Overview of Research at Bioinformatics Lab

Size: px
Start display at page:

Download "Overview of Research at Bioinformatics Lab"

Transcription

1 Overview of Research at Bioinformatics Lab Li Liao Develop new algorithms and (statistical) learning methods that help solve biological problems > Capable of incorporating domain knowledge > Effective, Expressive, Interpretable 1

2 Motivations Understanding correlations between genotype and phenotype Predicting genotype <=> phenotype Some Phenotype examples: Protein function Drug/therapy response Drug-drug interactions for expression Drug mechanism Interacting pathways of metabolism 2

3 Bioinformatics in a cell 3

4 Credit:Kellis & Indyk 4

5 Projects Genome sequencing and assembly (funded by NSF) Homology detection, protein family classification (funded by a DuPont S&E award) Support Vector Machines Hidden Markov models Graph theoretic methods Probabilistic modeling for BioSequence (funded by NIH) HMMs, and beyond Motifs finding Secondary structure Systems Bioinformatics Prediction of Protein-Protein Interactions Inference of Gene Regulatory Networks Prediction of other regulatory elements Pattern analysis for RNAi (funded by UDRF) Comparative Genomics Identify genome features for diagnostic and therapeutic purposes (funded by an Army grant) 5

6 People Current members: - Roger Craig (PhD student) - Alvaro Gonzalez (PhD student) - Kevin McCormick (PhD student) - Colin Kern (PhD student) Past members: - Dr. Wen-Zhong Wang (Postdoc Fellow) - Robel Kahsay (Ph.D. currently at DuPont Central Research & Development) - Kishore Narra (M.S. currently at VistaPrint, Inc.) - Arpita Gandhi (M.S. currently at Colgate-Palmolive Company) - Gaurav Jain (M.S. currently at Institute of Genomics, Univ. of Maryland) - Shivakundan Singh Tej (M.S.) - Tapan Patel (B.S. currently in MD/PhD program at U Penn) - Laura Shankman (B.S., currently in PhD program at U Virginia) 6

7 7

8 8

9 Hybrid Hierarchical Assembly Three types of reads: Sanger (~1000bp), 454 (~100bp), and SBS (~30bp). Assembly of individual types using the best suited assemblers. Phrap, TIGR, etc. for Sanger reads Euler assembler and Newbler for 454 reads Euler short, Shorty for SBS reads Hybrid and hierarchical Use longer reads as scaffolding to resolve repeat regions that are difficult for shorter reads Use contigs from shorter reads (pyrosequencing) as pseudoreads to bridge gaps (nonclonable and hard stops) with Sanger reads. 9

10 Major Findings Hybrid hierarchical assembly is proved to be an effective way for assembling short reads Incremental approach to selecting ABI reads is more effective than random approach in generating high coverage contigs Staged assembly using Phrap is an effective alternative to the proprietary Newbler assembler. Publications: Gonzalez & Liao, BMC Bioinformatics 2008, 9:

11 Blue lines are contigs generated from hybrid assembly 11

12 Detect remote homologues Attributes: - Sequence similarity, Aggregate statistics (e.g., protein families), Pattern/motif, and more attributes (presence at phylogenetic tree). How to incorporate domain specific knowledge into the model so a classifier can be more accurate? Results: - Quasi-consensus based comparison of profile HMM for protein sequences (Kahsay et al, Bioinformatics 2005) - Using extended phylogenetic profiles and support vector machines for protein family classification (Narra & Liao, SNPD04, Craig & Liao, ICMLA 05, Craig & Liao SAC 06, Craig & Liao, Int l J. Bioinfo & DM 2007) - Combining Pairwise Sequence Similarity and Support Vector Machines for Detecting Remote Protein Evolutionary and Structural Relationships (JCB 2003) 12

13 Non-linear mapping to a feature space Φ( ) x j x i Φ(x i ) Φ(x j ) L( ) = i ½ i j y i y j Φ (x i ) Φ (x j ) 13

14 Hamming distance Tree-based distance Data: phylogenetic profiles - How to account for correlations among profile components? profile extension (Narra & Liao, SNPD 04) Transductive learning (Craig & Liao, ICMLA 05, SAC 06, IJBDM, 2007) x = y = z = = =

15 Post-order traversal

16 16

17 Sequence Models (HMMs and beyond) Motivations: What is responsible for the function? Patterns/motifs Secondary structure To capture long range correlations of bio sequences Transporter proteins RNA secondary structure Methods: generative versus discriminative Linear dependent processes Stochastic grammars Model equivalence 17

18 TMMOD: An improved hidden Markov model for predicting transmembrane topology (Kahsay, Gao & Liao. Bioinformatics 2005) 18

19 Mod. Reg. Data set Correct topology Correct location Sensitivity Specificity TMMOD 1 (a) (b) (c) S (78.3%) 51 (61.4%) 64 (77.1%) 67 (80.7%) 52 (62.7%) 65 (78.3%) 97.4% 71.3% 97.1% 97.4% 71.3% 97.1% TMMOD 2 (a) (b) (c) S (73.5%) 54 (65.1%) 54 (65.1%) 65 (78.3%) 61 (73.5%) 66 (79.5%) 99.4% 93.8% 99.7% 97.4% 71.3% 97.1% TMMOD 3 (a) (b) (c) S (84.3%) 64 (77.1%) 74 (89.2%) 71 (85.5%) 65 (78.3%) 74 (89.2%) 98.2% 95.3% 99.1% 97.4% 71.3% 97.1% TMHMM S (77.1%) 69 (83.1%) 96.2% 96.2% PHDtm S-83 (85.5%) (88.0%) 98.8% 95.2% TMMOD 1 (a) (b) (c) S (73.1%) 92 (57.5%) 117 (73.1%) 128 (80.0%) 103 (64.4%) 126 (78.8%) 97.4% 77.4% 96.1% 97.0% 80.8% 96.7% TMMOD 2 (a) (b) (c) S (75.0%) 97 (60.6%) 118 (73.8%) 132 (82.5%) 121 (75.6%) 135 (84.4%) 98.4% 97.7% 98.4% 97.2% 95.6% 97.2% TMMOD 3 (a) (b) (c) S (75.0%) 110 (68.8%) 135 (84.4%) 133 (83.1%) 124 (77.5%) 143 (89.4%) 97.8% 94.5% 98.3% 97.6% 98.1% 98.1% TMHMM S (76.9%) 134 (83.8%) 97.1% 97.7% 19

20 20

21 21

22 Inferring Regulatory Networks from Time Course Expression Data (Gandhi, Cogburn & Liao, 2008) Expression Profile Clustering K-mean Binary heat map Boolean network algorithm 22

23 GENOMIC COMPARISON OF BACTERIAL SPECIES BASED ON METABOLIC CHARACTERISTICS (Jain, Wang, Boyd, Liao, ISIBM 2009) 23

24 24

Introduction to Bioinformatics

Introduction to Bioinformatics CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics

More information

CISC 636 Computational Biology & Bioinformatics (Fall 2016)

CISC 636 Computational Biology & Bioinformatics (Fall 2016) CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein

More information

Graph Alignment and Biological Networks

Graph Alignment and Biological Networks Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale

More information

Computational Systems Biology

Computational Systems Biology Computational Systems Biology Vasant Honavar Artificial Intelligence Research Laboratory Bioinformatics and Computational Biology Graduate Program Center for Computational Intelligence, Learning, & Discovery

More information

Hidden Markov Models (I)

Hidden Markov Models (I) GLOBEX Bioinformatics (Summer 2015) Hidden Markov Models (I) a. The model b. The decoding: Viterbi algorithm Hidden Markov models A Markov chain of states At each state, there are a set of possible observables

More information

HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM

HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM I529: Machine Learning in Bioinformatics (Spring 2017) HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University, Bloomington

More information

3/1/17. Content. TWINSCAN model. Example. TWINSCAN algorithm. HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM

3/1/17. Content. TWINSCAN model. Example. TWINSCAN algorithm. HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM I529: Machine Learning in Bioinformatics (Spring 2017) Content HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University,

More information

#33 - Genomics 11/09/07

#33 - Genomics 11/09/07 BCB 444/544 Required Reading (before lecture) Lecture 33 Mon Nov 5 - Lecture 31 Phylogenetics Parsimony and ML Chp 11 - pp 142 169 Genomics Wed Nov 7 - Lecture 32 Machine Learning Fri Nov 9 - Lecture 33

More information

Comparative genomics: Overview & Tools + MUMmer algorithm

Comparative genomics: Overview & Tools + MUMmer algorithm Comparative genomics: Overview & Tools + MUMmer algorithm Urmila Kulkarni-Kale Bioinformatics Centre University of Pune, Pune 411 007. urmila@bioinfo.ernet.in Genome sequence: Fact file 1995: The first

More information

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL

More information

Prediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines

Prediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines Article Prediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines Yun-Fei Wang, Huan Chen, and Yan-Hong Zhou* Hubei Bioinformatics and Molecular Imaging Key Laboratory,

More information

Mining and classification of repeat protein structures

Mining and classification of repeat protein structures Mining and classification of repeat protein structures Ian Walsh Ph.D. BioComputing UP, Department of Biology, University of Padova, Italy URL: http://protein.bio.unipd.it/ Repeat proteins Why are they

More information

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK

More information

Understanding Science Through the Lens of Computation. Richard M. Karp Nov. 3, 2007

Understanding Science Through the Lens of Computation. Richard M. Karp Nov. 3, 2007 Understanding Science Through the Lens of Computation Richard M. Karp Nov. 3, 2007 The Computational Lens Exposes the computational nature of natural processes and provides a language for their description.

More information

Computational Genomics. Systems biology. Putting it together: Data integration using graphical models

Computational Genomics. Systems biology. Putting it together: Data integration using graphical models 02-710 Computational Genomics Systems biology Putting it together: Data integration using graphical models High throughput data So far in this class we discussed several different types of high throughput

More information

Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics

Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign http://tandy.cs.illinois.edu

More information

Taxonomy. Content. How to determine & classify a species. Phylogeny and evolution

Taxonomy. Content. How to determine & classify a species. Phylogeny and evolution Taxonomy Content Why Taxonomy? How to determine & classify a species Domains versus Kingdoms Phylogeny and evolution Why Taxonomy? Classification Arrangement in groups or taxa (taxon = group) Nomenclature

More information

Genomics and bioinformatics summary. Finding genes -- computer searches

Genomics and bioinformatics summary. Finding genes -- computer searches Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Sequence Assembly

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Sequence Assembly CMPS 6630: Introduction to Computational Biology and Bioinformatics Sequence Assembly Why Genome Sequencing? Sanger (1982) introduced chaintermination sequencing. Main idea: Obtain fragments of all possible

More information

Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department

More information

Predicting Protein Functions and Domain Interactions from Protein Interactions

Predicting Protein Functions and Domain Interactions from Protein Interactions Predicting Protein Functions and Domain Interactions from Protein Interactions Fengzhu Sun, PhD Center for Computational and Experimental Genomics University of Southern California Outline High-throughput

More information

Biological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor

Biological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms

More information

STRUCTURAL BIOINFORMATICS I. Fall 2015

STRUCTURAL BIOINFORMATICS I. Fall 2015 STRUCTURAL BIOINFORMATICS I Fall 2015 Info Course Number - Classification: Biology 5411 Class Schedule: Monday 5:30-7:50 PM, SERC Room 456 (4 th floor) Instructors: Vincenzo Carnevale - SERC, Room 704C;

More information

Week 10: Homology Modelling (II) - HHpred

Week 10: Homology Modelling (II) - HHpred Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative

More information

Bioinformatics. Dept. of Computational Biology & Bioinformatics

Bioinformatics. Dept. of Computational Biology & Bioinformatics Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS

More information

Hidden Markov Models

Hidden Markov Models Hidden Markov Models A selection of slides taken from the following: Chris Bystroff Protein Folding Initiation Site Motifs Iosif Vaisman Bioinformatics and Gene Discovery Colin Cherry Hidden Markov Models

More information

Jessica Wehner. Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008

Jessica Wehner. Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008 Journal Club Jessica Wehner Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008 Comparison of Probabilistic Combination Methods for Protein Secondary Structure

More information

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic

More information

Comparative Network Analysis

Comparative Network Analysis Comparative Network Analysis BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2016 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by

More information

Learning in Bayesian Networks

Learning in Bayesian Networks Learning in Bayesian Networks Florian Markowetz Max-Planck-Institute for Molecular Genetics Computational Molecular Biology Berlin Berlin: 20.06.2002 1 Overview 1. Bayesian Networks Stochastic Networks

More information

Some Problems from Enzyme Families

Some Problems from Enzyme Families Some Problems from Enzyme Families Greg Butler Department of Computer Science Concordia University, Montreal www.cs.concordia.ca/~faculty/gregb gregb@cs.concordia.ca Abstract I will discuss some problems

More information

Computational Biology: Basics & Interesting Problems

Computational Biology: Basics & Interesting Problems Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information

More information

Computational methods for predicting protein-protein interactions

Computational methods for predicting protein-protein interactions Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational

More information

Sequence Alignment Techniques and Their Uses

Sequence Alignment Techniques and Their Uses Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this

More information

AN AXIOMATIC DESIGN FOR MODELING BIOLOGICAL SYSTEMS

AN AXIOMATIC DESIGN FOR MODELING BIOLOGICAL SYSTEMS AN AXIOMATIC DESIGN FOR MODELING BIOLOGICAL SYSTEMS Harun Pirim and Burak Eksioglu Department of Industrial and Systems Engineering Mississippi State University PO Box 9542 Mississippi State, MS 39762,

More information

Computational Molecular Biology (

Computational Molecular Biology ( Computational Molecular Biology (http://cmgm cmgm.stanford.edu/biochem218/) Biochemistry 218/Medical Information Sciences 231 Douglas L. Brutlag, Lee Kozar Jimmy Huang, Josh Silverman Lecture Syllabus

More information

Genome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting.

Genome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting. Genome Annotation Bioinformatics and Computational Biology Genome Annotation Frank Oliver Glöckner 1 Genome Analysis Roadmap Genome sequencing Assembly Gene prediction Protein targeting trna prediction

More information

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki. Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein

More information

Cellular Systems Biology or Biological Network Analysis

Cellular Systems Biology or Biological Network Analysis Cellular Systems Biology or Biological Network Analysis Joel S. Bader Department of Biomedical Engineering Johns Hopkins University (c) 2012 December 4, 2012 1 Preface Cells are systems. Standard engineering

More information

INTERACTIVE CLUSTERING FOR EXPLORATION OF GENOMIC DATA

INTERACTIVE CLUSTERING FOR EXPLORATION OF GENOMIC DATA INTERACTIVE CLUSTERING FOR EXPLORATION OF GENOMIC DATA XIUFENG WAN xw6@cs.msstate.edu Department of Computer Science Box 9637 JOHN A. BOYLE jab@ra.msstate.edu Department of Biochemistry and Molecular Biology

More information

Grundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson

Grundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson Grundlagen der Bioinformatik, SS 10, D. Huson, April 12, 2010 1 1 Introduction Grundlagen der Bioinformatik Summer semester 2010 Lecturer: Prof. Daniel Huson Office hours: Thursdays 17-18h (Sand 14, C310a)

More information

HYPERGRAPH BASED SEMI-SUPERVISED LEARNING ALGORITHMS APPLIED TO SPEECH RECOGNITION PROBLEM: A NOVEL APPROACH

HYPERGRAPH BASED SEMI-SUPERVISED LEARNING ALGORITHMS APPLIED TO SPEECH RECOGNITION PROBLEM: A NOVEL APPROACH HYPERGRAPH BASED SEMI-SUPERVISED LEARNING ALGORITHMS APPLIED TO SPEECH RECOGNITION PROBLEM: A NOVEL APPROACH Hoang Trang 1, Tran Hoang Loc 1 1 Ho Chi Minh City University of Technology-VNU HCM, Ho Chi

More information

Assembly improvement: based on Ragout approach. student: Anna Lioznova scientific advisor: Son Pham

Assembly improvement: based on Ragout approach. student: Anna Lioznova scientific advisor: Son Pham Assembly improvement: based on Ragout approach student: Anna Lioznova scientific advisor: Son Pham Plan Ragout overview Datasets Assembly improvements Quality overlap graph paired-end reads Coverage Plan

More information

Charalampos (Babis) E. Tsourakakis WABI 2013, France WABI '13 1

Charalampos (Babis) E. Tsourakakis WABI 2013, France WABI '13 1 Charalampos (Babis) E. Tsourakakis charalampos.tsourakakis@aalto.fi WBI 2013, France WBI '13 1 WBI '13 2 B B B C B B B B B B B B B B B D D D E E E E E E E Copy numbers for a single gene B C D E (2) (3)

More information

86 Part 4 SUMMARY INTRODUCTION

86 Part 4 SUMMARY INTRODUCTION 86 Part 4 Chapter # AN INTEGRATION OF THE DESCRIPTIONS OF GENE NETWORKS AND THEIR MODELS PRESENTED IN SIGMOID (CELLERATOR) AND GENENET Podkolodny N.L. *1, 2, Podkolodnaya N.N. 1, Miginsky D.S. 1, Poplavsky

More information

GLOBEX Bioinformatics (Summer 2015) Genetic networks and gene expression data

GLOBEX Bioinformatics (Summer 2015) Genetic networks and gene expression data GLOBEX Bioinformatics (Summer 2015) Genetic networks and gene expression data 1 Gene Networks Definition: A gene network is a set of molecular components, such as genes and proteins, and interactions between

More information

Lecture 3: A basic statistical concept

Lecture 3: A basic statistical concept Lecture 3: A basic statistical concept P value In statistical hypothesis testing, the p value is the probability of obtaining a result at least as extreme as the one that was actually observed, assuming

More information

Markov Models & DNA Sequence Evolution

Markov Models & DNA Sequence Evolution 7.91 / 7.36 / BE.490 Lecture #5 Mar. 9, 2004 Markov Models & DNA Sequence Evolution Chris Burge Review of Markov & HMM Models for DNA Markov Models for splice sites Hidden Markov Models - looking under

More information

EBI web resources II: Ensembl and InterPro. Yanbin Yin Spring 2013

EBI web resources II: Ensembl and InterPro. Yanbin Yin Spring 2013 EBI web resources II: Ensembl and InterPro Yanbin Yin Spring 2013 1 Outline Intro to genome annotation Protein family/domain databases InterPro, Pfam, Superfamily etc. Genome browser Ensembl Hands on Practice

More information

Bioinformatics Chapter 1. Introduction

Bioinformatics Chapter 1. Introduction Bioinformatics Chapter 1. Introduction Outline! Biological Data in Digital Symbol Sequences! Genomes Diversity, Size, and Structure! Proteins and Proteomes! On the Information Content of Biological Sequences!

More information

The minimal prokaryotic genome. The minimal prokaryotic genome. The minimal prokaryotic genome. The minimal prokaryotic genome

The minimal prokaryotic genome. The minimal prokaryotic genome. The minimal prokaryotic genome. The minimal prokaryotic genome Dr. Dirk Gevers 1,2 1 Laboratorium voor Microbiologie 2 Bioinformatics & Evolutionary Genomics The bacterial species in the genomic era CTACCATGAAAGACTTGTGAATCCAGGAAGAGAGACTGACTGGGCAACATGTTATTCAG GTACAAAAAGATTTGGACTGTAACTTAAAAATGATCAAATTATGTTTCCCATGCATCAGG

More information

CAP 5510 Lecture 3 Protein Structures

CAP 5510 Lecture 3 Protein Structures CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity

More information

Map of AP-Aligned Bio-Rad Kits with Learning Objectives

Map of AP-Aligned Bio-Rad Kits with Learning Objectives Map of AP-Aligned Bio-Rad Kits with Learning Objectives Cover more than one AP Biology Big Idea with these AP-aligned Bio-Rad kits. Big Idea 1 Big Idea 2 Big Idea 3 Big Idea 4 ThINQ! pglo Transformation

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Computational Genomics

Computational Genomics Computational Genomics http://www.cs.cmu.edu/~02710 Introduction to probability, statistics and algorithms (brief) intro to probability Basic notations Random variable - referring to an element / event

More information

CSCE555 Bioinformatics. Protein Function Annotation

CSCE555 Bioinformatics. Protein Function Annotation CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The

More information

A A A A B B1

A A A A B B1 LEARNING OBJECTIVES FOR EACH BIG IDEA WITH ASSOCIATED SCIENCE PRACTICES AND ESSENTIAL KNOWLEDGE Learning Objectives will be the target for AP Biology exam questions Learning Objectives Sci Prac Es Knowl

More information

Early History up to Schedule. Proteins DNA & RNA Schwann and Schleiden Cell Theory Charles Darwin publishes Origin of Species

Early History up to Schedule. Proteins DNA & RNA Schwann and Schleiden Cell Theory Charles Darwin publishes Origin of Species Schedule Bioinformatics and Computational Biology: History and Biological Background (JH) 0.0 he Parsimony criterion GKN.0 Stochastic Models of Sequence Evolution GKN 7.0 he Likelihood criterion GKN 0.0

More information

Content Descriptions Based on the Georgia Performance Standards. Biology

Content Descriptions Based on the Georgia Performance Standards. Biology Content Descriptions Based on the Georgia Performance Standards Biology Introduction The State Board of Education is required by Georgia law (A+ Educational Reform Act of 2000, O.C.G.A. 20-2-281) to adopt

More information

Basic modeling approaches for biological systems. Mahesh Bule

Basic modeling approaches for biological systems. Mahesh Bule Basic modeling approaches for biological systems Mahesh Bule The hierarchy of life from atoms to living organisms Modeling biological processes often requires accounting for action and feedback involving

More information

Multiple Sequence Alignment: HMMs and Other Approaches

Multiple Sequence Alignment: HMMs and Other Approaches Multiple Sequence Alignment: HMMs and Other Approaches Background Readings: Durbin et. al. Section 3.1, Ewens and Grant, Ch4. Wing-Kin Sung, Ch 6 Beerenwinkel N, Siebourg J. Statistics, probability, and

More information

Phylogenetic Analysis of Molecular Interaction Networks 1

Phylogenetic Analysis of Molecular Interaction Networks 1 Phylogenetic Analysis of Molecular Interaction Networks 1 Mehmet Koyutürk Case Western Reserve University Electrical Engineering & Computer Science 1 Joint work with Sinan Erten, Xin Li, Gurkan Bebek,

More information

BSc MATHEMATICAL SCIENCE

BSc MATHEMATICAL SCIENCE Overview College of Science Modules Electives May 2018 (2) BSc MATHEMATICAL SCIENCE BSc Mathematical Science Degree 2018 1 College of Science, NUI Galway Fullscreen Next page Overview [60 Credits] [60

More information

Preface. Contributors

Preface. Contributors CONTENTS Foreword Preface Contributors PART I INTRODUCTION 1 1 Networks in Biology 3 Björn H. Junker 1.1 Introduction 3 1.2 Biology 101 4 1.2.1 Biochemistry and Molecular Biology 4 1.2.2 Cell Biology 6

More information

Transductive learning with EM algorithm to classify proteins based on phylogenetic profiles

Transductive learning with EM algorithm to classify proteins based on phylogenetic profiles Int. J. Data Mining and Bioinformatics, Vol. 1, No. 4, 2007 337 Transductive learning with EM algorithm to classify proteins based on phylogenetic profiles Roger A. Craig and Li Liao* Department of Computer

More information

Homology Modeling. Roberto Lins EPFL - summer semester 2005

Homology Modeling. Roberto Lins EPFL - summer semester 2005 Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,

More information

AP Curriculum Framework with Learning Objectives

AP Curriculum Framework with Learning Objectives Big Ideas Big Idea 1: The process of evolution drives the diversity and unity of life. AP Curriculum Framework with Learning Objectives Understanding 1.A: Change in the genetic makeup of a population over

More information

CISC 889 Bioinformatics (Spring 2004) Lecture 1

CISC 889 Bioinformatics (Spring 2004) Lecture 1 CISC 889 Bioinformatics (Spring 2004) Lecture 1 Course Overview Li Liao Computer and Information Sciences University of Delaware Administrative stuff Syllabus and tentative schedule (check frequently for

More information

Comparative Bioinformatics Midterm II Fall 2004

Comparative Bioinformatics Midterm II Fall 2004 Comparative Bioinformatics Midterm II Fall 2004 Objective Answer, part I: For each of the following, select the single best answer or completion of the phrase. (3 points each) 1. Deinococcus radiodurans

More information

Bioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing

Bioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing Bioinformatics Proteins II. - Pattern, Profile, & Structure Database Searching Robert Latek, Ph.D. Bioinformatics, Biocomputing WIBR Bioinformatics Course, Whitehead Institute, 2002 1 Proteins I.-III.

More information

COMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University

COMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018

More information

Computational Biology From The Perspective Of A Physical Scientist

Computational Biology From The Perspective Of A Physical Scientist Computational Biology From The Perspective Of A Physical Scientist Dr. Arthur Dong PP1@TUM 26 November 2013 Bioinformatics Education Curriculum Math, Physics, Computer Science (Statistics and Programming)

More information

Inferring Causal Phenotype Networks from Segregating Populat

Inferring Causal Phenotype Networks from Segregating Populat Inferring Causal Phenotype Networks from Segregating Populations Elias Chaibub Neto chaibub@stat.wisc.edu Statistics Department, University of Wisconsin - Madison July 15, 2008 Overview Introduction Description

More information

CS612 - Algorithms in Bioinformatics

CS612 - Algorithms in Bioinformatics Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available

More information

Visualize Biological Database for Protein in Homosapiens Using Classification Searching Models

Visualize Biological Database for Protein in Homosapiens Using Classification Searching Models International Journal of Computational Intelligence Research ISSN 0973-1873 Volume 13, Number 2 (2017), pp. 213-224 Research India Publications http://www.ripublication.com Visualize Biological Database

More information

Protein Complex Identification by Supervised Graph Clustering

Protein Complex Identification by Supervised Graph Clustering Protein Complex Identification by Supervised Graph Clustering Yanjun Qi 1, Fernanda Balem 2, Christos Faloutsos 1, Judith Klein- Seetharaman 1,2, Ziv Bar-Joseph 1 1 School of Computer Science, Carnegie

More information

Mutual Information & Genotype-Phenotype Association. Norman MacDonald January 31, 2011 CSCI 4181/6802

Mutual Information & Genotype-Phenotype Association. Norman MacDonald January 31, 2011 CSCI 4181/6802 Mutual Information & Genotype-Phenotype Association Norman MacDonald January 31, 2011 CSCI 4181/6802 2 Overview What is information (specifically Shannon Information)? What are information entropy and

More information

Introduction to Bioinformatics Online Course: IBT

Introduction to Bioinformatics Online Course: IBT Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple

More information

Structure to Function. Molecular Bioinformatics, X3, 2006

Structure to Function. Molecular Bioinformatics, X3, 2006 Structure to Function Molecular Bioinformatics, X3, 2006 Structural GeNOMICS Structural Genomics project aims at determination of 3D structures of all proteins: - organize known proteins into families

More information

Microbial Taxonomy. Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible.

Microbial Taxonomy. Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible. Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional

More information

6.047 / Computational Biology: Genomes, Networks, Evolution Fall 2008

6.047 / Computational Biology: Genomes, Networks, Evolution Fall 2008 MIT OpenCourseWare http://ocw.mit.edu 6.047 / 6.878 Computational Biology: Genomes, Networks, Evolution Fall 2008 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms.

More information

Big Idea 3: Living systems store, retrieve, transmit, and respond to information essential to life processes.

Big Idea 3: Living systems store, retrieve, transmit, and respond to information essential to life processes. Big Idea 3: Living systems store, retrieve, transmit, and respond to information essential to life processes. Enduring understanding 3.A: Heritable information provides for continuity of life. Essential

More information

MiGA: The Microbial Genome Atlas

MiGA: The Microbial Genome Atlas December 12 th 2017 MiGA: The Microbial Genome Atlas Jim Cole Center for Microbial Ecology Dept. of Plant, Soil & Microbial Sciences Michigan State University East Lansing, Michigan U.S.A. Where I m From

More information

Probabilistic Arithmetic Automata

Probabilistic Arithmetic Automata Probabilistic Arithmetic Automata Applications of a Stochastic Computational Framework in Biological Sequence Analysis Inke Herms PhD thesis defense Overview 1 Probabilistic Arithmetic Automata 2 Application

More information

Inferring Protein-Signaling Networks

Inferring Protein-Signaling Networks Inferring Protein-Signaling Networks Lectures 14 Nov 14, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall (JHN) 022 1

More information

Transcription Regulation and Gene Expression in Eukaryotes FS08 Pharmacenter/Biocenter Auditorium 1 Wednesdays 16h15-18h00.

Transcription Regulation and Gene Expression in Eukaryotes FS08 Pharmacenter/Biocenter Auditorium 1 Wednesdays 16h15-18h00. Transcription Regulation and Gene Expression in Eukaryotes FS08 Pharmacenter/Biocenter Auditorium 1 Wednesdays 16h15-18h00. Promoters and Enhancers Systematic discovery of transcriptional regulatory motifs

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2014 1 HMM Lecture Notes Dannie Durand and Rose Hoberman November 6th Introduction In the last few lectures, we have focused on three problems related

More information

Evaluation of the relative contribution of each STRING feature in the overall accuracy operon classification

Evaluation of the relative contribution of each STRING feature in the overall accuracy operon classification Evaluation of the relative contribution of each STRING feature in the overall accuracy operon classification B. Taboada *, E. Merino 2, C. Verde 3 blanca.taboada@ccadet.unam.mx Centro de Ciencias Aplicadas

More information

2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity.

2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. A global picture of the protein universe will help us to understand

More information

Network Biology: Understanding the cell s functional organization. Albert-László Barabási Zoltán N. Oltvai

Network Biology: Understanding the cell s functional organization. Albert-László Barabási Zoltán N. Oltvai Network Biology: Understanding the cell s functional organization Albert-László Barabási Zoltán N. Oltvai Outline: Evolutionary origin of scale-free networks Motifs, modules and hierarchical networks Network

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

BMI/CS 776 Lecture #20 Alignment of whole genomes. Colin Dewey (with slides adapted from those by Mark Craven)

BMI/CS 776 Lecture #20 Alignment of whole genomes. Colin Dewey (with slides adapted from those by Mark Craven) BMI/CS 776 Lecture #20 Alignment of whole genomes Colin Dewey (with slides adapted from those by Mark Craven) 2007.03.29 1 Multiple whole genome alignment Input set of whole genome sequences genomes diverged

More information

Predicting RNA Secondary Structure Using Profile Stochastic Context-Free Grammars and Phylogenic Analysis

Predicting RNA Secondary Structure Using Profile Stochastic Context-Free Grammars and Phylogenic Analysis Fang XY, Luo ZG, Wang ZH. Predicting RNA secondary structure using profile stochastic context-free grammars and phylogenic analysis. JOURNAL OF COMPUTER SCIENCE AND TECHNOLOGY 23(4): 582 589 July 2008

More information

AP Biology UNIT 1: CELL BIOLOGY. Advanced Placement

AP Biology UNIT 1: CELL BIOLOGY. Advanced Placement Advanced Placement AP Biology builds students' understanding of biology on both the micro and macro scales. After studying cell biology, students move on to understand how evolution drives the diversity

More information

Machine Learning for Structured Prediction

Machine Learning for Structured Prediction Machine Learning for Structured Prediction Grzegorz Chrupa la National Centre for Language Technology School of Computing Dublin City University NCLT Seminar Grzegorz Chrupa la (DCU) Machine Learning for

More information

University of Florida CISE department Gator Engineering. Clustering Part 1

University of Florida CISE department Gator Engineering. Clustering Part 1 Clustering Part 1 Dr. Sanjay Ranka Professor Computer and Information Science and Engineering University of Florida, Gainesville What is Cluster Analysis? Finding groups of objects such that the objects

More information

Pattern Recognition and Machine Learning

Pattern Recognition and Machine Learning Christopher M. Bishop Pattern Recognition and Machine Learning ÖSpri inger Contents Preface Mathematical notation Contents vii xi xiii 1 Introduction 1 1.1 Example: Polynomial Curve Fitting 4 1.2 Probability

More information

MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE

MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary information S1 (box). Supplementary Methods description. Prokaryotic Genome Database Archaeal and bacterial genome sequences were downloaded from the NCBI FTP site (ftp://ftp.ncbi.nlm.nih.gov/genomes/all/)

More information

Biological Systems: Open Access

Biological Systems: Open Access Biological Systems: Open Access Biological Systems: Open Access Liu and Zheng, 2016, 5:1 http://dx.doi.org/10.4172/2329-6577.1000153 ISSN: 2329-6577 Research Article ariant Maps to Identify Coding and

More information