Cytosolic proteins NODs involved in the regulation of immune and inflammatory responses. HU Chao - feng

Size: px
Start display at page:

Download "Cytosolic proteins NODs involved in the regulation of immune and inflammatory responses. HU Chao - feng"

Transcription

1 1304 Chinese Journal of Pathophysiology 2004,20 (7) : [ ] (2004) NODs (, ) Cytosolic proteins NODs involved in the regulation of immune and inflammatory responses HU Chao - feng ( Department of Pathophysiology, Medical College of Jinan University, Guangzhou , China) A Review Nucleotide - binding oligomerization domain (NOD) proteins are members of a growing family of cytosolic factors related to the apoptosis regulator Apaf - 1 and a class of plant disease resistance pro2 teins. NOD proteins have been implicated in the induction of NF -B activity and in the activation of caspas2 es. Biochemical evidence has unraveled the role of NOD1 and NOD2 as intracellular sensors of bacterial pepti2 doglycan. Notably, genetic variation in the genes encoding the NOD proteins NOD2, cryopyrin and C TA in humans is associated with inflammatory disease or increased susceptibility to bacterial infections. NOD proteins may be involved in the recognition of microorganisms and regulation of inflammatory responses. [] NOD ; ; ; [ KEY WORDS] NOD proteins ; Inflammation ; Immunity ; Apoptosis [] R363 [] A [2 ], 1 NOD, (pattern - recognition receptors,prrs) (pathogen - associated molecular [ ] [ ] Tel : NOD,PRRs - 1 (apoptotic protease activating factor - 1, APAF - 1) [3, 4 ] ;,NOD1 NOD2, NOD patterns, PAMPs), Toll ( Toll - like, 20 APAF - 1 receptors,tlrs) PRRs NOD1 NOD TLRs NF - B 3 - N -, (effector - binding domain, EBD), [1 ],PRRs, NOD, C - ( ligand - TLRs,PAMPs, recognition domain, LRD) ( 1) NOD NOD EBD,cas2, pase (caspase - recruitment domain, CARD) pyrin (pyrin domain, PYD) - (nucleotide - binding oligomeriza2 [5,6 ] CARD PYD tion domain, NOD), NOD1 1 CARD,NOD2 2 CARDs PYD NOD DEFCAP(death effector fil2 ament - forming Ced like apoptosis protein) cryopy2

2 1305 rin PYPAFs (pyrin - containing APAF like pro2 teins) 15 NOD CARDs NF - B,, (neuronal apopto2 sis inhibitory protein, NAIP),NAIP NOD [9-11 ] IL - 1,N - 3 (interleukin - 1 beta converting en2 (baculovirus inhibitor - of - apoptosis repeats, BIRs) [7 ] (major histocompati2 bility complex, MHC) (class trans2 activator, C TA ) N - EBD NOD ( C TA CARD ),N - C TA DNA,,Caspase - 1 caspase - 9 MHC [8] NOD8 LRD CARD NOD1 caspase - 9 CARD PYD NOD,DEFCAP C - CARD APAF - 1 C - pase - 1 CARD - CARD cas2 WD - 40 (WD - 40 repeats, WDRs) [7] Fig 1 Domain structures of NOD proteins [7 ]. 1 NOD 2 NOD 211 NF - B NOD1, TLRs NOD NOD2 NF - B,; A2 PAF - 1 NF - B, NOD1 NOD2 A2 PAF - 1 LPS,(peptidoglycan, NOD C - PGN),LPS (leucine - rich repeats, LRRs),LRRs NF - B, LRRs NOD1 NOD2 NF -B, LRRs NOD NF - B,LRRs NOD,NOD1 NOD2 LRRs,NF - B : LRRs NF - B 1 2 CARDs NF - B, NOD1 NOD2 CARD NF - B NOD zyme - protease - activating factor, IPAF) cryopyrin PY2 PAF5 PYPAF7 NF -B 212 NOD, APAF - NOD1 NOD2 IPAF DEFCAP caspases, Caspase,, ;,NOD1 cas2 pase - 1, IPAF cryopyrin DEFCAP PY2 PAF5 PYPAF7 caspase - 1 [7, 12, 13 ] APAF - 1 WD - 40 c,nod APAF - 1,APAF - 1 CARD cas2 pase - 9 CARD, caspase - 9 [14 ] NOD caspases NOD,NOD,NOD caspases 3 NOD1 NOD2 NOD (disease - resistance proteins, R proteins),r,, R,NOD1 NOD2 LPS ;,NOD1 NOD2 [15 ] N - (N - acetylglucosamine, GlcNAc or G) N - (N - acetylmuramic acid, MurNac or M) (Lys),

3 1306 (diaminopimelic acid, DAP) Girardin [16 ] TLRs,,TLRs NOD HEK293T NOD1 ;NOD1 DAP GM ( Glc2 NAc - MurNac - tripeptide, GM - tripeptide),gm - L - Ala - D - Glu - mesodapchamaillard [17 ] Lys DAP NOD1 ; - (D - glutamine - diaminopimelic acid, D - Glu - DAP) NOD1 ing protein (RIP) - like interacting caspase - like apopto2,d - Glu - DAP sis - regulatory protein (CLARP ) kinase ], Girardin [16 ],NOD1 CARD - CARD, NF -B ( 2) ; GM - tripeptide NOD2 GM - tripeptide, ), RICK (muramyl dipeptide, MDP) MurNac - L - Ala - D - isogln NOD2 [29 ],D - Ala L - Ala L - isogln D - isogln, MDP NOD2 D - Glu - DAP MDP, TNF; NOD - / - MDP, D - Glu - DAP MDP, IKK,IKKIB,,IL - 1 TNF ; IL - 6 IL - 12, T T ; NOD2 4 NOD Inohara [7 ],NOD1 NOD2 LRRs, EBDs,CARDs NOD1 NOD2 - RICK[ receptor - interact2 MyD88 ( TLRs NOD1 NOD2 NF - B,RICK,NF -B [18 ] IKK / IKK / IKK( IB, IKK ),NF - B IB,RICK CARD IKK,NF -B,,, [19 ] IKK Fig 2 Signalling pathways mediated by NOD1, NOD2, IPAF and cryopyrin. 2 NOD1, NOD2, IPAF cryopyrin

4 1307 NOD ASC (apoptosis - associated speck - like protein containing a caspase recruitment do2 main),asc N - PYD, C - [26 ] CARDASC PYD NOD, cryopyrinpypaf5 PYPAF7 CARD IPAF NF - B [12, 13, 20, 21 ], ASC PYD (familial cold autoinflamma2 cryopyrin PYD,ASC CARD IPAF CARD,ASC syndrome, MWs) ; ASC RICK ( neonatal - onset multisystem inflammatory disease,,ikk NF -B, NOD [27, 28 ],cryopyrin pyrin,n - PYD,pyrin PYD ASC PYD MID, cryopyrin IPAF NF - B [20, 21 ],pyrin cryopyrin IPAF, ( 2) NOD,, NOD NOD1 NOD2,NOD 5 NOD C TA NOD2 cryopyrin 3 NOD C TA ( type bare lymphocyte syndrome, BLS),BLS, Nature Rev Immunol, 2001, 1 (2) : MHC [8 ], MHC [2 ] Inohara N, Ogura Y, Nugez G. NODs : a family of cytosolic proteins that regulate the host response to pathogens[j ]. Curr T, Opin Microbiol, 2002, 5 (1) : BLS, [3 ] Kanuka H, Sawamoto K, Inohara N, et al. HAC - 1, a Drosophila homolog of APAF - 1 and CED - 4 functions in de2 NOD2 Crohn s velopmental and radiation - induced apoptosis[j ]. Mol Cell, (Crohn s disease, CD),Hugot CD 1999, 4 (5) : NOD2,3 [4 ] Inohara N, Nunez G. The NOD : a signaling molecule that CD, : regulates apoptosis and host defense against pathogens [ J ]. (Arg702Trp Gly908Arg) (3020insC) [22-24 ] PGN MDP, 3 CD NOD2 NF - B new apoptotic signaling motif[j ]. Trends Biochem Sci, 1997, 22 (5) : ,, [6 ] Bertin K, DiStefano PS. The PYRIN domain : a novel motif found in apoptosis and inflammation proteins[j ]. Cell Death CD, Differ, 2000,7 (12) : CD, NOD2 Blau [7 ] Inohara N, Nugez G. NODS: intracellular proteins involved in (Blau syndrome, BS),BS inflammation and apoptosis[j ]. Nature Rev Immunol, 2003, CD BS 3 (5) : , [8 ] Steimle V, Otten LA, Zufferey M, et al. Complementation CD NOD2 LRRs LRRs,BS NOD2 NOD [25 ],BS NOD2 NF - B cryopyrin CIAS1, tory syndrome, FCAS), MW (Muckle - Wells NOMID) FCAS MWs NOMID cryopyrin NF -B, FCAS MWs NO2 NOD NOD TLRs NOD NOD [ ] [1 ] Medzhitov R. Toll - like receptors and innate immunity[j ]. Oncogene, 2001, 20 (44) : [5 ] Hofmann K, Bucher P, Tschopp J. The CARD domain : a cloning of an MHC class II transactivator mutated in hereditary

5 1308 MHC class II deficiency (or bare lymphocyte syndrome) [J ]. Cell, 1993, 75 (1) : [9 ] Bertin J, Nir WJ, Fischer CM, et al. Human CARD4 protein is a novel CED - 4/ APAF - 1 cell death family member that activates NF - kappa B [J ]. J Biol Chem, 1999, 274 (19) : [10 ] Inohara N, Koseki T, Del Peso L, et al. NOD1, an APAF like activator of caspase - 9 and nuclear factor - kappa B [J ]. J Biol Chem, 1999, 274 (21) : [11 ] Ogura Y, Inohara N, Benito A, et al. NOD2, a NOD1/ A2 PAF - 1 family member that is restricted to monocytes and ac2 tivates NF - kappa B[J ]. J Biol Chem, 2001, 276 (7) : [12 ] Wang L, Mangi GA, Grenier JM et al. PYPAF7, a novel PYRIN - containing APAF1 - like protein that regulates acti2 vation of NF - kappa B and caspase dependent cytokine processing[ J ]. J Biol Chem, 2002, 277 ( 33) : [13 ] Grenier J, Wang L, Mangi GA, et al. Functional screening of five PYPAF family members identifies PYPAF5 as a novel regulator of NF - kappa B and caspase - 1 [J ]. FEBS Lett, 2002, 530 (1-3) : [14 ] Hu Y, Ding L, Spencer DM, et al. WD - 40 repeat region regulates APAF - 1 self - association and procaspase - 9 acti2 vation[j ]. J Biol Chem, 1998, 273 (50) : [15 ] Royet J, Reichhart JM. Detection of peptidoglycans by NOD proteins[j ]. Trends Cell Biol, 2003, 13 (12) : [ 16 ] Girardin SE, Boneca IG, Carneiro LA, et al. NOD1 detects a unique muropeptide from gram - negative bacterial peptidogly2 can[j ]. Science, 2003, 300 (5625) : [17 ] Chamaillard M, Hashimoto M, Horie Y, et al. An essential role for NOD1 in host recognition of bacterial peptidoglycan containing diaminopimelic acid [ J ]. Nat Immunol, 2003, 4 (7) : [18 ] Kobayashi K, Inohara N, Hemadnez LD, et al, RICK/ Rip2/ CARDIAK mediates signalling for receptors of the innate and adaptive immune systems [ J ]. Nature, 2002, 416 ( 6877) : [19 ] Inohara N, Koseki T, Lin J, et al. An induced proximity model for NF - kappa B activation in the NOD1/ RICK and RIP signaling pathways[j ]. J Biol Chem, 2000, 275 (36) : [20 ] Dowds TA, Koseki T, Del Peso L, et al. Regulation of cry2 opyrin/ PYPAF1 signaling by pyrin, the familial Mediterranean fever gene product [ J ]. Biochem Biophys Res Commun, 2003, 302 (3) : [21 ] Masumoto J, Dowds TA, Schaner P, et al. ASC is an activat2 ing adaptor for NF - kappa B and caspase dependent apoptosis [ J ]. Biochem Biophys Res Commun, 2003, 303 (1) : [22 ] Ogura Y, Bonen DK, Inohara N, et al. A frameshift mutation in NOD2 associated with susceptibility to Crohn s disease[j ]. Nature, 2001, 411 (6837) : [23 ] Hugot JP, Chamaillard M, Zouali H, et al. Association of NOD2 leucine - rich repeat variants with susceptibility to Crohn s disease[j ]. Nature, 2001, 411 (6837) : [24 ] Hampe J, Cuthbert A, Croucher PJ, et al. Association be2 tween insertion mutation in NOD2 gene and Crohn s disease in German and British populations [ J ]. Lancet, 2001, 357 (9272) : [25 ] Miceli - Richard C, Lesage S, Rybojad M, et al. CARD15 mutations in Blau syndrome[j ]. Nat Genet, 2001, 29 (1) : [26 ] Chamaillard M, Philpott D, Girardin SE, et al. Gene - envi2 ronment interaction modulated by allelic heterogeneity in in2 flammatory diseases[j ]. Proc Natl Acad Sci USA, 2003, 100 (6) : [27 ] Hoffman HM, Mueller JL, Broide DH, et al. Mutation of a new gene encoding a putative pyrin - like protein causes famil2 ial cold autoinflammatory syndrome and Muckle - Wells syn2 drome[j ]. Nat Genet, 2001, 29 (3) : [28 ] Aksentijevich I, Nowak M, Mallah M, et al. De novo CIAS1 mutations, cytokine activation, and evidence for genetic het2 erogeneity in patients with neonatal - onset multisystem inflam2 matory disease (NOMID) : a new member of the expanding family of pyrin - associated autoinflammatory diseases [ J ]. Arthritis Rheum, 2002, 46 (12) : [29 ] Girardin SE, Boneca IG, Viala J, et al. NOD2 is a general sensor of peptidoglycan through muramyl dipeptide (MDP) de2 tection[j ]. J Biol Chem, 2003, 278 (11) :

Nods, Nalps and Naip: intracellular regulators of bacterial-induced inflammation

Nods, Nalps and Naip: intracellular regulators of bacterial-induced inflammation Blackwell Science, LtdOxford, UKCMICellular Microbiology 1462-5822Blackwell Publishing Ltd, 200359581592Review ArticleM. Chamaillard, S. E. Girardin, J. Viala and D. J. PhilpottNBS-LRR family of proteins

More information

Role of he Inflammasome in fighting against infection. Gabriel Nuñez Department of Pathology University of Michigan

Role of he Inflammasome in fighting against infection. Gabriel Nuñez Department of Pathology University of Michigan Role of he Inflammasome in fighting against infection Gabriel Nuñez Department of Pathology University of Michigan NLRs and TLRs mediate elimination of pathogens Pathoge n Mammals Plants TLRs LRRs membrane

More information

NLR proteins: integral members of innate immunity and mediators of inflammatory diseases

NLR proteins: integral members of innate immunity and mediators of inflammatory diseases NLR proteins: integral members of innate immunity and mediators of inflammatory diseases Jeanette M. Wilmanski,*,, Tanja Petnicki-Ocwieja,*, and Koichi S. Kobayashi*,,1 *Department of Cancer Immunology

More information

Intracellular NOD-like receptors in innate immunity, infection and disease

Intracellular NOD-like receptors in innate immunity, infection and disease Cellular Microbiology (2008) 10(1), 1 8 doi:10.1111/j.1462-5822.2007.01059.x First published online 18 October 2007 Microreview Intracellular NOD-like receptors in innate immunity, infection and disease

More information

Microbial Pathogen-Induced Necrosis Mediated By NLRP3 and ASC. Stephen Willingham

Microbial Pathogen-Induced Necrosis Mediated By NLRP3 and ASC. Stephen Willingham Microbial Pathogen-Induced Necrosis Mediated By NLRP3 and ASC Stephen Willingham A dissertation submitted to the faculty of the University of North Carolina at Chapel Hill in partial fulfillment of the

More information

Apoptosis & Autophagy

Apoptosis & Autophagy SPETSAI SUMMER SCHOOL 2010 Host Microbe Interactions Cellular Response to Infection: Apoptosis & Autophagy Christoph Dehio There are many ways to die Apoptosis: Historical perspective Process of programmed

More information

NOD-LIKE RECEPTORS (NLRs)

NOD-LIKE RECEPTORS (NLRs) NOD-LIKE RECEPTORS (NLRs) Introduction In mammals, germ-line encoded pattern recognition receptors (PRRs) detect the presence of pathogens either directly through recognition of pathogen-associated molecular

More information

Modulation of Innate Immunity by Nucleotide Binding -Biochemical and Functional Characterization of a CATERPILLER/NLR Protein, Monarch-1/NLRP12

Modulation of Innate Immunity by Nucleotide Binding -Biochemical and Functional Characterization of a CATERPILLER/NLR Protein, Monarch-1/NLRP12 Modulation of Innate Immunity by Nucleotide Binding -Biochemical and Functional Characterization of a CATERPILLER/NLR Protein, Monarch-1/NLRP12 Zhengmao Ye A dissertation submitted to the faculty of the

More information

The Death Domain Superfamily in Intracellular Signaling of Apoptosis and Inflammation

The Death Domain Superfamily in Intracellular Signaling of Apoptosis and Inflammation Annu. Rev. Immunol. 2007. 25:561 86 First published online as a Review in Advance on January 2, 2007 The Annual Review of Immunology is online at immunol.annualreviews.org This article s doi: 10.1146/annurev.immunol.25.022106.141656

More information

Animal NLRs provide structural insights into plant NLR function

Animal NLRs provide structural insights into plant NLR function Annals of Botany 119: 689 702, 2017 doi:10.1093/aob/mcw171, available online at www.aob.oxfordjournals.org REVIEW: PART OF A SPECIAL ISSUE ON PLANT IMMUNITY Animal NLRs provide structural insights into

More information

Nod1 and Nod2 Regulation of Inflammation in the Salmonella Colitis Model

Nod1 and Nod2 Regulation of Inflammation in the Salmonella Colitis Model INFECTION AND IMMUNITY, Dec. 2010, p. 5107 5115 Vol. 78, No. 12 0019-9567/10/$12.00 doi:10.1128/iai.00759-10 Copyright 2010, American Society for Microbiology. All Rights Reserved. Nod1 and Nod2 Regulation

More information

PERSPECTIVE. Are innate immune signaling pathways in plants and animals conserved? Frederick M Ausubel

PERSPECTIVE. Are innate immune signaling pathways in plants and animals conserved? Frederick M Ausubel Are innate immune signaling pathways in plants and animals conserved? Frederick M Ausubel Although adaptive immunity is unique to vertebrates, the innate immune response seems to have ancient origins.

More information

Critical Role for NALP3/CIAS1/Cryopyrin in Innate and Adaptive Immunity through Its Regulation of Caspase-1

Critical Role for NALP3/CIAS1/Cryopyrin in Innate and Adaptive Immunity through Its Regulation of Caspase-1 Immunity 24, 317 327, March 2006 ª2006 Elsevier Inc. DOI 10.1016/j.immuni.2006.02.004 Critical Role for NALP3/CIAS1/Cryopyrin in Innate and Adaptive Immunity through Its Regulation of Caspase-1 Fayyaz

More information

Sensing microbes by diverse hosts. Workshop on Pattern Recognition Proteins and Receptors

Sensing microbes by diverse hosts. Workshop on Pattern Recognition Proteins and Receptors Sensing microbes by diverse hosts Workshop on Pattern Recognition Proteins and Receptors Stephen E. Girardin 1, Dana J. Philpott 2+ & Bruno Lemaitre 3 1 Pathogénie Microbienne Moléculaire and 2 Immunité

More information

Caspase-1 inflammasomes in infection and inflammation

Caspase-1 inflammasomes in infection and inflammation Caspase-1 inflammasomes in infection and inflammation Mohamed Lamkanfi, Thirumala-Devi Kanneganti, Luigi Franchi, and Gabriel Núñez 1 Department of Pathology and Comprehensive Cancer Center, University

More information

PAMP-triggered immunity (PTI)

PAMP-triggered immunity (PTI) PAMP-triggered immunity (PTI) PAMP-triggered immunity (PTI) Recognition of danger signals - Distinguish self or damaged self versus non-self fundamental to any immune system - PAMP or MAMP pathogen/microbe-associated

More information

The innate immune system is the first line of defense against

The innate immune system is the first line of defense against Structural basis for peptidoglycan binding by peptidoglycan recognition proteins Rongjin Guan*, Abhijit Roychowdhury, Brian Ember, Sanjay Kumar, Geert-Jan Boons, and Roy A. Mariuzza* *Center for Advanced

More information

Features. Differences and similarities Innate immunity in plants and animals. The evolutionary impetus for an innate immune system

Features. Differences and similarities Innate immunity in plants and animals. The evolutionary impetus for an innate immune system Differences and similarities Innate immunity in plants and animals Cara H. Haney (Harvard Medical School and Massachusetts General Hospital, USA), Jonathan Urbach (Massachusetts General Hospital, USA)

More information

Drosophila Apoptosis and the Regulation of the Caspase Cascade

Drosophila Apoptosis and the Regulation of the Caspase Cascade Drosophila Apoptosis and the Regulation of the Caspase Cascade Kate Stafford March 18, 2005 Abstract The caspase cascade in Drosophila is controlled primarily by DIAP1 (Drosophila inhibitor of apoptosis),

More information

Programmed Cell Death

Programmed Cell Death Programmed Cell Death Dewajani Purnomosari Department of Histology and Cell Biology Faculty of Medicine Universitas Gadjah Mada d.purnomosari@ugm.ac.id What is apoptosis? a normal component of the development

More information

Massive loss of neurons in embryos occurs during normal development (!)

Massive loss of neurons in embryos occurs during normal development (!) Types of Cell Death Apoptosis (Programmed Cell Death) : Cell-Autonomous Stereotypic Rapid Clean (dead cells eaten) Necrosis : Not Self-Initiated Not Stereotypic Can Be Slow Messy (injury can spread) Apoptosis

More information

FINAL REPORT For Japan-Korea Joint Research Project AREA

FINAL REPORT For Japan-Korea Joint Research Project AREA (Form4-2) FINAL REPORT For Japan-Korea Joint Research Project AREA 1. Mathematics & Physics 2. Chemistry & Material Science 3. Biology 4. Informatics & Mechatronics 5. Geo-Science & Space Science 6. Medical

More information

Si Ming Man and Thirumala-Devi Kanneganti

Si Ming Man and Thirumala-Devi Kanneganti Converging roles of caspases in inflammasome activation, cell death and innate immunity Si Ming Man and Thirumala-Devi Kanneganti Abstract Inflammatory and apoptotic caspases are central players in inflammation

More information

Pannexin-1-Mediated Recognition of Bacterial Molecules Activates the Cryopyrin Inflammasome Independent of Toll-like Receptor Signaling

Pannexin-1-Mediated Recognition of Bacterial Molecules Activates the Cryopyrin Inflammasome Independent of Toll-like Receptor Signaling Article Pannexin-1-Mediated Recognition of Bacterial Molecules Activates the Cryopyrin Inflammasome Independent of Toll-like Receptor Signaling Thirumala-Devi Kanneganti, 1,4 Mohamed Lamkanfi, 1,4 Yun-Gi

More information

Apoptosis: Death Comes for the Cell

Apoptosis: Death Comes for the Cell Apoptosis: Death Comes for the Cell Joe W. Ramos joeramos@hawaii.edu From Ingmar Bergman s The Seventh Seal 1 2 Mutations in proteins that regulate cell proliferation, survival and death can contribute

More information

Cell Death & Trophic Factors II. Steven McLoon Department of Neuroscience University of Minnesota

Cell Death & Trophic Factors II. Steven McLoon Department of Neuroscience University of Minnesota Cell Death & Trophic Factors II Steven McLoon Department of Neuroscience University of Minnesota 1 Remember? Neurotrophins are cell survival factors that neurons get from their target cells! There is a

More information

Structural localization of disease-associated sequence variations in the NACHT and LRR domains of PYPAF1 and NOD2 1

Structural localization of disease-associated sequence variations in the NACHT and LRR domains of PYPAF1 and NOD2 1 FEBS Letters 554 (2003) 520^528 FEBS 27828 Structural localization of disease-associated sequence variations in the NACHT and LRR domains of PYPAF1 and NOD2 1 Mario Albrecht a;, Francisco S. Domingues

More information

Proteases for Cell Suicide: Functions and Regulation of Caspases

Proteases for Cell Suicide: Functions and Regulation of Caspases MICROBIOLOGY AND MOLECULAR BIOLOGY REVIEWS, Dec. 2000, p. 821 846 Vol. 64, No. 4 1092-2172/00/$04.00 0 Copyright 2000, American Society for Microbiology. All Rights Reserved. Proteases for Cell Suicide:

More information

(IAI ; revised manuscript) ACCEPTED. S. aureus. and Andreas Peschel 1

(IAI ; revised manuscript) ACCEPTED. S. aureus. and Andreas Peschel 1 IAI Accepts, published online ahead of print on 29 January 07 Infect. Immun. doi:.1128/iai.076-06 Copyright 07, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights Reserved.

More information

Bio 3411, Fall 2006, Lecture 19-Cell Death.

Bio 3411, Fall 2006, Lecture 19-Cell Death. Types of Cell Death Questions : Apoptosis (Programmed Cell Death) : Cell-Autonomous Stereotypic Rapid Clean (dead cells eaten) Necrosis : Not Self-Initiated Not Stereotypic Can Be Slow Messy (injury can

More information

The Mechanistic Function of the NOD-like Receptor NLRX1 in Apoptosis and Cell Death in the Nervous System

The Mechanistic Function of the NOD-like Receptor NLRX1 in Apoptosis and Cell Death in the Nervous System The Mechanistic Function of the NOD-like Receptor NLRX1 in Apoptosis and Cell Death in the Nervous System by Muhammed Aashiq Rahman A thesis submitted in conformity with the requirements for the degree

More information

Apoptosis in Mammalian Cells

Apoptosis in Mammalian Cells Apoptosis in Mammalian Cells 7.16 2-10-05 Apoptosis is an important factor in many human diseases Cancer malignant cells evade death by suppressing apoptosis (too little apoptosis) Stroke damaged neurons

More information

Emerging inflammasome effector mechanisms

Emerging inflammasome effector mechanisms Emerging inflammasome effector mechanisms Mohamed Lamkanfi Abstract Caspase 1 activation by inflammasome complexes in response to pathogenassociated molecular patterns (PAMPs) and damage-associated molecular

More information

CLIMATE CHANGE: DOES MEMORY IN CORAL

CLIMATE CHANGE: DOES MEMORY IN CORAL CLIMATE CHANGE: DOES MEMORY IN CORAL DICTATE FITNESS IN A CHANGING WORLD? 1Kevin 1Annis 2Louisiana B. Strychar & 2Paul W. Sammarco Water Resources Institute of Grand Valley State University, Michigan,

More information

Host-Pathogen interaction-ii. Pl Path 604 PN Sharma Department of Plant Pathology CSK HPKV, Palampur

Host-Pathogen interaction-ii. Pl Path 604 PN Sharma Department of Plant Pathology CSK HPKV, Palampur Host-Pathogen interaction-ii Pl Path 604 PN Sharma Department of Plant Pathology CSK HPKV, Palampur-176062 It was originally believed that gene-for-gene resistance was conferred by a direct interaction

More information

Chemical aspects of the cell. Compounds that induce cell proliferation, differentiation and death

Chemical aspects of the cell. Compounds that induce cell proliferation, differentiation and death Chemical aspects of the cell Compounds that induce cell proliferation, differentiation and death Cell proliferation The cell cycle Chapter 17 Molecular Biology of the Cell 2 Cell cycle Chapter 17 Molecular

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11419 Supplementary Figure 1 Schematic representation of innate immune signaling pathways induced by intracellular Salmonella in cultured macrophages. a, During the infection Salmonella

More information

A Multi-scale Extensive Petri Net Model of Bacterialmacrophage

A Multi-scale Extensive Petri Net Model of Bacterialmacrophage A Multi-scale Extensive Petri Net Model of Bacterialmacrophage Interaction Rafael V. Carvalho Imaging & BioInformatics, Leiden Institute of Advanced Computer Science Introduction - Mycobacterial infection

More information

The innate immune system recognizes microorganisms via pattern-recognition

The innate immune system recognizes microorganisms via pattern-recognition Pseudomonas aeruginosa activates caspase 1 through Ipaf Edward A. Miao*, Robert K. Ernst, Monica Dors*, Dat P. Mao*, and Alan Aderem* *Institute for Systems Biology, Seattle, WA 98103; and Department of

More information

Apoptosis EXTRA REQUIREMETS

Apoptosis EXTRA REQUIREMETS Apoptosis Introduction (SLIDE 1) Organisms develop from a single cell, and in doing so an anatomy has to be created. This process not only involves the creation of new cells, but also the removal of cells

More information

The NLRP12 Pyrin Domain: Structure, Dynamics, and Functional Insights

The NLRP12 Pyrin Domain: Structure, Dynamics, and Functional Insights doi:10.1016/j.jmb.2011.09.024 J. Mol. Biol. (2011) 413, 790 803 Contents lists available at www.sciencedirect.com Journal of Molecular Biology journal homepage: http://ees.elsevier.com.jmb The NLRP12 Pyrin

More information

Salmonella Promotes ASC Oligomerization-dependent Caspase-1 Activation

Salmonella Promotes ASC Oligomerization-dependent Caspase-1 Activation http://dx.doi.org/10.4110/in.2012.12.6.284 pissn 1598-2629 eissn 2092-6685 BRIEF COMMUNICATION Salmonella Promotes ASC Oligomerization-dependent Caspase-1 Activation Inhwa Hwang 1,2, Sangjun Park 1,2,

More information

Cell Survival Curves (Chap. 3)

Cell Survival Curves (Chap. 3) Cell Survival Curves (Chap. 3) Example of pedigress of EMT6 mouse cells Clone The in vitro cell survival curve Cell Survival Assay Dye exclusion assay: membrane integrity MTT assay: respiratory activity

More information

Host-Pathogen Interaction. PN Sharma Department of Plant Pathology CSK HPKV, Palampur

Host-Pathogen Interaction. PN Sharma Department of Plant Pathology CSK HPKV, Palampur Host-Pathogen Interaction PN Sharma Department of Plant Pathology CSK HPKV, Palampur-176062 PATHOGEN DEFENCE IN PLANTS A BIOLOGICAL AND MOLECULAR VIEW Two types of plant resistance response to potential

More information

Graduate Institute t of fanatomy and Cell Biology

Graduate Institute t of fanatomy and Cell Biology Cell Adhesion 黃敏銓 mchuang@ntu.edu.tw Graduate Institute t of fanatomy and Cell Biology 1 Cell-Cell Adhesion and Cell-Matrix Adhesion actin filaments adhesion belt (cadherins) cadherin Ig CAMs integrin

More information

The Drosophila caspasedreddisrequiredtoresist Gram-negative bacterial infection

The Drosophila caspasedreddisrequiredtoresist Gram-negative bacterial infection EMBO reports The Drosophila caspasedreddisrequiredtoresist Gram-negative bacterial infection François Leulier, Antony Rodriguez 1, Ranjiv S. Khush, John M. Abrams 1 and Bruno Lemaitre + Centre de Génétique

More information

Nature Genetics: doi: /ng Supplementary Figure 1. Icm/Dot secretion system region I in 41 Legionella species.

Nature Genetics: doi: /ng Supplementary Figure 1. Icm/Dot secretion system region I in 41 Legionella species. Supplementary Figure 1 Icm/Dot secretion system region I in 41 Legionella species. Homologs of the effector-coding gene lega15 (orange) were found within Icm/Dot region I in 13 Legionella species. In four

More information

NK cells are part of the innate immune response. Early response to injury and infection

NK cells are part of the innate immune response. Early response to injury and infection NK cells are part of the innate immune response Early response to injury and infection Functions: Natural Killer (NK) Cells. Cytolysis: killing infected or damaged cells 2. Cytokine production: IFNγ, GM-CSF,

More information

Translation - Prokaryotes

Translation - Prokaryotes 1 Translation - Prokaryotes Shine-Dalgarno (SD) Sequence rrna 3 -GAUACCAUCCUCCUUA-5 mrna...ggagg..(5-7bp)...aug Influences: Secondary structure!! SD and AUG in unstructured region Start AUG 91% GUG 8 UUG

More information

Most plants are resistant to most plant

Most plants are resistant to most plant Plant pathogens and integrated defence responses to infection Jeffery L. Dangl* & Jonathan D. G. Jones *Department of Biology and Curriculum in Genetics, Coker Hall 108, CB#3280, University of North Carolina

More information

Introduction to Bioinformatics. Case Study

Introduction to Bioinformatics. Case Study Case Study Case 1 Case 2 How SIGIRR inhibit the TLR4 and 7 signaling pathways? Homology modeling of Tolllike receptor ectodomains. Case 1 How SIGIRR inhibit the Toll-like receptors TLR4 and 7 signaling

More information

On the relevance of cellular signaling pathways for immune-inspired algorithms

On the relevance of cellular signaling pathways for immune-inspired algorithms On the relevance of cellular signaling pathways for immune-inspired algorithms T. S. Guzella 1,2 and T. A. Mota-Santos 2 1 Dept. of Electrical Engineering, Federal University of Minas Gerais, Belo Horizonte

More information

The role of Receptor Interacting Protein Kinases in Necroptosis and Inflammation

The role of Receptor Interacting Protein Kinases in Necroptosis and Inflammation The role of Receptor Interacting Protein Kinases in Necroptosis and Inflammation Grainne Delaney Senior Sophister Immunology Inflammation is a defensive response against pathogens. During the initial inflammatory

More information

The cytoskeleton in cell-autonomous immunity: structural determinants of host defence

The cytoskeleton in cell-autonomous immunity: structural determinants of host defence The cytoskeleton in cell-autonomous immunity: structural determinants of host defence Serge Mostowy and Avinash R. Shenoy Medical Research Council Centre of Molecular Bacteriology and Infection (CMBI),

More information

Examination paper for Bi3016 Molecular Cell Biology

Examination paper for Bi3016 Molecular Cell Biology Department of Biology Examination paper for Bi3016 Molecular Cell Biology Academic contact during examination: Per Winge Phone: 99369359 Examination date: 20 th December 2017 Examination time (from-to):

More information

Mechanisms of Cell Death

Mechanisms of Cell Death Mechanisms of Cell Death Etiology of cell death Major Factors Accidental Genetic Necrosis Apoptosis Necrosis: The sum of the morphologic changes that follow cell death in a living tissue or organ Apoptosis:

More information

Introduction to Bioinformatics Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Dr. rer. nat. Gong Jing Cancer Research center Medicine School of Shandong University 2012.11.14 1 Case Study 2 Case 1 Case 2 How SIGIRR inhibit the TLR4 and 7 signaling pathways? Model Construction Tolllike

More information

A Database of human biological pathways

A Database of human biological pathways A Database of human biological pathways Steve Jupe - sjupe@ebi.ac.uk 1 Rationale Journal information Nature 407(6805):770-6.The Biochemistry of Apoptosis. Caspase-8 is the key initiator caspase in the

More information

Death signaling. Color PDF file of handouts can be found at Wu lab web-page:

Death signaling. Color PDF file of handouts can be found at Wu lab web-page: Death signaling Hao Wu References 1. Wang, X. The expanding role of mitochondria in apoptosis. Genes Dev 15, 2922-2933. (2001). 2. Fesik, S. W. Insights into programmed cell death through structural biology.

More information

Apoptosis and Carcinogenesis

Apoptosis and Carcinogenesis Death Becomes Us: Apoptosis and Carcinogenesis by Michele M. Cox Department of Biology, University of the Virgin Islands Part I What Is Cancer? Hi, Derek. Studying for your Cell and Molec final? asked

More information

Looking for LOV: Location of LOV1 function in Nicotiana benthamiana cells

Looking for LOV: Location of LOV1 function in Nicotiana benthamiana cells Looking for LOV: Location of LOV1 function in Nicotiana benthamiana cells By: Patrick Rutledge 1 Dr. Jennifer Lorang 2,3, Dr. Marc Curtis 2,3, Dr. Thomas Wolpert 2,3 BioResource Research 1, Botany and

More information

Approved Courses for General Science students with Major/Minors in Biological Sciences

Approved Courses for General Science students with Major/Minors in Biological Sciences Approved Courses for General Science students with Major/Minors in Biological Sciences List C: Physiology, cell and developmental biology BIOIN 301 Bioinformatics. * (fi 6) (first term, 3-0-0). Introduction

More information

Signal recognition and transduction mediated by the tomato Pto kinase: a paradigm of innate immunity in plants

Signal recognition and transduction mediated by the tomato Pto kinase: a paradigm of innate immunity in plants , 2, 2000, 1591 1597 2000 Éditions scientifiques et médicales Elsevier SAS. All rights reserved S1286457900013150/REV Signal recognition and transduction mediated by the tomato Pto kinase: a paradigm of

More information

REVIEW. Sensing bacterial infections by NAIP receptors in NLRC4 inflammasome activation. Protein & Cell. Yi-Nan Gong 1, Feng Shao 2 ABSTRACT

REVIEW. Sensing bacterial infections by NAIP receptors in NLRC4 inflammasome activation. Protein & Cell. Yi-Nan Gong 1, Feng Shao 2 ABSTRACT Protein Cell 2012, 3(2): 98 105 DOI 10.1007/s13238-012-2028-3 REVIEW Sensing bacterial infections by NAIP receptors in NLRC4 inflammasome activation Yi-Nan Gong 1, Feng Shao 2 1 National Institute of Biological

More information

A. Incorrect! The Cell Cycle contains 4 distinct phases: (1) G 1, (2) S Phase, (3) G 2 and (4) M Phase.

A. Incorrect! The Cell Cycle contains 4 distinct phases: (1) G 1, (2) S Phase, (3) G 2 and (4) M Phase. Molecular Cell Biology - Problem Drill 21: Cell Cycle and Cell Death Question No. 1 of 10 1. Which of the following statements about the cell cycle is correct? Question #1 (A) The Cell Cycle contains 3

More information

Journal Club & MSc Seminar

Journal Club & MSc Seminar IN THE NAME OF GOD Journal Club & MSc Seminar The relationship between apoptosis and microorganisms Superviser: Dr. Presented by: Mehri Sadeghi MSc Medical Microbiology What is it? Why is it important?

More information

Supporting Information

Supporting Information Supporting Information Cao et al. 10.1073/pnas.1306220110 Gram - bacteria Hemolymph Cytoplasm PGRP-LC TAK1 signalosome Imd dfadd Dredd Dnr1 Ikk signalosome P Relish Nucleus AMP and effector genes Fig.

More information

Domain 6: Communication

Domain 6: Communication Domain 6: Communication 6.1: Cell communication processes share common features that reflect a shared evolutionary history. (EK3.D.1) 1. Introduction to Communication Communication requires the generation,

More information

The cytoskeleton in cell-autonomous immunity: structural determinants of host defence

The cytoskeleton in cell-autonomous immunity: structural determinants of host defence The cytoskeleton in cell-autonomous immunity: structural determinants of host defence Serge Mostowy and Avinash R. Shenoy Abstract Host cells use antimicrobial proteins, pathogen-restrictive compartmentalization

More information

Monte Carlo study elucidates the type 1/type 2 choice in apoptotic death signaling in normal and cancer cells

Monte Carlo study elucidates the type 1/type 2 choice in apoptotic death signaling in normal and cancer cells Cells 2013, 2, 1-x manuscripts; doi:10.3390/cells20x000x OPEN ACCESS cells ISSN 2073-4409 www.mdpi.com/journal/cells Article Monte Carlo study elucidates the type 1/type 2 choice in apoptotic death signaling

More information

The Drosophila systemic immune response: sensing and signalling during bacterial and fungal infections

The Drosophila systemic immune response: sensing and signalling during bacterial and fungal infections The Drosophila systemic immune response: sensing and signalling during bacterial and fungal infections Dominique Ferrandon, Jean-Luc Imler, Charles Hetru and Jules A. Hoffmann Abstract A hallmark of the

More information

A Salmonella Virulence Factor Activates the NOD1/NOD2 Signaling Pathway

A Salmonella Virulence Factor Activates the NOD1/NOD2 Signaling Pathway RESEARCH ARTICLE A Salmonella Virulence Factor Activates the NOD1/NOD2 Signaling Pathway A. Marijke Keestra, Maria G. Winter, Daisy Klein-Douwel, Mariana N. Xavier, Sebastian E. Winter, Anita Kim, Renée

More information

12/5/2014. The cell cycle and cell death. The cell cycle: cells duplicate their contents and divide

12/5/2014. The cell cycle and cell death. The cell cycle: cells duplicate their contents and divide The cell cycle and cell death The cell cycle: cells duplicate their contents and divide 1 The cell cycle may be divided into 4 phases Eucaryotic cell division: Mitosis (nuclear division) Cytokinesis (cell

More information

Supplementary Figure 1. AnnexinV FITC and Sytox orange staining in wild type, Nlrp3 /, ASC / and casp1/11 / TEC treated with TNF /CHX.

Supplementary Figure 1. AnnexinV FITC and Sytox orange staining in wild type, Nlrp3 /, ASC / and casp1/11 / TEC treated with TNF /CHX. Supplementary Figure 1. AnnexinV FITC and Sytox orange staining in wild type, Nlrp3 /, ASC / and casp1/11 / TEC treated with TNF /CHX. Phase contrast and widefield fluorescence microscopy (20x magnification).

More information

What are mitochondria?

What are mitochondria? What are mitochondria? What are mitochondria? An intracellular organelle. There are 100 to 1000s of mitochondria/cell. Most mitochondria come from the mother. Mitochondria have their own DNA Mitochondria

More information

DEFINING THE PLAYERS IN HIGHER-ORDER NETWORKS: PREDICTIVE MODELING FOR REVERSE ENGINEERING FUNCTIONAL INFLUENCE NETWORKS

DEFINING THE PLAYERS IN HIGHER-ORDER NETWORKS: PREDICTIVE MODELING FOR REVERSE ENGINEERING FUNCTIONAL INFLUENCE NETWORKS DEFINING THE PLAYERS IN HIGHER-ORDER NETWORKS: PREDICTIVE MODELING FOR REVERSE ENGINEERING FUNCTIONAL INFLUENCE NETWORKS JASON E. MCDERMOTT 1, MICHELLE ARCHULETA 1, SUSAN L. STEVENS 2, MARY P. STENZEL-POORE

More information

Ab1 (57-68) Ab2 ( ) Ab3 ( ) Ab4 ( ) GBP-N domain GBP-C domain CARD domain

Ab1 (57-68) Ab2 ( ) Ab3 ( ) Ab4 ( ) GBP-N domain GBP-C domain CARD domain MDKPVCLIDTGSDGKLCVQQAALQVLQQIQQPVVVVAVVGLYRTGKSFLMNRLAG 55 KRTGFALSSNIKPKTEGIWMWCVPHPTKAGTSLVLLDTKGLGDVEKGDSKRDTYI 110 FSLTVLLSSTLVYNSRGVIDNKAMEELQYVTELIEHIKVTPDEDADDCTAFAKFF 165 PHFIWCLRDFTLELKLDGKDLTEDEYLEFALKLRPGTLKKVMMYNLPRECIQKFF

More information

Types of biological networks. I. Intra-cellurar networks

Types of biological networks. I. Intra-cellurar networks Types of biological networks I. Intra-cellurar networks 1 Some intra-cellular networks: 1. Metabolic networks 2. Transcriptional regulation networks 3. Cell signalling networks 4. Protein-protein interaction

More information

Lecture 10: Cyclins, cyclin kinases and cell division

Lecture 10: Cyclins, cyclin kinases and cell division Chem*3560 Lecture 10: Cyclins, cyclin kinases and cell division The eukaryotic cell cycle Actively growing mammalian cells divide roughly every 24 hours, and follow a precise sequence of events know as

More information

The Caspase System: a potential role in muscle proteolysis and meat quality? Tim Parr

The Caspase System: a potential role in muscle proteolysis and meat quality? Tim Parr The Caspase System: a potential role in muscle proteolysis and meat quality? Tim Parr Caroline Kemp, Ron Bardsley,, Peter Buttery Division of Nutritional Sciences, School of Biosciences, University of

More information

A molecular model of the full-length human NOD-like receptor family CARD domain containing 5 (NLRC5) protein

A molecular model of the full-length human NOD-like receptor family CARD domain containing 5 (NLRC5) protein Mótyán et al. BMC Bioinformatics 2013, 14:275 RESEARCH ARTICLE Open Access A molecular model of the full-length human NOD-like receptor family CARD domain containing 5 (NLRC5) protein János András Mótyán

More information

On the Evolution of Decoys in Plant Immune Systems

On the Evolution of Decoys in Plant Immune Systems On the Evolution of Decoys in Plant Immune Systems Iaroslav Ispolatov and Michael Doebeli Departments of Mathematics and Zoology University of British Columbia Vancouver, BC, Canada slava@math.ubc.ca doebeli@zoology.ubc.ca

More information

Mutations in the Drosophila dtak1 gene reveal a conserved function for MAPKKKs in the control of rel/nf- B-dependent innate immune responses

Mutations in the Drosophila dtak1 gene reveal a conserved function for MAPKKKs in the control of rel/nf- B-dependent innate immune responses Mutations in the Drosophila dtak1 gene reveal a conserved function for MAPKKKs in the control of rel/nf- B-dependent innate immune responses Sheila Vidal, 1,3 Ranjiv S. Khush, 1,3 François Leulier, 1,3

More information

1. Ras-Interactors from the RASOMICS database

1. Ras-Interactors from the RASOMICS database Transformation by ras oncogenes induces the deregulation of intracellular signalling cascades that are critical elements in cell growth control. Ras genes code for small GTPases that act as GDP/ GTP-regulated

More information

Divergence from a Dedicated Cellular Suicide Mechanism: Exploring the Evolution of Cell Death. Review. Junying Yuan 1, * 1 Department of Cell Biology

Divergence from a Dedicated Cellular Suicide Mechanism: Exploring the Evolution of Cell Death. Review. Junying Yuan 1, * 1 Department of Cell Biology Molecular Cell 23, 1 12, July 7, 2006 ª2006 Elsevier Inc. DOI 10.1016/j.molcel.2006.06.008 Divergence from a Dedicated Cellular Suicide Mechanism: Exploring the Evolution of Cell Death Review Junying Yuan

More information

Mechanisms of Cell Death

Mechanisms of Cell Death Mechanisms of Cell Death Etiology of cell death Major Factors Accidental Genetic Necrosis Apoptosis Necrosis: The sum of the morphologic changes that follow cell death in a living tissue or organ Apoptosis:

More information

Inflammatory responses to a Clostridium perfringens type A strain and α-toxin in primary intestinal epithelial cells of chicken embryos

Inflammatory responses to a Clostridium perfringens type A strain and α-toxin in primary intestinal epithelial cells of chicken embryos Avian Pathology ISSN: 0307-9457 (Print) 1465-3338 (Online) Journal homepage: http://www.tandfonline.com/loi/cavp20 Inflammatory responses to a Clostridium perfringens type A strain and α-toxin in primary

More information

AP Biology Gene Regulation and Development Review

AP Biology Gene Regulation and Development Review AP Biology Gene Regulation and Development Review 1. What does the regulatory gene code for? 2. Is the repressor by default active/inactive? 3. What changes the repressor activity? 4. What does repressor

More information

COMPUTER SIMULATION OF DIFFERENTIAL KINETICS OF MAPK ACTIVATION UPON EGF RECEPTOR OVEREXPRESSION

COMPUTER SIMULATION OF DIFFERENTIAL KINETICS OF MAPK ACTIVATION UPON EGF RECEPTOR OVEREXPRESSION COMPUTER SIMULATION OF DIFFERENTIAL KINETICS OF MAPK ACTIVATION UPON EGF RECEPTOR OVEREXPRESSION I. Aksan 1, M. Sen 2, M. K. Araz 3, and M. L. Kurnaz 3 1 School of Biological Sciences, University of Manchester,

More information

Understanding relationship between homologous sequences

Understanding relationship between homologous sequences Molecular Evolution Molecular Evolution How and when were genes and proteins created? How old is a gene? How can we calculate the age of a gene? How did the gene evolve to the present form? What selective

More information

Cell Adhesion and Signaling

Cell Adhesion and Signaling Cell Adhesion and Signaling mchuang@ntu.edu.tw Institute of Anatomy and Cell Biology 1 Transactivation NATURE REVIEWS CANCER VOLUME 7 FEBRUARY 2007 85 2 Functions of Cell Adhesion cell cycle proliferation

More information

Journal of Pharmacology and Experimental Therapy-JPET#172536

Journal of Pharmacology and Experimental Therapy-JPET#172536 A NEW NON-PEPTIDIC INHIBITOR OF THE 14-3-3 DOCKING SITE INDUCES APOPTOTIC CELL DEATH IN CHRONIC MYELOID LEUKEMIA SENSITIVE OR RESISTANT TO IMATINIB Manuela Mancini, Valentina Corradi, Sara Petta, Enza

More information

Common and Contrasting Themes of Plant and Animal Diseases

Common and Contrasting Themes of Plant and Animal Diseases 32. M. R. Grant et al., Proc. Natl. Acad. Sci. U.S.A. 95, 15843 (1998). 33. Unpublished data of authors (39), comparing about 2 kb of flanking sequence in 23 A. thaliana accessions. 34. To calculate changes

More information

Under the Radar Screen: How Bugs Trick Our Immune Defenses

Under the Radar Screen: How Bugs Trick Our Immune Defenses Under the Radar Screen: How Bugs Trick Our Immune Defenses Session 2: Phagocytosis Marie-Eve Paquet and Gijsbert Grotenbreg Whitehead Institute for Biomedical Research Salmonella Gram negative bacteria

More information

Chang 1. Characterization of the Drosophila Ortholog of the Mammalian Anti-apoptotic Protein Aven

Chang 1. Characterization of the Drosophila Ortholog of the Mammalian Anti-apoptotic Protein Aven Chang 1 Characterization of the Drosophila Ortholog of the Mammalian Anti-apoptotic Protein Aven Joy Chang Georgetown University Senior Digital Thesis May 1, 2006 Chang 2 Table of Contents BACKGROUND 4

More information

In silico analysis of the NBS protein family in Ectocarpus siliculosus

In silico analysis of the NBS protein family in Ectocarpus siliculosus Indian Journal of Biotechnology Vol 12, January 2013, pp 98-102 In silico analysis of the NBS protein family in Ectocarpus siliculosus Niaz Mahmood 1 * and Mahdi Muhammad Moosa 1,2 1 Molecular Biology

More information

Transcription Regulation And Gene Expression in Eukaryotes UPSTREAM TRANSCRIPTION FACTORS

Transcription Regulation And Gene Expression in Eukaryotes UPSTREAM TRANSCRIPTION FACTORS Transcription Regulation And Gene Expression in Eukaryotes UPSTREAM TRANSCRIPTION FACTORS RG. Clerc March 26. 2008 UPSTREAM TRANSCRIPTION FACTORS Experimental approaches DNA binding domains (DBD) Transcription

More information

AP Biology. Free-Response Questions

AP Biology. Free-Response Questions 2018 AP Biology Free-Response Questions College Board, Advanced Placement Program, AP, AP Central, and the acorn logo are registered trademarks of the College Board. AP Central is the official online home

More information

Importance of Protein sorting. A clue from plastid development

Importance of Protein sorting. A clue from plastid development Importance of Protein sorting Cell organization depend on sorting proteins to their right destination. Cell functions depend on sorting proteins to their right destination. Examples: A. Energy production

More information

Scholarly Activity Improvement Fund (SAIF)-A 2012/2013 Final Report. Blocking signal pathway inter-connectors to reverse cell death

Scholarly Activity Improvement Fund (SAIF)-A 2012/2013 Final Report. Blocking signal pathway inter-connectors to reverse cell death Scholarly Activity Improvement Fund (SAIF)-A 2012/2013 Final Report Blocking signal pathway inter-connectors to reverse cell death Chanaka Mendis Professor of Chemistry Department of Chemistry & Engineering

More information