Mining and classification of repeat protein structures

Size: px
Start display at page:

Download "Mining and classification of repeat protein structures"

Transcription

1 Mining and classification of repeat protein structures Ian Walsh Ph.D. BioComputing UP, Department of Biology, University of Padova, Italy URL:

2 Repeat proteins Why are they important? Ribonuclease inhibitor Abundant in nature: Cell regulation Transcriptional control Nervous system roles Protein transport Disease: Neurodegenerative and infectious disease PDB code: 1z7x_W

3 Repeat proteins Why are they important? Abundant in nature: Cell regulation Transcriptional control Nervous system roles Protein transport Disease: Neurodegenerative and infectious disease Very modular Repeating structural motifs Good for protein design Bad for homology modeling

4 Example: Why do we need a dedicated resource? PDB code: 3oja_A

5 Goal Dedicated repeat resource Protein Data Bank: is great for collecting info on all structures Repeats Data Bank (annotation steps): 1. Extract repeat structures from PDB Repeats 2. Identify repeating domains and classify 3. Split repeats into tandem arrays 4. Publicly available Data Bank

6 RAPHAEL (Walsh, et al. Bioinformatics, 28: , 2012) Idea: Discriminates repeat from globular structures Algorithm: Identify periodic changes in 3D coordinates Geometry Machine learning Periodic variance (A) Repeat protein Leucine-rich Effector protein (PDB code 1JL5) (B) Globular Sulfhydryl protease (PDB code 9PAP).

7 RAPHAEL results: Detection Large improvement Vs. sequence detectors ROC curve on the combined training and test set. RAPHAEL trained using the leave one out split is compared to four other methods. The curve ends when a method does not produce further output, i.e. believes to have found all solenoids.

8 RAPHAEL- Period Number of residues in each repeating unit Derived from distance frequencies: Accurate period calculation Accuracy = 90% within 5 residues 20 residues

9 RAPHAEL- Insertions Non-periodic parts Derivation: deviations from period Not all repeat detection easy Example of insertions for a β-solenoid.

10 ProteinZoo Invites people to assist in the classification of large protein numbers Crowd Science Large repeat protein set Large amount of people + In-house software annotation tools Classification Level. Consensus Detailed Level Consensus

11 Annotation with ProteinZoo RAPHAEL MINING Repeats Predicted Period Predicted insertions ProteinZoo >7,000 structures

12 (Di Domenico, et al. Nucl. Acids Res., accepted) RepeatsDB is a collaborative database of repeat proteins. It builds on the results of RAPHAEL, and leverages manual curation to provide a high quality gold standard of repeat protein annotations. In collaboration with: Dr. Andrey V. Kajava (CNRS Montpellier) Giant RNA twister (TAL effector, PDB: 4gjr) Propeller with spare part (Proteasome regulatory particle, PDB: 3acp) Dr. Diego U. Ferreiro (Universidad de Buenos Aires)

13 Schematic view of the different classification levels (Pyrimad scheme)

14 (Pyrimad scheme) RAPHAEL Mining Schematic view of the different classification levels

15 (Pyrimad scheme) ProteinZoo basic classification (Tree) Schematic view of the different classification levels Based on a scheme previously proposed (Kajava A.V., Tandem repeats in proteins: From sequence to structure. J Struct Biol, 2012)

16 (Pyrimad scheme) Bridge manual with predicted: Homology by sequence alignment Schematic view of the different classification levels

17 (Pyrimad scheme) ProteinZoo detailed annotation Domain assignment Tandem arrays assigned in sequence Schematic view of the different classification levels

18 (The classification tree) (V) Beads-ona-string (IV) Closed (toroids) (III) Solenoids (II) Fibrils (I) Crystalites 2nd level sub-division

19 Fibrils Solenoids Closed (toroids) Beads-ona-string Unclassified

20 ProteinZoo In Progress Fibrils Solenoids Closed (toroids) Beads-ona-string Unclassified

21 Fibrils (2 sub-classes) Closed (6 sub-classes) Solenoids (5 sub-classes) 2nd level sub-division EXAMPLES Beads-ona-string (3 sub-classes)

22 URL:

23 Tandem Arrays in Sequence Secondary Structure Insertions URL:

24 Structural Annotation URL:

25 Functions, Domains + Cross-links URL:

26 Use case: Improved homology modeling Template Hidden Markov Models (HMMs) HMM-HMM search

27 Use case: Improved homology modeling Query sequence (a repeat) Hidden Markov Model (HMM) Template Hidden Markov Models (HMMs) HMM-HMM search Often a poor model due to repeats having considerable sequence divergence for same structures.

28 Use case: Improved homology modeling Query sequence (a repeat) Hidden Markov Model (HMM) Repeat Template Hidden Markov Models (HMMs) HMM-HMM search Model Should be improved Due to more finely tuned HMMs

29 Acknowledgements Tomàs Di Domenico Dr. Emilio Potenza Dr. Giovanni Minervini (University of Padova) Funding FIRB Futuro in Ricerca Università di Padova CARIPLO CARIPARO AIRC Manuel Giollo Prof.Silvio Tosatto Dr. Awais Ihsan (Sahiwal, Pakistan) Dr. Andrey V. Kajava (CNRS Montpellier, France) Gonzalo Parra (Universidad de Buenos Aires, Argentina) URL:

Week 10: Homology Modelling (II) - HHpred

Week 10: Homology Modelling (II) - HHpred Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative

More information

Università degli Studi di Padova. Tesi di Laurea Magistrale in Ingegneria Informatica. Automatic classification of repeat proteins with Raphael

Università degli Studi di Padova. Tesi di Laurea Magistrale in Ingegneria Informatica. Automatic classification of repeat proteins with Raphael Università degli Studi di Padova Dipartimento di Ingegneria dell Informazione Tesi di Laurea Magistrale in Ingegneria Informatica Automatic classification of repeat proteins with Raphael Laureando Gabriele

More information

CISC 636 Computational Biology & Bioinformatics (Fall 2016)

CISC 636 Computational Biology & Bioinformatics (Fall 2016) CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein

More information

Some Problems from Enzyme Families

Some Problems from Enzyme Families Some Problems from Enzyme Families Greg Butler Department of Computer Science Concordia University, Montreal www.cs.concordia.ca/~faculty/gregb gregb@cs.concordia.ca Abstract I will discuss some problems

More information

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic

More information

Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department

More information

Bioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing

Bioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing Bioinformatics Proteins II. - Pattern, Profile, & Structure Database Searching Robert Latek, Ph.D. Bioinformatics, Biocomputing WIBR Bioinformatics Course, Whitehead Institute, 2002 1 Proteins I.-III.

More information

Bioinformatics. Dept. of Computational Biology & Bioinformatics

Bioinformatics. Dept. of Computational Biology & Bioinformatics Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS

More information

Overview of Research at Bioinformatics Lab

Overview of Research at Bioinformatics Lab Overview of Research at Bioinformatics Lab Li Liao Develop new algorithms and (statistical) learning methods that help solve biological problems > Capable of incorporating domain knowledge > Effective,

More information

PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES

PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES Eser Aygün 1, Caner Kömürlü 2, Zafer Aydin 3 and Zehra Çataltepe 1 1 Computer Engineering Department and 2

More information

Protein Structure Prediction using String Kernels. Technical Report

Protein Structure Prediction using String Kernels. Technical Report Protein Structure Prediction using String Kernels Technical Report Department of Computer Science and Engineering University of Minnesota 4-192 EECS Building 200 Union Street SE Minneapolis, MN 55455-0159

More information

CAP 5510 Lecture 3 Protein Structures

CAP 5510 Lecture 3 Protein Structures CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity

More information

Hidden Markov Models

Hidden Markov Models Hidden Markov Models A selection of slides taken from the following: Chris Bystroff Protein Folding Initiation Site Motifs Iosif Vaisman Bioinformatics and Gene Discovery Colin Cherry Hidden Markov Models

More information

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and

More information

2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity.

2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. A global picture of the protein universe will help us to understand

More information

Introduction to Bioinformatics

Introduction to Bioinformatics CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics

More information

Computational Biology From The Perspective Of A Physical Scientist

Computational Biology From The Perspective Of A Physical Scientist Computational Biology From The Perspective Of A Physical Scientist Dr. Arthur Dong PP1@TUM 26 November 2013 Bioinformatics Education Curriculum Math, Physics, Computer Science (Statistics and Programming)

More information

Conditional Graphical Models

Conditional Graphical Models PhD Thesis Proposal Conditional Graphical Models for Protein Structure Prediction Yan Liu Language Technologies Institute University Thesis Committee Jaime Carbonell (Chair) John Lafferty Eric P. Xing

More information

Grundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson

Grundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson Grundlagen der Bioinformatik, SS 10, D. Huson, April 12, 2010 1 1 Introduction Grundlagen der Bioinformatik Summer semester 2010 Lecturer: Prof. Daniel Huson Office hours: Thursdays 17-18h (Sand 14, C310a)

More information

Information Extraction from Text

Information Extraction from Text Information Extraction from Text Jing Jiang Chapter 2 from Mining Text Data (2012) Presented by Andrew Landgraf, September 13, 2013 1 What is Information Extraction? Goal is to discover structured information

More information

Hidden Markov Models in computational biology. Ron Elber Computer Science Cornell

Hidden Markov Models in computational biology. Ron Elber Computer Science Cornell Hidden Markov Models in computational biology Ron Elber Computer Science Cornell 1 Or: how to fish homolog sequences from a database Many sequences in database RPOBESEQ Partitioned data base 2 An accessible

More information

Computational Molecular Biology (

Computational Molecular Biology ( Computational Molecular Biology (http://cmgm cmgm.stanford.edu/biochem218/) Biochemistry 218/Medical Information Sciences 231 Douglas L. Brutlag, Lee Kozar Jimmy Huang, Josh Silverman Lecture Syllabus

More information

COMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University

COMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018

More information

Computational Biology: Basics & Interesting Problems

Computational Biology: Basics & Interesting Problems Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information

More information

Introduction to Comparative Protein Modeling. Chapter 4 Part I

Introduction to Comparative Protein Modeling. Chapter 4 Part I Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature

More information

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings

More information

CS612 - Algorithms in Bioinformatics

CS612 - Algorithms in Bioinformatics Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available

More information

Protein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1

Protein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1 Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2

More information

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan

CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs15.html Describing & Modeling Patterns

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture

More information

Template Free Protein Structure Modeling Jianlin Cheng, PhD

Template Free Protein Structure Modeling Jianlin Cheng, PhD Template Free Protein Structure Modeling Jianlin Cheng, PhD Professor Department of EECS Informatics Institute University of Missouri, Columbia 2018 Protein Energy Landscape & Free Sampling http://pubs.acs.org/subscribe/archive/mdd/v03/i09/html/willis.html

More information

Large-Scale Genomic Surveys

Large-Scale Genomic Surveys Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction

More information

Multiple sequence alignment

Multiple sequence alignment Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple

More information

STRUCTURAL BIOINFORMATICS I. Fall 2015

STRUCTURAL BIOINFORMATICS I. Fall 2015 STRUCTURAL BIOINFORMATICS I Fall 2015 Info Course Number - Classification: Biology 5411 Class Schedule: Monday 5:30-7:50 PM, SERC Room 456 (4 th floor) Instructors: Vincenzo Carnevale - SERC, Room 704C;

More information

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major

More information

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding

More information

Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program)

Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program) Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program) Course Name: Structural Bioinformatics Course Description: Instructor: This course introduces fundamental concepts and methods for structural

More information

Supporting Text 1. Comparison of GRoSS sequence alignment to HMM-HMM and GPCRDB

Supporting Text 1. Comparison of GRoSS sequence alignment to HMM-HMM and GPCRDB Structure-Based Sequence Alignment of the Transmembrane Domains of All Human GPCRs: Phylogenetic, Structural and Functional Implications, Cvicek et al. Supporting Text 1 Here we compare the GRoSS alignment

More information

How much non-coding DNA do eukaryotes require?

How much non-coding DNA do eukaryotes require? How much non-coding DNA do eukaryotes require? Andrei Zinovyev UMR U900 Computational Systems Biology of Cancer Institute Curie/INSERM/Ecole de Mine Paritech Dr. Sebastian Ahnert Dr. Thomas Fink Bioinformatics

More information

CSCE555 Bioinformatics. Protein Function Annotation

CSCE555 Bioinformatics. Protein Function Annotation CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The

More information

Outline. Sequence-comparison methods. Buzzzzzzzz. Why compare sequences? Gerard Kleywegt Uppsala University

Outline. Sequence-comparison methods. Buzzzzzzzz. Why compare sequences? Gerard Kleywegt Uppsala University MB330 - January, 2006 Sequence-comparison methods erard Kleywegt Uppsala University Outline! Why compare sequences?! Dotplots! airwise sequence alignments &! Multiple sequence alignments! rofile methods!

More information

Homology Modeling. Roberto Lins EPFL - summer semester 2005

Homology Modeling. Roberto Lins EPFL - summer semester 2005 Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,

More information

Basics of protein structure

Basics of protein structure Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu

More information

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL

More information

Computational Genomics. Reconstructing dynamic regulatory networks in multiple species

Computational Genomics. Reconstructing dynamic regulatory networks in multiple species 02-710 Computational Genomics Reconstructing dynamic regulatory networks in multiple species Methods for reconstructing networks in cells CRH1 SLT2 SLR3 YPS3 YPS1 Amit et al Science 2009 Pe er et al Recomb

More information

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK

More information

1-D Predictions. Prediction of local features: Secondary structure & surface exposure

1-D Predictions. Prediction of local features: Secondary structure & surface exposure 1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local

More information

December 2, :4 WSPC/INSTRUCTION FILE jbcb-profile-kernel. Profile-based string kernels for remote homology detection and motif extraction

December 2, :4 WSPC/INSTRUCTION FILE jbcb-profile-kernel. Profile-based string kernels for remote homology detection and motif extraction Journal of Bioinformatics and Computational Biology c Imperial College Press Profile-based string kernels for remote homology detection and motif extraction Rui Kuang 1, Eugene Ie 1,3, Ke Wang 1, Kai Wang

More information

HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM

HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM I529: Machine Learning in Bioinformatics (Spring 2017) HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University, Bloomington

More information

DATA ACQUISITION FROM BIO-DATABASES AND BLAST. Natapol Pornputtapong 18 January 2018

DATA ACQUISITION FROM BIO-DATABASES AND BLAST. Natapol Pornputtapong 18 January 2018 DATA ACQUISITION FROM BIO-DATABASES AND BLAST Natapol Pornputtapong 18 January 2018 DATABASE Collections of data To share multi-user interface To prevent data loss To make sure to get the right things

More information

Genome Annotation. Qi Sun Bioinformatics Facility Cornell University

Genome Annotation. Qi Sun Bioinformatics Facility Cornell University Genome Annotation Qi Sun Bioinformatics Facility Cornell University Some basic bioinformatics tools BLAST PSI-BLAST - Position-Specific Scoring Matrix HMM - Hidden Markov Model NCBI BLAST How does BLAST

More information

Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics

Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia

More information

Motif Prediction in Amino Acid Interaction Networks

Motif Prediction in Amino Acid Interaction Networks Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions

More information

Amino Acid Structures from Klug & Cummings. Bioinformatics (Lec 12)

Amino Acid Structures from Klug & Cummings. Bioinformatics (Lec 12) Amino Acid Structures from Klug & Cummings 2/17/05 1 Amino Acid Structures from Klug & Cummings 2/17/05 2 Amino Acid Structures from Klug & Cummings 2/17/05 3 Amino Acid Structures from Klug & Cummings

More information

Variable-Length Protein Sequence Motif Extraction Using Hierarchically-Clustered Hidden Markov Models

Variable-Length Protein Sequence Motif Extraction Using Hierarchically-Clustered Hidden Markov Models 2013 12th International Conference on Machine Learning and Applications Variable-Length Protein Sequence Motif Extraction Using Hierarchically-Clustered Hidden Markov Models Cody Hudson, Bernard Chen Department

More information

Computational methods for predicting protein-protein interactions

Computational methods for predicting protein-protein interactions Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational

More information

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

Model Accuracy Measures

Model Accuracy Measures Model Accuracy Measures Master in Bioinformatics UPF 2017-2018 Eduardo Eyras Computational Genomics Pompeu Fabra University - ICREA Barcelona, Spain Variables What we can measure (attributes) Hypotheses

More information

Reconstructing Amino Acid Interaction Networks by an Ant Colony Approach

Reconstructing Amino Acid Interaction Networks by an Ant Colony Approach Author manuscript, published in "Journal of Computational Intelligence in Bioinformatics 2, 2 (2009) 131-146" Reconstructing Amino Acid Interaction Networks by an Ant Colony Approach Omar GACI and Stefan

More information

Radial Basis Function Neural Networks in Protein Sequence Classification ABSTRACT

Radial Basis Function Neural Networks in Protein Sequence Classification ABSTRACT (): 195-04 (008) Radial Basis Function Neural Networks in Protein Sequence Classification Zarita Zainuddin and Maragatham Kumar School of Mathematical Sciences, University Science Malaysia, 11800 USM Pulau

More information

IMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS

IMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS IMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS Aslı Filiz 1, Eser Aygün 2, Özlem Keskin 3 and Zehra Cataltepe 2 1 Informatics Institute and 2 Computer Engineering Department,

More information

Phylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign

Phylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign Phylogenomics, Multiple Sequence Alignment, and Metagenomics Tandy Warnow University of Illinois at Urbana-Champaign Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the

More information

Prediction of protein function from sequence analysis

Prediction of protein function from sequence analysis Prediction of protein function from sequence analysis Rita Casadio BIOCOMPUTING GROUP University of Bologna, Italy The omic era Genome Sequencing Projects: Archaea: 74 species In Progress:52 Bacteria:

More information

Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010

Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010 Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010 1 New genomes (and metagenomes) sequenced every day... 2 3 3 3 3 3 3 3 3 3 Computational

More information

3/1/17. Content. TWINSCAN model. Example. TWINSCAN algorithm. HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM

3/1/17. Content. TWINSCAN model. Example. TWINSCAN algorithm. HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM I529: Machine Learning in Bioinformatics (Spring 2017) Content HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University,

More information

Chemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller

Chemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller Chemogenomic: Approaches to Rational Drug Design Jonas Skjødt Møller Chemogenomic Chemistry Biology Chemical biology Medical chemistry Chemical genetics Chemoinformatics Bioinformatics Chemoproteomics

More information

Molecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007

Molecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007 Molecular Modeling Prediction of Protein 3D Structure from Sequence Vimalkumar Velayudhan Jain Institute of Vocational and Advanced Studies May 21, 2007 Vimalkumar Velayudhan Molecular Modeling 1/23 Outline

More information

PREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS

PREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS PREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS T. Z. SEN, A. KLOCZKOWSKI, R. L. JERNIGAN L.H. Baker Center for Bioinformatics and Biological Statistics, Iowa State University Ames, IA

More information

EBI web resources II: Ensembl and InterPro

EBI web resources II: Ensembl and InterPro EBI web resources II: Ensembl and InterPro Yanbin Yin http://www.ebi.ac.uk/training/online/course/ 1 Homework 3 Go to http://www.ebi.ac.uk/interpro/training.htmland finish the second online training course

More information

The Homology Kernel: A Biologically Motivated Sequence Embedding into Euclidean Space

The Homology Kernel: A Biologically Motivated Sequence Embedding into Euclidean Space The Homology Kernel: A Biologically Motivated Sequence Embedding into Euclidean Space Eleazar Eskin Department of Computer Science Engineering University of California, San Diego eeskin@cs.ucsd.edu Sagi

More information

Protein Structure Prediction and Display

Protein Structure Prediction and Display Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2011 1 HMM Lecture Notes Dannie Durand and Rose Hoberman October 11th 1 Hidden Markov Models In the last few lectures, we have focussed on three problems

More information

Proteins: Structure & Function. Ulf Leser

Proteins: Structure & Function. Ulf Leser Proteins: Structure & Function Ulf Leser This Lecture Proteins Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding

More information

Computational Systems Biology

Computational Systems Biology Computational Systems Biology Vasant Honavar Artificial Intelligence Research Laboratory Bioinformatics and Computational Biology Graduate Program Center for Computational Intelligence, Learning, & Discovery

More information

networks in molecular biology Wolfgang Huber

networks in molecular biology Wolfgang Huber networks in molecular biology Wolfgang Huber networks in molecular biology Regulatory networks: components = gene products interactions = regulation of transcription, translation, phosphorylation... Metabolic

More information

Efficient Remote Homology Detection with Secondary Structure

Efficient Remote Homology Detection with Secondary Structure Efficient Remote Homology Detection with Secondary Structure 2 Yuna Hou 1, Wynne Hsu 1, Mong Li Lee 1, and Christopher Bystroff 2 1 School of Computing,National University of Singapore,Singapore 117543

More information

Sequence Alignment Techniques and Their Uses

Sequence Alignment Techniques and Their Uses Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this

More information

RNA Protein Interaction

RNA Protein Interaction Introduction RN binding in detail structural analysis Examples RN Protein Interaction xel Wintsche February 16, 2009 xel Wintsche RN Protein Interaction Introduction RN binding in detail structural analysis

More information

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major

More information

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki. Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein

More information

Detection of Protein Binding Sites II

Detection of Protein Binding Sites II Detection of Protein Binding Sites II Goal: Given a protein structure, predict where a ligand might bind Thomas Funkhouser Princeton University CS597A, Fall 2007 1hld Geometric, chemical, evolutionary

More information

Human Mobility Pattern Prediction Algorithm using Mobile Device Location and Time Data

Human Mobility Pattern Prediction Algorithm using Mobile Device Location and Time Data Human Mobility Pattern Prediction Algorithm using Mobile Device Location and Time Data 0. Notations Myungjun Choi, Yonghyun Ro, Han Lee N = number of states in the model T = length of observation sequence

More information

RNA Search and! Motif Discovery" Genome 541! Intro to Computational! Molecular Biology"

RNA Search and! Motif Discovery Genome 541! Intro to Computational! Molecular Biology RNA Search and! Motif Discovery" Genome 541! Intro to Computational! Molecular Biology" Day 1" Many biologically interesting roles for RNA" RNA secondary structure prediction" 3 4 Approaches to Structure

More information

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value

More information

A New Similarity Measure among Protein Sequences

A New Similarity Measure among Protein Sequences A New Similarity Measure among Protein Sequences Kuen-Pin Wu, Hsin-Nan Lin, Ting-Yi Sung and Wen-Lian Hsu * Institute of Information Science Academia Sinica, Taipei 115, Taiwan Abstract Protein sequence

More information

STRUCTURAL BIOINFORMATICS II. Spring 2018

STRUCTURAL BIOINFORMATICS II. Spring 2018 STRUCTURAL BIOINFORMATICS II Spring 2018 Syllabus Course Number - Classification: Chemistry 5412 Class Schedule: Monday 5:30-7:50 PM, SERC Room 456 (4 th floor) Instructors: Ronald Levy, SERC 718 (ronlevy@temple.edu)

More information

Prediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines

Prediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines Article Prediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines Yun-Fei Wang, Huan Chen, and Yan-Hong Zhou* Hubei Bioinformatics and Molecular Imaging Key Laboratory,

More information

Predicting Protein Functions and Domain Interactions from Protein Interactions

Predicting Protein Functions and Domain Interactions from Protein Interactions Predicting Protein Functions and Domain Interactions from Protein Interactions Fengzhu Sun, PhD Center for Computational and Experimental Genomics University of Southern California Outline High-throughput

More information

Combining pairwise sequence similarity and support vector machines for remote protein homology detection

Combining pairwise sequence similarity and support vector machines for remote protein homology detection Combining pairwise sequence similarity and support vector machines for remote protein homology detection Li Liao Central Research & Development E. I. du Pont de Nemours Company li.liao@usa.dupont.com William

More information

Bioinformatics. Macromolecular structure

Bioinformatics. Macromolecular structure Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure Structure analysis Structure alignment Domain

More information

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded

More information

Jessica Wehner. Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008

Jessica Wehner. Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008 Journal Club Jessica Wehner Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008 Comparison of Probabilistic Combination Methods for Protein Secondary Structure

More information

Bioinformatics 2 - Lecture 4

Bioinformatics 2 - Lecture 4 Bioinformatics 2 - Lecture 4 Guido Sanguinetti School of Informatics University of Edinburgh February 14, 2011 Sequences Many data types are ordered, i.e. you can naturally say what is before and what

More information

#33 - Genomics 11/09/07

#33 - Genomics 11/09/07 BCB 444/544 Required Reading (before lecture) Lecture 33 Mon Nov 5 - Lecture 31 Phylogenetics Parsimony and ML Chp 11 - pp 142 169 Genomics Wed Nov 7 - Lecture 32 Machine Learning Fri Nov 9 - Lecture 33

More information

MBLG lecture 5. The EGG! Visualising Molecules. Dr. Dale Hancock Lab 715

MBLG lecture 5. The EGG! Visualising Molecules. Dr. Dale Hancock Lab 715 MBLG lecture 5 Dr. Dale Hancock D.Hancock@mmb.usyd.edu.au Lab 715 The EGG! Visualising Molecules In molecular biology and biochemistry it is better to view molecules as killer pythons rather than smarties.

More information

Bioinformatics in Neurocomputing Framework

Bioinformatics in Neurocomputing Framework Bioinformatics in Neurocomputing Framework Shubhra Sankar Ray, Sanghamitra Bandyopadhyay, Pabitra Mitra and Sankar K. Pal Machine Intelligence Unit, Indian Statistical Institute, Kolkata 700108 Email:

More information

Domain-based computational approaches to understand the molecular basis of diseases

Domain-based computational approaches to understand the molecular basis of diseases Domain-based computational approaches to understand the molecular basis of diseases Dr. Maricel G. Kann Assistant Professor Dept of Biological Sciences UMBC http://bioinf.umbc.edu Research at Kann s Lab.

More information

MATHEMATICAL MODELS - Vol. III - Mathematical Modeling and the Human Genome - Hilary S. Booth MATHEMATICAL MODELING AND THE HUMAN GENOME

MATHEMATICAL MODELS - Vol. III - Mathematical Modeling and the Human Genome - Hilary S. Booth MATHEMATICAL MODELING AND THE HUMAN GENOME MATHEMATICAL MODELING AND THE HUMAN GENOME Hilary S. Booth Australian National University, Australia Keywords: Human genome, DNA, bioinformatics, sequence analysis, evolution. Contents 1. Introduction:

More information

Subfamily HMMS in Functional Genomics. D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander

Subfamily HMMS in Functional Genomics. D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander Subfamily HMMS in Functional Genomics D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander Pacific Symposium on Biocomputing 10:322-333(2005) SUBFAMILY HMMS IN FUNCTIONAL GENOMICS DUNCAN

More information

Inferring Transcriptional Regulatory Networks from Gene Expression Data II

Inferring Transcriptional Regulatory Networks from Gene Expression Data II Inferring Transcriptional Regulatory Networks from Gene Expression Data II Lectures 9 Oct 26, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday

More information