8% 94.5% 98.3% 97.6% 98.1% 98.1% TMHMM S (76.9%) 134 (83.8%) 97.1% 97.7% 19
20 20
21 21
22 Inferring Regulatory Networks from Time Course Expression Data (Gandhi, Cogburn & Liao, 2008) Expression Profile Clustering K-mean Binary heat map Boolean network algorithm 22
23 GENOMIC COMPARISON OF BACTERIAL SPECIES BASED ON METABOLIC CHARACTERISTICS (Jain, Wang, Boyd, Liao, ISIBM 2009) 23
24 24
Introduction to Bioinformatics
CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein
More informationGraph Alignment and Biological Networks
Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale
More informationComputational Systems Biology
Computational Systems Biology Vasant Honavar Artificial Intelligence Research Laboratory Bioinformatics and Computational Biology Graduate Program Center for Computational Intelligence, Learning, & Discovery
More informationHidden Markov Models (I)
GLOBEX Bioinformatics (Summer 2015) Hidden Markov Models (I) a. The model b. The decoding: Viterbi algorithm Hidden Markov models A Markov chain of states At each state, there are a set of possible observables
More informationHMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM
I529: Machine Learning in Bioinformatics (Spring 2017) HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University, Bloomington
More information3/1/17. Content. TWINSCAN model. Example. TWINSCAN algorithm. HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM
I529: Machine Learning in Bioinformatics (Spring 2017) Content HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University,
More information#33 - Genomics 11/09/07
BCB 444/544 Required Reading (before lecture) Lecture 33 Mon Nov 5 - Lecture 31 Phylogenetics Parsimony and ML Chp 11 - pp 142 169 Genomics Wed Nov 7 - Lecture 32 Machine Learning Fri Nov 9 - Lecture 33
More informationComparative genomics: Overview & Tools + MUMmer algorithm
Comparative genomics: Overview & Tools + MUMmer algorithm Urmila Kulkarni-Kale Bioinformatics Centre University of Pune, Pune 411 007. urmila@bioinfo.ernet.in Genome sequence: Fact file 1995: The first
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationPrediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines
Article Prediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines Yun-Fei Wang, Huan Chen, and Yan-Hong Zhou* Hubei Bioinformatics and Molecular Imaging Key Laboratory,
More informationMining and classification of repeat protein structures
Mining and classification of repeat protein structures Ian Walsh Ph.D. BioComputing UP, Department of Biology, University of Padova, Italy URL: http://protein.bio.unipd.it/ Repeat proteins Why are they
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationUnderstanding Science Through the Lens of Computation. Richard M. Karp Nov. 3, 2007
Understanding Science Through the Lens of Computation Richard M. Karp Nov. 3, 2007 The Computational Lens Exposes the computational nature of natural processes and provides a language for their description.
More informationComputational Genomics. Systems biology. Putting it together: Data integration using graphical models
02-710 Computational Genomics Systems biology Putting it together: Data integration using graphical models High throughput data So far in this class we discussed several different types of high throughput
More informationUsing Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics
Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign http://tandy.cs.illinois.edu
More informationTaxonomy. Content. How to determine & classify a species. Phylogeny and evolution
Taxonomy Content Why Taxonomy? How to determine & classify a species Domains versus Kingdoms Phylogeny and evolution Why Taxonomy? Classification Arrangement in groups or taxa (taxon = group) Nomenclature
More informationGenomics and bioinformatics summary. Finding genes -- computer searches
Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Sequence Assembly
CMPS 6630: Introduction to Computational Biology and Bioinformatics Sequence Assembly Why Genome Sequencing? Sanger (1982) introduced chaintermination sequencing. Main idea: Obtain fragments of all possible
More informationStatistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department
More informationPredicting Protein Functions and Domain Interactions from Protein Interactions
Predicting Protein Functions and Domain Interactions from Protein Interactions Fengzhu Sun, PhD Center for Computational and Experimental Genomics University of Southern California Outline High-throughput
More informationBiological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor
Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms
More informationSTRUCTURAL BIOINFORMATICS I. Fall 2015
STRUCTURAL BIOINFORMATICS I Fall 2015 Info Course Number - Classification: Biology 5411 Class Schedule: Monday 5:30-7:50 PM, SERC Room 456 (4 th floor) Instructors: Vincenzo Carnevale - SERC, Room 704C;
More informationWeek 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
More informationBioinformatics. Dept. of Computational Biology & Bioinformatics
Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS
More informationHidden Markov Models
Hidden Markov Models A selection of slides taken from the following: Chris Bystroff Protein Folding Initiation Site Motifs Iosif Vaisman Bioinformatics and Gene Discovery Colin Cherry Hidden Markov Models
More informationJessica Wehner. Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008
Journal Club Jessica Wehner Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008 Comparison of Probabilistic Combination Methods for Protein Secondary Structure
More informationStatistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic
More informationComparative Network Analysis
Comparative Network Analysis BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2016 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by
More informationLearning in Bayesian Networks
Learning in Bayesian Networks Florian Markowetz Max-Planck-Institute for Molecular Genetics Computational Molecular Biology Berlin Berlin: 20.06.2002 1 Overview 1. Bayesian Networks Stochastic Networks
More informationSome Problems from Enzyme Families
Some Problems from Enzyme Families Greg Butler Department of Computer Science Concordia University, Montreal www.cs.concordia.ca/~faculty/gregb gregb@cs.concordia.ca Abstract I will discuss some problems
More informationComputational Biology: Basics & Interesting Problems
Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information
More informationComputational methods for predicting protein-protein interactions
Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational
More informationSequence Alignment Techniques and Their Uses
Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this
More informationAN AXIOMATIC DESIGN FOR MODELING BIOLOGICAL SYSTEMS
AN AXIOMATIC DESIGN FOR MODELING BIOLOGICAL SYSTEMS Harun Pirim and Burak Eksioglu Department of Industrial and Systems Engineering Mississippi State University PO Box 9542 Mississippi State, MS 39762,
More informationComputational Molecular Biology (
Computational Molecular Biology (http://cmgm cmgm.stanford.edu/biochem218/) Biochemistry 218/Medical Information Sciences 231 Douglas L. Brutlag, Lee Kozar Jimmy Huang, Josh Silverman Lecture Syllabus
More informationGenome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting.
Genome Annotation Bioinformatics and Computational Biology Genome Annotation Frank Oliver Glöckner 1 Genome Analysis Roadmap Genome sequencing Assembly Gene prediction Protein targeting trna prediction
More informationProtein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.
Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein
More informationCellular Systems Biology or Biological Network Analysis
Cellular Systems Biology or Biological Network Analysis Joel S. Bader Department of Biomedical Engineering Johns Hopkins University (c) 2012 December 4, 2012 1 Preface Cells are systems. Standard engineering
More informationINTERACTIVE CLUSTERING FOR EXPLORATION OF GENOMIC DATA
INTERACTIVE CLUSTERING FOR EXPLORATION OF GENOMIC DATA XIUFENG WAN xw6@cs.msstate.edu Department of Computer Science Box 9637 JOHN A. BOYLE jab@ra.msstate.edu Department of Biochemistry and Molecular Biology
More informationGrundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson
Grundlagen der Bioinformatik, SS 10, D. Huson, April 12, 2010 1 1 Introduction Grundlagen der Bioinformatik Summer semester 2010 Lecturer: Prof. Daniel Huson Office hours: Thursdays 17-18h (Sand 14, C310a)
More informationHYPERGRAPH BASED SEMI-SUPERVISED LEARNING ALGORITHMS APPLIED TO SPEECH RECOGNITION PROBLEM: A NOVEL APPROACH
HYPERGRAPH BASED SEMI-SUPERVISED LEARNING ALGORITHMS APPLIED TO SPEECH RECOGNITION PROBLEM: A NOVEL APPROACH Hoang Trang 1, Tran Hoang Loc 1 1 Ho Chi Minh City University of Technology-VNU HCM, Ho Chi
More informationAssembly improvement: based on Ragout approach. student: Anna Lioznova scientific advisor: Son Pham
Assembly improvement: based on Ragout approach student: Anna Lioznova scientific advisor: Son Pham Plan Ragout overview Datasets Assembly improvements Quality overlap graph paired-end reads Coverage Plan
More informationCharalampos (Babis) E. Tsourakakis WABI 2013, France WABI '13 1
Charalampos (Babis) E. Tsourakakis charalampos.tsourakakis@aalto.fi WBI 2013, France WBI '13 1 WBI '13 2 B B B C B B B B B B B B B B B D D D E E E E E E E Copy numbers for a single gene B C D E (2) (3)
More information86 Part 4 SUMMARY INTRODUCTION
86 Part 4 Chapter # AN INTEGRATION OF THE DESCRIPTIONS OF GENE NETWORKS AND THEIR MODELS PRESENTED IN SIGMOID (CELLERATOR) AND GENENET Podkolodny N.L. *1, 2, Podkolodnaya N.N. 1, Miginsky D.S. 1, Poplavsky
More informationGLOBEX Bioinformatics (Summer 2015) Genetic networks and gene expression data
GLOBEX Bioinformatics (Summer 2015) Genetic networks and gene expression data 1 Gene Networks Definition: A gene network is a set of molecular components, such as genes and proteins, and interactions between
More informationLecture 3: A basic statistical concept
Lecture 3: A basic statistical concept P value In statistical hypothesis testing, the p value is the probability of obtaining a result at least as extreme as the one that was actually observed, assuming
More informationMarkov Models & DNA Sequence Evolution
7.91 / 7.36 / BE.490 Lecture #5 Mar. 9, 2004 Markov Models & DNA Sequence Evolution Chris Burge Review of Markov & HMM Models for DNA Markov Models for splice sites Hidden Markov Models - looking under
More informationEBI web resources II: Ensembl and InterPro. Yanbin Yin Spring 2013
EBI web resources II: Ensembl and InterPro Yanbin Yin Spring 2013 1 Outline Intro to genome annotation Protein family/domain databases InterPro, Pfam, Superfamily etc. Genome browser Ensembl Hands on Practice
More informationBioinformatics Chapter 1. Introduction
Bioinformatics Chapter 1. Introduction Outline! Biological Data in Digital Symbol Sequences! Genomes Diversity, Size, and Structure! Proteins and Proteomes! On the Information Content of Biological Sequences!
More informationThe minimal prokaryotic genome. The minimal prokaryotic genome. The minimal prokaryotic genome. The minimal prokaryotic genome
Dr. Dirk Gevers 1,2 1 Laboratorium voor Microbiologie 2 Bioinformatics & Evolutionary Genomics The bacterial species in the genomic era CTACCATGAAAGACTTGTGAATCCAGGAAGAGAGACTGACTGGGCAACATGTTATTCAG GTACAAAAAGATTTGGACTGTAACTTAAAAATGATCAAATTATGTTTCCCATGCATCAGG
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationMap of AP-Aligned Bio-Rad Kits with Learning Objectives
Map of AP-Aligned Bio-Rad Kits with Learning Objectives Cover more than one AP Biology Big Idea with these AP-aligned Bio-Rad kits. Big Idea 1 Big Idea 2 Big Idea 3 Big Idea 4 ThINQ! pglo Transformation
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationComputational Genomics
Computational Genomics http://www.cs.cmu.edu/~02710 Introduction to probability, statistics and algorithms (brief) intro to probability Basic notations Random variable - referring to an element / event
More informationCSCE555 Bioinformatics. Protein Function Annotation
CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The
More informationA A A A B B1
LEARNING OBJECTIVES FOR EACH BIG IDEA WITH ASSOCIATED SCIENCE PRACTICES AND ESSENTIAL KNOWLEDGE Learning Objectives will be the target for AP Biology exam questions Learning Objectives Sci Prac Es Knowl
More informationEarly History up to Schedule. Proteins DNA & RNA Schwann and Schleiden Cell Theory Charles Darwin publishes Origin of Species
Schedule Bioinformatics and Computational Biology: History and Biological Background (JH) 0.0 he Parsimony criterion GKN.0 Stochastic Models of Sequence Evolution GKN 7.0 he Likelihood criterion GKN 0.0
More informationContent Descriptions Based on the Georgia Performance Standards. Biology
Content Descriptions Based on the Georgia Performance Standards Biology Introduction The State Board of Education is required by Georgia law (A+ Educational Reform Act of 2000, O.C.G.A. 20-2-281) to adopt
More informationBasic modeling approaches for biological systems. Mahesh Bule
Basic modeling approaches for biological systems Mahesh Bule The hierarchy of life from atoms to living organisms Modeling biological processes often requires accounting for action and feedback involving
More informationMultiple Sequence Alignment: HMMs and Other Approaches
Multiple Sequence Alignment: HMMs and Other Approaches Background Readings: Durbin et. al. Section 3.1, Ewens and Grant, Ch4. Wing-Kin Sung, Ch 6 Beerenwinkel N, Siebourg J. Statistics, probability, and
More informationPhylogenetic Analysis of Molecular Interaction Networks 1
Phylogenetic Analysis of Molecular Interaction Networks 1 Mehmet Koyutürk Case Western Reserve University Electrical Engineering & Computer Science 1 Joint work with Sinan Erten, Xin Li, Gurkan Bebek,
More informationBSc MATHEMATICAL SCIENCE
Overview College of Science Modules Electives May 2018 (2) BSc MATHEMATICAL SCIENCE BSc Mathematical Science Degree 2018 1 College of Science, NUI Galway Fullscreen Next page Overview [60 Credits] [60
More informationPreface. Contributors
CONTENTS Foreword Preface Contributors PART I INTRODUCTION 1 1 Networks in Biology 3 Björn H. Junker 1.1 Introduction 3 1.2 Biology 101 4 1.2.1 Biochemistry and Molecular Biology 4 1.2.2 Cell Biology 6
More informationTransductive learning with EM algorithm to classify proteins based on phylogenetic profiles
Int. J. Data Mining and Bioinformatics, Vol. 1, No. 4, 2007 337 Transductive learning with EM algorithm to classify proteins based on phylogenetic profiles Roger A. Craig and Li Liao* Department of Computer
More informationHomology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
More informationAP Curriculum Framework with Learning Objectives
Big Ideas Big Idea 1: The process of evolution drives the diversity and unity of life. AP Curriculum Framework with Learning Objectives Understanding 1.A: Change in the genetic makeup of a population over
More informationCISC 889 Bioinformatics (Spring 2004) Lecture 1
CISC 889 Bioinformatics (Spring 2004) Lecture 1 Course Overview Li Liao Computer and Information Sciences University of Delaware Administrative stuff Syllabus and tentative schedule (check frequently for
More informationComparative Bioinformatics Midterm II Fall 2004
Comparative Bioinformatics Midterm II Fall 2004 Objective Answer, part I: For each of the following, select the single best answer or completion of the phrase. (3 points each) 1. Deinococcus radiodurans
More informationBioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing
Bioinformatics Proteins II. - Pattern, Profile, & Structure Database Searching Robert Latek, Ph.D. Bioinformatics, Biocomputing WIBR Bioinformatics Course, Whitehead Institute, 2002 1 Proteins I.-III.
More informationCOMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University
COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018
More informationComputational Biology From The Perspective Of A Physical Scientist
Computational Biology From The Perspective Of A Physical Scientist Dr. Arthur Dong PP1@TUM 26 November 2013 Bioinformatics Education Curriculum Math, Physics, Computer Science (Statistics and Programming)
More informationInferring Causal Phenotype Networks from Segregating Populat
Inferring Causal Phenotype Networks from Segregating Populations Elias Chaibub Neto chaibub@stat.wisc.edu Statistics Department, University of Wisconsin - Madison July 15, 2008 Overview Introduction Description
More informationCS612 - Algorithms in Bioinformatics
Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available
More informationVisualize Biological Database for Protein in Homosapiens Using Classification Searching Models
International Journal of Computational Intelligence Research ISSN 0973-1873 Volume 13, Number 2 (2017), pp. 213-224 Research India Publications http://www.ripublication.com Visualize Biological Database
More informationProtein Complex Identification by Supervised Graph Clustering
Protein Complex Identification by Supervised Graph Clustering Yanjun Qi 1, Fernanda Balem 2, Christos Faloutsos 1, Judith Klein- Seetharaman 1,2, Ziv Bar-Joseph 1 1 School of Computer Science, Carnegie
More informationMutual Information & Genotype-Phenotype Association. Norman MacDonald January 31, 2011 CSCI 4181/6802
Mutual Information & Genotype-Phenotype Association Norman MacDonald January 31, 2011 CSCI 4181/6802 2 Overview What is information (specifically Shannon Information)? What are information entropy and
More informationIntroduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple
More informationStructure to Function. Molecular Bioinformatics, X3, 2006
Structure to Function Molecular Bioinformatics, X3, 2006 Structural GeNOMICS Structural Genomics project aims at determination of 3D structures of all proteins: - organize known proteins into families
More informationMicrobial Taxonomy. Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible.
Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional
More information6.047 / Computational Biology: Genomes, Networks, Evolution Fall 2008
MIT OpenCourseWare http://ocw.mit.edu 6.047 / 6.878 Computational Biology: Genomes, Networks, Evolution Fall 2008 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms.
More informationBig Idea 3: Living systems store, retrieve, transmit, and respond to information essential to life processes.
Big Idea 3: Living systems store, retrieve, transmit, and respond to information essential to life processes. Enduring understanding 3.A: Heritable information provides for continuity of life. Essential
More informationMiGA: The Microbial Genome Atlas
December 12 th 2017 MiGA: The Microbial Genome Atlas Jim Cole Center for Microbial Ecology Dept. of Plant, Soil & Microbial Sciences Michigan State University East Lansing, Michigan U.S.A. Where I m From
More informationProbabilistic Arithmetic Automata
Probabilistic Arithmetic Automata Applications of a Stochastic Computational Framework in Biological Sequence Analysis Inke Herms PhD thesis defense Overview 1 Probabilistic Arithmetic Automata 2 Application
More informationInferring Protein-Signaling Networks
Inferring Protein-Signaling Networks Lectures 14 Nov 14, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall (JHN) 022 1
More informationTranscription Regulation and Gene Expression in Eukaryotes FS08 Pharmacenter/Biocenter Auditorium 1 Wednesdays 16h15-18h00.
Transcription Regulation and Gene Expression in Eukaryotes FS08 Pharmacenter/Biocenter Auditorium 1 Wednesdays 16h15-18h00. Promoters and Enhancers Systematic discovery of transcriptional regulatory motifs
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2014 1 HMM Lecture Notes Dannie Durand and Rose Hoberman November 6th Introduction In the last few lectures, we have focused on three problems related
More informationEvaluation of the relative contribution of each STRING feature in the overall accuracy operon classification
Evaluation of the relative contribution of each STRING feature in the overall accuracy operon classification B. Taboada *, E. Merino 2, C. Verde 3 blanca.taboada@ccadet.unam.mx Centro de Ciencias Aplicadas
More information2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity.
Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. A global picture of the protein universe will help us to understand
More informationNetwork Biology: Understanding the cell s functional organization. Albert-László Barabási Zoltán N. Oltvai
Network Biology: Understanding the cell s functional organization Albert-László Barabási Zoltán N. Oltvai Outline: Evolutionary origin of scale-free networks Motifs, modules and hierarchical networks Network
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationBMI/CS 776 Lecture #20 Alignment of whole genomes. Colin Dewey (with slides adapted from those by Mark Craven)
BMI/CS 776 Lecture #20 Alignment of whole genomes Colin Dewey (with slides adapted from those by Mark Craven) 2007.03.29 1 Multiple whole genome alignment Input set of whole genome sequences genomes diverged
More informationPredicting RNA Secondary Structure Using Profile Stochastic Context-Free Grammars and Phylogenic Analysis
Fang XY, Luo ZG, Wang ZH. Predicting RNA secondary structure using profile stochastic context-free grammars and phylogenic analysis. JOURNAL OF COMPUTER SCIENCE AND TECHNOLOGY 23(4): 582 589 July 2008
More informationAP Biology UNIT 1: CELL BIOLOGY. Advanced Placement
Advanced Placement AP Biology builds students' understanding of biology on both the micro and macro scales. After studying cell biology, students move on to understand how evolution drives the diversity
More informationMachine Learning for Structured Prediction
Machine Learning for Structured Prediction Grzegorz Chrupa la National Centre for Language Technology School of Computing Dublin City University NCLT Seminar Grzegorz Chrupa la (DCU) Machine Learning for
More informationUniversity of Florida CISE department Gator Engineering. Clustering Part 1
Clustering Part 1 Dr. Sanjay Ranka Professor Computer and Information Science and Engineering University of Florida, Gainesville What is Cluster Analysis? Finding groups of objects such that the objects
More informationPattern Recognition and Machine Learning
Christopher M. Bishop Pattern Recognition and Machine Learning ÖSpri inger Contents Preface Mathematical notation Contents vii xi xiii 1 Introduction 1 1.1 Example: Polynomial Curve Fitting 4 1.2 Probability
More informationMULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr
More informationSUPPLEMENTARY INFORMATION
Supplementary information S1 (box). Supplementary Methods description. Prokaryotic Genome Database Archaeal and bacterial genome sequences were downloaded from the NCBI FTP site (ftp://ftp.ncbi.nlm.nih.gov/genomes/all/)
More informationBiological Systems: Open Access
Biological Systems: Open Access Biological Systems: Open Access Liu and Zheng, 2016, 5:1 http://dx.doi.org/10.4172/2329-6577.1000153 ISSN: 2329-6577 Research Article ariant Maps to Identify Coding and
More information