Mining and classification of repeat protein structures
|
|
- Jessie Patrick
- 5 years ago
- Views:
Transcription
1 Mining and classification of repeat protein structures Ian Walsh Ph.D. BioComputing UP, Department of Biology, University of Padova, Italy URL:
2 Repeat proteins Why are they important? Ribonuclease inhibitor Abundant in nature: Cell regulation Transcriptional control Nervous system roles Protein transport Disease: Neurodegenerative and infectious disease PDB code: 1z7x_W
3 Repeat proteins Why are they important? Abundant in nature: Cell regulation Transcriptional control Nervous system roles Protein transport Disease: Neurodegenerative and infectious disease Very modular Repeating structural motifs Good for protein design Bad for homology modeling
4 Example: Why do we need a dedicated resource? PDB code: 3oja_A
5 Goal Dedicated repeat resource Protein Data Bank: is great for collecting info on all structures Repeats Data Bank (annotation steps): 1. Extract repeat structures from PDB Repeats 2. Identify repeating domains and classify 3. Split repeats into tandem arrays 4. Publicly available Data Bank
6 RAPHAEL (Walsh, et al. Bioinformatics, 28: , 2012) Idea: Discriminates repeat from globular structures Algorithm: Identify periodic changes in 3D coordinates Geometry Machine learning Periodic variance (A) Repeat protein Leucine-rich Effector protein (PDB code 1JL5) (B) Globular Sulfhydryl protease (PDB code 9PAP).
7 RAPHAEL results: Detection Large improvement Vs. sequence detectors ROC curve on the combined training and test set. RAPHAEL trained using the leave one out split is compared to four other methods. The curve ends when a method does not produce further output, i.e. believes to have found all solenoids.
8 RAPHAEL- Period Number of residues in each repeating unit Derived from distance frequencies: Accurate period calculation Accuracy = 90% within 5 residues 20 residues
9 RAPHAEL- Insertions Non-periodic parts Derivation: deviations from period Not all repeat detection easy Example of insertions for a β-solenoid.
10 ProteinZoo Invites people to assist in the classification of large protein numbers Crowd Science Large repeat protein set Large amount of people + In-house software annotation tools Classification Level. Consensus Detailed Level Consensus
11 Annotation with ProteinZoo RAPHAEL MINING Repeats Predicted Period Predicted insertions ProteinZoo >7,000 structures
12 (Di Domenico, et al. Nucl. Acids Res., accepted) RepeatsDB is a collaborative database of repeat proteins. It builds on the results of RAPHAEL, and leverages manual curation to provide a high quality gold standard of repeat protein annotations. In collaboration with: Dr. Andrey V. Kajava (CNRS Montpellier) Giant RNA twister (TAL effector, PDB: 4gjr) Propeller with spare part (Proteasome regulatory particle, PDB: 3acp) Dr. Diego U. Ferreiro (Universidad de Buenos Aires)
13 Schematic view of the different classification levels (Pyrimad scheme)
14 (Pyrimad scheme) RAPHAEL Mining Schematic view of the different classification levels
15 (Pyrimad scheme) ProteinZoo basic classification (Tree) Schematic view of the different classification levels Based on a scheme previously proposed (Kajava A.V., Tandem repeats in proteins: From sequence to structure. J Struct Biol, 2012)
16 (Pyrimad scheme) Bridge manual with predicted: Homology by sequence alignment Schematic view of the different classification levels
17 (Pyrimad scheme) ProteinZoo detailed annotation Domain assignment Tandem arrays assigned in sequence Schematic view of the different classification levels
18 (The classification tree) (V) Beads-ona-string (IV) Closed (toroids) (III) Solenoids (II) Fibrils (I) Crystalites 2nd level sub-division
19 Fibrils Solenoids Closed (toroids) Beads-ona-string Unclassified
20 ProteinZoo In Progress Fibrils Solenoids Closed (toroids) Beads-ona-string Unclassified
21 Fibrils (2 sub-classes) Closed (6 sub-classes) Solenoids (5 sub-classes) 2nd level sub-division EXAMPLES Beads-ona-string (3 sub-classes)
22 URL:
23 Tandem Arrays in Sequence Secondary Structure Insertions URL:
24 Structural Annotation URL:
25 Functions, Domains + Cross-links URL:
26 Use case: Improved homology modeling Template Hidden Markov Models (HMMs) HMM-HMM search
27 Use case: Improved homology modeling Query sequence (a repeat) Hidden Markov Model (HMM) Template Hidden Markov Models (HMMs) HMM-HMM search Often a poor model due to repeats having considerable sequence divergence for same structures.
28 Use case: Improved homology modeling Query sequence (a repeat) Hidden Markov Model (HMM) Repeat Template Hidden Markov Models (HMMs) HMM-HMM search Model Should be improved Due to more finely tuned HMMs
29 Acknowledgements Tomàs Di Domenico Dr. Emilio Potenza Dr. Giovanni Minervini (University of Padova) Funding FIRB Futuro in Ricerca Università di Padova CARIPLO CARIPARO AIRC Manuel Giollo Prof.Silvio Tosatto Dr. Awais Ihsan (Sahiwal, Pakistan) Dr. Andrey V. Kajava (CNRS Montpellier, France) Gonzalo Parra (Universidad de Buenos Aires, Argentina) URL:
Week 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
More informationUniversità degli Studi di Padova. Tesi di Laurea Magistrale in Ingegneria Informatica. Automatic classification of repeat proteins with Raphael
Università degli Studi di Padova Dipartimento di Ingegneria dell Informazione Tesi di Laurea Magistrale in Ingegneria Informatica Automatic classification of repeat proteins with Raphael Laureando Gabriele
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein
More informationSome Problems from Enzyme Families
Some Problems from Enzyme Families Greg Butler Department of Computer Science Concordia University, Montreal www.cs.concordia.ca/~faculty/gregb gregb@cs.concordia.ca Abstract I will discuss some problems
More informationStatistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic
More informationStatistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department
More informationBioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing
Bioinformatics Proteins II. - Pattern, Profile, & Structure Database Searching Robert Latek, Ph.D. Bioinformatics, Biocomputing WIBR Bioinformatics Course, Whitehead Institute, 2002 1 Proteins I.-III.
More informationBioinformatics. Dept. of Computational Biology & Bioinformatics
Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS
More informationOverview of Research at Bioinformatics Lab
Overview of Research at Bioinformatics Lab Li Liao Develop new algorithms and (statistical) learning methods that help solve biological problems > Capable of incorporating domain knowledge > Effective,
More informationPROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES
PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES Eser Aygün 1, Caner Kömürlü 2, Zafer Aydin 3 and Zehra Çataltepe 1 1 Computer Engineering Department and 2
More informationProtein Structure Prediction using String Kernels. Technical Report
Protein Structure Prediction using String Kernels Technical Report Department of Computer Science and Engineering University of Minnesota 4-192 EECS Building 200 Union Street SE Minneapolis, MN 55455-0159
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationHidden Markov Models
Hidden Markov Models A selection of slides taken from the following: Chris Bystroff Protein Folding Initiation Site Motifs Iosif Vaisman Bioinformatics and Gene Discovery Colin Cherry Hidden Markov Models
More informationChapter 5. Proteomics and the analysis of protein sequence Ⅱ
Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and
More information2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity.
Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. A global picture of the protein universe will help us to understand
More informationIntroduction to Bioinformatics
CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics
More informationComputational Biology From The Perspective Of A Physical Scientist
Computational Biology From The Perspective Of A Physical Scientist Dr. Arthur Dong PP1@TUM 26 November 2013 Bioinformatics Education Curriculum Math, Physics, Computer Science (Statistics and Programming)
More informationConditional Graphical Models
PhD Thesis Proposal Conditional Graphical Models for Protein Structure Prediction Yan Liu Language Technologies Institute University Thesis Committee Jaime Carbonell (Chair) John Lafferty Eric P. Xing
More informationGrundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson
Grundlagen der Bioinformatik, SS 10, D. Huson, April 12, 2010 1 1 Introduction Grundlagen der Bioinformatik Summer semester 2010 Lecturer: Prof. Daniel Huson Office hours: Thursdays 17-18h (Sand 14, C310a)
More informationInformation Extraction from Text
Information Extraction from Text Jing Jiang Chapter 2 from Mining Text Data (2012) Presented by Andrew Landgraf, September 13, 2013 1 What is Information Extraction? Goal is to discover structured information
More informationHidden Markov Models in computational biology. Ron Elber Computer Science Cornell
Hidden Markov Models in computational biology Ron Elber Computer Science Cornell 1 Or: how to fish homolog sequences from a database Many sequences in database RPOBESEQ Partitioned data base 2 An accessible
More informationComputational Molecular Biology (
Computational Molecular Biology (http://cmgm cmgm.stanford.edu/biochem218/) Biochemistry 218/Medical Information Sciences 231 Douglas L. Brutlag, Lee Kozar Jimmy Huang, Josh Silverman Lecture Syllabus
More informationCOMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University
COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018
More informationComputational Biology: Basics & Interesting Problems
Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationAmino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1
Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings
More informationCS612 - Algorithms in Bioinformatics
Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available
More informationProtein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1
Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs15.html Describing & Modeling Patterns
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison
CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture
More informationTemplate Free Protein Structure Modeling Jianlin Cheng, PhD
Template Free Protein Structure Modeling Jianlin Cheng, PhD Professor Department of EECS Informatics Institute University of Missouri, Columbia 2018 Protein Energy Landscape & Free Sampling http://pubs.acs.org/subscribe/archive/mdd/v03/i09/html/willis.html
More informationLarge-Scale Genomic Surveys
Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction
More informationMultiple sequence alignment
Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple
More informationSTRUCTURAL BIOINFORMATICS I. Fall 2015
STRUCTURAL BIOINFORMATICS I Fall 2015 Info Course Number - Classification: Biology 5411 Class Schedule: Monday 5:30-7:50 PM, SERC Room 456 (4 th floor) Instructors: Vincenzo Carnevale - SERC, Room 704C;
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationHMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder
HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding
More informationSyllabus of BIOINF 528 (2017 Fall, Bioinformatics Program)
Syllabus of BIOINF 528 (2017 Fall, Bioinformatics Program) Course Name: Structural Bioinformatics Course Description: Instructor: This course introduces fundamental concepts and methods for structural
More informationSupporting Text 1. Comparison of GRoSS sequence alignment to HMM-HMM and GPCRDB
Structure-Based Sequence Alignment of the Transmembrane Domains of All Human GPCRs: Phylogenetic, Structural and Functional Implications, Cvicek et al. Supporting Text 1 Here we compare the GRoSS alignment
More informationHow much non-coding DNA do eukaryotes require?
How much non-coding DNA do eukaryotes require? Andrei Zinovyev UMR U900 Computational Systems Biology of Cancer Institute Curie/INSERM/Ecole de Mine Paritech Dr. Sebastian Ahnert Dr. Thomas Fink Bioinformatics
More informationCSCE555 Bioinformatics. Protein Function Annotation
CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The
More informationOutline. Sequence-comparison methods. Buzzzzzzzz. Why compare sequences? Gerard Kleywegt Uppsala University
MB330 - January, 2006 Sequence-comparison methods erard Kleywegt Uppsala University Outline! Why compare sequences?! Dotplots! airwise sequence alignments &! Multiple sequence alignments! rofile methods!
More informationHomology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationComputational Genomics. Reconstructing dynamic regulatory networks in multiple species
02-710 Computational Genomics Reconstructing dynamic regulatory networks in multiple species Methods for reconstructing networks in cells CRH1 SLT2 SLR3 YPS3 YPS1 Amit et al Science 2009 Pe er et al Recomb
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More information1-D Predictions. Prediction of local features: Secondary structure & surface exposure
1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local
More informationDecember 2, :4 WSPC/INSTRUCTION FILE jbcb-profile-kernel. Profile-based string kernels for remote homology detection and motif extraction
Journal of Bioinformatics and Computational Biology c Imperial College Press Profile-based string kernels for remote homology detection and motif extraction Rui Kuang 1, Eugene Ie 1,3, Ke Wang 1, Kai Wang
More informationHMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM
I529: Machine Learning in Bioinformatics (Spring 2017) HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University, Bloomington
More informationDATA ACQUISITION FROM BIO-DATABASES AND BLAST. Natapol Pornputtapong 18 January 2018
DATA ACQUISITION FROM BIO-DATABASES AND BLAST Natapol Pornputtapong 18 January 2018 DATABASE Collections of data To share multi-user interface To prevent data loss To make sure to get the right things
More informationGenome Annotation. Qi Sun Bioinformatics Facility Cornell University
Genome Annotation Qi Sun Bioinformatics Facility Cornell University Some basic bioinformatics tools BLAST PSI-BLAST - Position-Specific Scoring Matrix HMM - Hidden Markov Model NCBI BLAST How does BLAST
More informationStatistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics
Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia
More informationMotif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
More informationAmino Acid Structures from Klug & Cummings. Bioinformatics (Lec 12)
Amino Acid Structures from Klug & Cummings 2/17/05 1 Amino Acid Structures from Klug & Cummings 2/17/05 2 Amino Acid Structures from Klug & Cummings 2/17/05 3 Amino Acid Structures from Klug & Cummings
More informationVariable-Length Protein Sequence Motif Extraction Using Hierarchically-Clustered Hidden Markov Models
2013 12th International Conference on Machine Learning and Applications Variable-Length Protein Sequence Motif Extraction Using Hierarchically-Clustered Hidden Markov Models Cody Hudson, Bernard Chen Department
More informationComputational methods for predicting protein-protein interactions
Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More informationModel Accuracy Measures
Model Accuracy Measures Master in Bioinformatics UPF 2017-2018 Eduardo Eyras Computational Genomics Pompeu Fabra University - ICREA Barcelona, Spain Variables What we can measure (attributes) Hypotheses
More informationReconstructing Amino Acid Interaction Networks by an Ant Colony Approach
Author manuscript, published in "Journal of Computational Intelligence in Bioinformatics 2, 2 (2009) 131-146" Reconstructing Amino Acid Interaction Networks by an Ant Colony Approach Omar GACI and Stefan
More informationRadial Basis Function Neural Networks in Protein Sequence Classification ABSTRACT
(): 195-04 (008) Radial Basis Function Neural Networks in Protein Sequence Classification Zarita Zainuddin and Maragatham Kumar School of Mathematical Sciences, University Science Malaysia, 11800 USM Pulau
More informationIMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS
IMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS Aslı Filiz 1, Eser Aygün 2, Özlem Keskin 3 and Zehra Cataltepe 2 1 Informatics Institute and 2 Computer Engineering Department,
More informationPhylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign
Phylogenomics, Multiple Sequence Alignment, and Metagenomics Tandy Warnow University of Illinois at Urbana-Champaign Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the
More informationPrediction of protein function from sequence analysis
Prediction of protein function from sequence analysis Rita Casadio BIOCOMPUTING GROUP University of Bologna, Italy The omic era Genome Sequencing Projects: Archaea: 74 species In Progress:52 Bacteria:
More informationAnnotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010
Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010 1 New genomes (and metagenomes) sequenced every day... 2 3 3 3 3 3 3 3 3 3 Computational
More information3/1/17. Content. TWINSCAN model. Example. TWINSCAN algorithm. HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM
I529: Machine Learning in Bioinformatics (Spring 2017) Content HMM for modeling aligned multiple sequences: phylo-hmm & multivariate HMM Yuzhen Ye School of Informatics and Computing Indiana University,
More informationChemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller
Chemogenomic: Approaches to Rational Drug Design Jonas Skjødt Møller Chemogenomic Chemistry Biology Chemical biology Medical chemistry Chemical genetics Chemoinformatics Bioinformatics Chemoproteomics
More informationMolecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007
Molecular Modeling Prediction of Protein 3D Structure from Sequence Vimalkumar Velayudhan Jain Institute of Vocational and Advanced Studies May 21, 2007 Vimalkumar Velayudhan Molecular Modeling 1/23 Outline
More informationPREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS
PREDICTION OF PROTEIN BINDING SITES BY COMBINING SEVERAL METHODS T. Z. SEN, A. KLOCZKOWSKI, R. L. JERNIGAN L.H. Baker Center for Bioinformatics and Biological Statistics, Iowa State University Ames, IA
More informationEBI web resources II: Ensembl and InterPro
EBI web resources II: Ensembl and InterPro Yanbin Yin http://www.ebi.ac.uk/training/online/course/ 1 Homework 3 Go to http://www.ebi.ac.uk/interpro/training.htmland finish the second online training course
More informationThe Homology Kernel: A Biologically Motivated Sequence Embedding into Euclidean Space
The Homology Kernel: A Biologically Motivated Sequence Embedding into Euclidean Space Eleazar Eskin Department of Computer Science Engineering University of California, San Diego eeskin@cs.ucsd.edu Sagi
More informationProtein Structure Prediction and Display
Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2011 1 HMM Lecture Notes Dannie Durand and Rose Hoberman October 11th 1 Hidden Markov Models In the last few lectures, we have focussed on three problems
More informationProteins: Structure & Function. Ulf Leser
Proteins: Structure & Function Ulf Leser This Lecture Proteins Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding
More informationComputational Systems Biology
Computational Systems Biology Vasant Honavar Artificial Intelligence Research Laboratory Bioinformatics and Computational Biology Graduate Program Center for Computational Intelligence, Learning, & Discovery
More informationnetworks in molecular biology Wolfgang Huber
networks in molecular biology Wolfgang Huber networks in molecular biology Regulatory networks: components = gene products interactions = regulation of transcription, translation, phosphorylation... Metabolic
More informationEfficient Remote Homology Detection with Secondary Structure
Efficient Remote Homology Detection with Secondary Structure 2 Yuna Hou 1, Wynne Hsu 1, Mong Li Lee 1, and Christopher Bystroff 2 1 School of Computing,National University of Singapore,Singapore 117543
More informationSequence Alignment Techniques and Their Uses
Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this
More informationRNA Protein Interaction
Introduction RN binding in detail structural analysis Examples RN Protein Interaction xel Wintsche February 16, 2009 xel Wintsche RN Protein Interaction Introduction RN binding in detail structural analysis
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationProtein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.
Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein
More informationDetection of Protein Binding Sites II
Detection of Protein Binding Sites II Goal: Given a protein structure, predict where a ligand might bind Thomas Funkhouser Princeton University CS597A, Fall 2007 1hld Geometric, chemical, evolutionary
More informationHuman Mobility Pattern Prediction Algorithm using Mobile Device Location and Time Data
Human Mobility Pattern Prediction Algorithm using Mobile Device Location and Time Data 0. Notations Myungjun Choi, Yonghyun Ro, Han Lee N = number of states in the model T = length of observation sequence
More informationRNA Search and! Motif Discovery" Genome 541! Intro to Computational! Molecular Biology"
RNA Search and! Motif Discovery" Genome 541! Intro to Computational! Molecular Biology" Day 1" Many biologically interesting roles for RNA" RNA secondary structure prediction" 3 4 Approaches to Structure
More informationBioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment
Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value
More informationA New Similarity Measure among Protein Sequences
A New Similarity Measure among Protein Sequences Kuen-Pin Wu, Hsin-Nan Lin, Ting-Yi Sung and Wen-Lian Hsu * Institute of Information Science Academia Sinica, Taipei 115, Taiwan Abstract Protein sequence
More informationSTRUCTURAL BIOINFORMATICS II. Spring 2018
STRUCTURAL BIOINFORMATICS II Spring 2018 Syllabus Course Number - Classification: Chemistry 5412 Class Schedule: Monday 5:30-7:50 PM, SERC Room 456 (4 th floor) Instructors: Ronald Levy, SERC 718 (ronlevy@temple.edu)
More informationPrediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines
Article Prediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines Yun-Fei Wang, Huan Chen, and Yan-Hong Zhou* Hubei Bioinformatics and Molecular Imaging Key Laboratory,
More informationPredicting Protein Functions and Domain Interactions from Protein Interactions
Predicting Protein Functions and Domain Interactions from Protein Interactions Fengzhu Sun, PhD Center for Computational and Experimental Genomics University of Southern California Outline High-throughput
More informationCombining pairwise sequence similarity and support vector machines for remote protein homology detection
Combining pairwise sequence similarity and support vector machines for remote protein homology detection Li Liao Central Research & Development E. I. du Pont de Nemours Company li.liao@usa.dupont.com William
More informationBioinformatics. Macromolecular structure
Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure Structure analysis Structure alignment Domain
More informationHomology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB
Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded
More informationJessica Wehner. Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008
Journal Club Jessica Wehner Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008 Comparison of Probabilistic Combination Methods for Protein Secondary Structure
More informationBioinformatics 2 - Lecture 4
Bioinformatics 2 - Lecture 4 Guido Sanguinetti School of Informatics University of Edinburgh February 14, 2011 Sequences Many data types are ordered, i.e. you can naturally say what is before and what
More information#33 - Genomics 11/09/07
BCB 444/544 Required Reading (before lecture) Lecture 33 Mon Nov 5 - Lecture 31 Phylogenetics Parsimony and ML Chp 11 - pp 142 169 Genomics Wed Nov 7 - Lecture 32 Machine Learning Fri Nov 9 - Lecture 33
More informationMBLG lecture 5. The EGG! Visualising Molecules. Dr. Dale Hancock Lab 715
MBLG lecture 5 Dr. Dale Hancock D.Hancock@mmb.usyd.edu.au Lab 715 The EGG! Visualising Molecules In molecular biology and biochemistry it is better to view molecules as killer pythons rather than smarties.
More informationBioinformatics in Neurocomputing Framework
Bioinformatics in Neurocomputing Framework Shubhra Sankar Ray, Sanghamitra Bandyopadhyay, Pabitra Mitra and Sankar K. Pal Machine Intelligence Unit, Indian Statistical Institute, Kolkata 700108 Email:
More informationDomain-based computational approaches to understand the molecular basis of diseases
Domain-based computational approaches to understand the molecular basis of diseases Dr. Maricel G. Kann Assistant Professor Dept of Biological Sciences UMBC http://bioinf.umbc.edu Research at Kann s Lab.
More informationMATHEMATICAL MODELS - Vol. III - Mathematical Modeling and the Human Genome - Hilary S. Booth MATHEMATICAL MODELING AND THE HUMAN GENOME
MATHEMATICAL MODELING AND THE HUMAN GENOME Hilary S. Booth Australian National University, Australia Keywords: Human genome, DNA, bioinformatics, sequence analysis, evolution. Contents 1. Introduction:
More informationSubfamily HMMS in Functional Genomics. D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander
Subfamily HMMS in Functional Genomics D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander Pacific Symposium on Biocomputing 10:322-333(2005) SUBFAMILY HMMS IN FUNCTIONAL GENOMICS DUNCAN
More informationInferring Transcriptional Regulatory Networks from Gene Expression Data II
Inferring Transcriptional Regulatory Networks from Gene Expression Data II Lectures 9 Oct 26, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday
More information