Protein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds
|
|
- Meagan Stephens
- 6 years ago
- Views:
Transcription
1 Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino acid sequence of protein helices, sheets, turns and loops association of secondary structures independently stable structural unit folded structure of whole polypeptide includes disulfide bonds assembled complex (oligomer) homo-oligomeric ( protein type) hetero-oligomeric (> type) Primary Structure Linear amino acid sequence -Can be chemically sequenced Sanger insulin 955 -Can usually be translated from gene B - inteins Aminoacid 2 Equine hemoglobin primary structure VLSAADKTVKAAWSKVGGHAGEYGAEALEMF LGFPTTKTYFPHFDLSHGSAQVKAHGKKVADGL TLAVGHLDDLPGALSDLSLHAHKLVDPVFK LLSHCLLSTLAVHLPDFTPAVHASLDKFLSSV STVLTSKY Aminoacid
2 Secondary Structure Defined by main chain angles - Helix - Sheet Distinct hydrogen bonding patterns - Turn - Loop (or coil) amachandran Plot Alpha Helix Super-Secondary Structure TIM barrel composed of strand-helix-strand motifs Tertiary Structure Three main categories: - all alpha - all beta - alpha/beta May contain one or more domains Lipoxygenase 2 2
3 Quaternary Structure Homodimer S-adenosyl homocysteine hydrolase Homotrimer of heterodimers b a b F0F ATPase a a b Main Chain Angles (eview) Omega (peptide bond) is ~80 and can be 0 for proline 2 3 Omega is angle between two planes: -Plane made by atoms,2,3 -Plane made by atoms 2,3, Main Chain Angles (Phi) Phi is angle between two planes: -Plane made by atoms,2,3 -Plane made by atoms 2,3, o Phi for proline 3
4 Main Chain Angles (Psi) 2 3 Psi is angle between two planes: -Plane made by atoms,2,3 -Plane made by atoms 2,3, 2 3 amachandran Plot Describes allowable areas for 8 amino acids (not G and P) Psi estrictions 2 3 Clash between and Clash between and
5 Phi estrictions 3 2 Clash between C and C Clash between C and, Interactions Limit Main Chain Conformational Space Secondary Structure Elements alpha-helix beta-sheet Helices (30, alpha, pi) Sheets (parallel, anti-parallel) Turns (beta, gamma) Loop/Coil (everything else) coil (usually exposed on the surface of proteins) ribonuclease A 5
6 alpha Helices 3.0 pi amino acids per turn: frequency 3.6 ~97% 3.0 ~3%. rare H-bonding i, i+ i, i+3 i, i+5 Helical Main Chain Angles Collagen, PolyProline 3 0 Helix Alpha Helix Pi Helix a-helices -Local interactions -ight handed rise per residue,.5 Å -esidue per turn, 3.5Å -Alpha helices are about 0 residues on average -Side chains staggered -Linus Pauling (obel Prize in Chemistry, 95) figured out the structure of alpha-keratin helix. 6
7 a-helix Dipole Moment d- -Hydrogen bond between C=O(i)...H-(i+) -Dipole moment arises due to the orientation of peptide bond (3.5 Debye) d+ Dipole moment Helical Wheels - a tool to visualize the position of amino acids around an alpha-helix - allows for quick visualization of whether a side of a helix posses specific chemical properties - example shown is a helix that forms a Leucine-Zipper Hydrophobic residues on one side interact with helix displaying same pattern Amphipathic Helices Amphipathic: hydrophilic & hydrophobic - these helices posses hydrophilic amino acids on one side and hydrophobic residues on the other. Hydrophobic -these -helices can interact with membrane Hydrophilic hydrophilic head group aliphatic carbon chain lipid bilayer 7
8 b-sheets Antiparallel b-sheet Parallel b-sheet b-sheets fulfill the hydrogen bonding potential of the main-chain atoms, except at the edges. Sheet are composed of individual beta strands. Adjacent strands are usually close in sequence. b-sheets Antiparallel b-sheet Parallel b-sheet Properties: -Parallel beta-strands (3.25 Å between adjacent Ca s) -Anti-parallel beta-strands (3.7 Å between adjacent Ca s) -Distance between strands ~.6 Å -o significant net dipole moment -Strands are not flat. They have a characteristic right-handed twist ight Handed Twist parallel - beta-sheets can form various higher-level structures, such as a beta-barrel anti-parallel twisted Green Fluorescent Protein (GFP) 8
9 Beta Strand Main Chain Angles Antiparallel Parallel Side Chains Extend Above and Below Beta-Sheets Silk An example of complex beta-sheets: Silk Fibroin - multiple pleated sheets provide toughness & rigidity to many structural proteins. 9
10 Beta Bulge C H 3 O H H 0 O O O H O 2 H - H O H O 3 0 H O 2 H O Beta bulge C C H 3 O H O O H 2 O H 0 H O H O 3 H 0 O 2 H O C Anti-parallel strands -Beta bulges occur on the last strand (edge) of an anti-parallel beta sheet -An additional amino acid is present in the last strand -Bulges cause bending of otherwise straight anti-parallel beta strands Beta - Turns Same side There are two classes of beta-turns: - type I - type II Type I turns have the amino acids on the same side Opposite sides Type II turns have the amino acids on the opposite sides Hydrogen-bonding between backbones of residue and Gamma-Turns Proline A 3 amino acid turn utilizing proline at the turn. Hydrogen-bonding with C=O of residue and -H of residue 2 0
11 Conformational Preferences of the Amino Acids Helical Preference Strand Preference Turn Preference Williams, W et al., Biochim. Biophys. Acta 987, 96: 200- Conformational Preferences of the Amino Acids Extended flexible side chains Bulky side chains, beta-branched estricted conformations, side Chain main chain interactions Williams, W et al., Biochim. Biophys. Acta 987, 96: 200- Helical Preference Extended flexible side chains
12 Strand Preference Bulky side chains, beta-branched B B B Bulky residues better tolerated above and below sheet Turn Preference estricted conformations, side chain main chain interactions End of Secondary Structure 2
13 Super Secondary Structure Motifs These simple arrangements of secondary structural elements account for most protein domains. In all cases the stabilizing interactions occur within a local area of the sequence (this is convenient for evolution). ote also that all of these motifs are chiral and are observed almost exclusively in these arrangements Tertiary Structure PDB 3
14
Protein Structure Basics
Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes
More informationProtein Structure and Function. Protein Architecture:
BCHS 6229 Protein Structure and Function Lecture 2 (October 13, 2011) Protein Architecture: Symmetry relationships and protein structure Primary & Secondary Structure Motifs & Super-secondary Structure
More informationAnnouncements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure
Announcements TA Office Hours: Brian Eckenroth Monday 3-4 pm Thursday 11 am-12 pm Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Margaret Daugherty Fall 2003 Homework II posted
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2003 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More information4 Proteins: Structure, Function, Folding W. H. Freeman and Company
4 Proteins: Structure, Function, Folding 2013 W. H. Freeman and Company CHAPTER 4 Proteins: Structure, Function, Folding Learning goals: Structure and properties of the peptide bond Structural hierarchy
More informationBCH 4053 Spring 2003 Chapter 6 Lecture Notes
BCH 4053 Spring 2003 Chapter 6 Lecture Notes 1 CHAPTER 6 Proteins: Secondary, Tertiary, and Quaternary Structure 2 Levels of Protein Structure Primary (sequence) Secondary (ordered structure along peptide
More informationBiochemistry: Concepts and Connections
Biochemistry: Concepts and Connections Dean R. Appling Spencer J. Anthony-Cahill Christopher K. Mathews Chapter 6 The Three Dimensional Structure of Proteins Cartoon representation of myoglobin, showing
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2004 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More informationtitin, has 35,213 amino acid residues (the human version of titin is smaller, with only 34,350 residues in the full length protein).
Introduction to Protein Structure Proteins are large heteropolymers usually comprised of 50 2500 monomer units, although larger proteins are observed 8. The monomer units of proteins are amino acids. Proteins
More informationProtein Structure & Motifs
& Motifs Biochemistry 201 Molecular Biology January 12, 2000 Doug Brutlag Introduction Proteins are more flexible than nucleic acids in structure because of both the larger number of types of residues
More informationFrom Amino Acids to Proteins - in 4 Easy Steps
From Amino Acids to Proteins - in 4 Easy Steps Although protein structure appears to be overwhelmingly complex, you can provide your students with a basic understanding of how proteins fold by focusing
More informationMajor Types of Association of Proteins with Cell Membranes. From Alberts et al
Major Types of Association of Proteins with Cell Membranes From Alberts et al Proteins Are Polymers of Amino Acids Peptide Bond Formation Amino Acid central carbon atom to which are attached amino group
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationBiomolecules: lecture 10
Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet
More informationThe Structure and Functions of Proteins
Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science and Engineering 2003 The Structure and Functions of Proteins Dan E. Krane Wright State University
More informationProteins. Division Ave. High School Ms. Foglia AP Biology. Proteins. Proteins. Multipurpose molecules
Proteins Proteins Multipurpose molecules 2008-2009 Proteins Most structurally & functionally diverse group Function: involved in almost everything u enzymes (pepsin, DNA polymerase) u structure (keratin,
More informationAP Biology. Proteins. AP Biology. Proteins. Multipurpose molecules
Proteins Proteins Multipurpose molecules 2008-2009 1 Proteins Most structurally & functionally diverse group Function: involved in almost everything u enzymes (pepsin, DNA polymerase) u structure (keratin,
More informationPart II => PROTEINS and ENZYMES. 2.3 PROTEIN STRUCTURE 2.3a Secondary Structure 2.3b Tertiary Structure 2.3c Quaternary Structure
Part II => PROTEINS and ENZYMES 2.3 PROTEIN STRUCTURE 2.3a Secondary Structure 2.3b Tertiary Structure 2.3c Quaternary Structure Section 2.3a: Secondary Structure Synopsis 2.3a - Secondary structure refers
More informationRead more about Pauling and more scientists at: Profiles in Science, The National Library of Medicine, profiles.nlm.nih.gov
2018 Biochemistry 110 California Institute of Technology Lecture 2: Principles of Protein Structure Linus Pauling (1901-1994) began his studies at Caltech in 1922 and was directed by Arthur Amos oyes to
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More informationIntroduction to Protein Folding
Introduction to Protein Folding Chapter 4 Proteins: Three Dimensional Structure and Function Conformation - three dimensional shape Native conformation - each protein folds into a single stable shape (physiological
More informationConformational Geometry of Peptides and Proteins:
Conformational Geometry of Peptides and Proteins: Before discussing secondary structure, it is important to appreciate the conformational plasticity of proteins. Each residue in a polypeptide has three
More informationDana Alsulaibi. Jaleel G.Sweis. Mamoon Ahram
15 Dana Alsulaibi Jaleel G.Sweis Mamoon Ahram Revision of last lectures: Proteins have four levels of structures. Primary,secondary, tertiary and quaternary. Primary structure is the order of amino acids
More informationSecondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure
Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted
More informationWhat is the central dogma of biology?
Bellringer What is the central dogma of biology? A. RNA DNA Protein B. DNA Protein Gene C. DNA Gene RNA D. DNA RNA Protein Review of DNA processes Replication (7.1) Transcription(7.2) Translation(7.3)
More informationD Dobbs ISU - BCB 444/544X 1
11/7/05 Protein Structure: Classification, Databases, Visualization Announcements BCB 544 Projects - Important Dates: Nov 2 Wed noon - Project proposals due to David/Drena Nov 4 Fri PM - Approvals/responses
More informationSupersecondary Structures (structural motifs)
Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationBiochemistry - I SPRING Mondays and Wednesdays 9:30-10:45 AM (MR-1307) Lectures 3-4. Based on Profs. Kevin Gardner & Reza Khayat
Biochemistry - I Mondays and Wednesdays 9:30-10:45 AM (MR-1307) SPRING 2017 Lectures 3-4 Based on Profs. Kevin Gardner & Reza Khayat 1 Outline Overview of protein structure Peptide bonds Secondary structure
More informationSecondary and sidechain structures
Lecture 2 Secondary and sidechain structures James Chou BCMP201 Spring 2008 Images from Petsko & Ringe, Protein Structure and Function. Branden & Tooze, Introduction to Protein Structure. Richardson, J.
More informationModel Mélange. Physical Models of Peptides and Proteins
Model Mélange Physical Models of Peptides and Proteins In the Model Mélange activity, you will visit four different stations each featuring a variety of different physical models of peptides or proteins.
More informationBIRKBECK COLLEGE (University of London)
BIRKBECK COLLEGE (University of London) SCHOOL OF BIOLOGICAL SCIENCES M.Sc. EXAMINATION FOR INTERNAL STUDENTS ON: Postgraduate Certificate in Principles of Protein Structure MSc Structural Molecular Biology
More informationAnalysis and Prediction of Protein Structure (I)
Analysis and Prediction of Protein Structure (I) Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 2006 Free for academic use. Copyright @ Jianlin Cheng
More informationObjective: Students will be able identify peptide bonds in proteins and describe the overall reaction between amino acids that create peptide bonds.
Scott Seiple AP Biology Lesson Plan Lesson: Primary and Secondary Structure of Proteins Purpose:. To understand how amino acids can react to form peptides through peptide bonds.. Students will be able
More informationDenaturation and renaturation of proteins
Denaturation and renaturation of proteins Higher levels of protein structure are formed without covalent bonds. Therefore, they are not as stable as peptide covalent bonds which make protein primary structure
More information1. Amino Acids and Peptides Structures and Properties
1. Amino Acids and Peptides Structures and Properties Chemical nature of amino acids The!-amino acids in peptides and proteins (excluding proline) consist of a carboxylic acid ( COOH) and an amino ( NH
More informationMolecular Modelling. part of Bioinformatik von RNA- und Proteinstrukturen. Sonja Prohaska. Leipzig, SS Computational EvoDevo University Leipzig
part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 Protein Structure levels or organization Primary structure: sequence of amino acids (from
More informationProtein Structure. Role of (bio)informatics in drug discovery. Bioinformatics
Bioinformatics Protein Structure Principles & Architecture Marjolein Thunnissen Dep. of Biochemistry & Structural Biology Lund University September 2011 Homology, pattern and 3D structure searches need
More informationThe Structure of Enzymes!
The Structure of Enzymes Levels of Protein Structure 0 order amino acid composition Primary Secondary Motifs Tertiary Domains Quaternary ther sequence repeating structural patterns defined by torsion angles
More informationThe Structure of Enzymes!
The Structure of Enzymes Levels of Protein Structure 0 order amino acid composition Primary Secondary Motifs Tertiary Domains Quaternary ther sequence repeating structural patterns defined by torsion angles
More informationTamer Barakat. Razi Kittaneh. Mohammed Bio. Diala Abu-Hassan
14 Tamer Barakat Razi Kittaneh Mohammed Bio Diala Abu-Hassan Protein structure: We already know that when two amino acids bind, a dipeptide is formed which is considered to be an oligopeptide. When more
More informationCh 3: Chemistry of Life. Chemistry Water Macromolecules Enzymes
Ch 3: Chemistry of Life Chemistry Water Macromolecules Enzymes Chemistry Atom = smallest unit of matter that cannot be broken down by chemical means Element = substances that have similar properties and
More informationEnzyme Catalysis & Biotechnology
L28-1 Enzyme Catalysis & Biotechnology Bovine Pancreatic RNase A Biochemistry, Life, and all that L28-2 A brief word about biochemistry traditionally, chemical engineers used organic and inorganic chemistry
More informationProtein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror
Protein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror Please interrupt if you have questions, and especially if you re confused! Assignment
More informationAdvanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions
BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start
More information2: CHEMICAL COMPOSITION OF THE BODY
1 2: CHEMICAL COMPOSITION OF THE BODY Although most students of human physiology have had at least some chemistry, this chapter serves very well as a review and as a glossary of chemical terms. In particular,
More informationBiochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture - 06 Protein Structure IV
Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur Lecture - 06 Protein Structure IV We complete our discussion on Protein Structures today. And just to recap
More informationLecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ].
Lecture 26: Polymers: DA Packing and Protein folding 26.1 Problem Set 4 due today. eading for Lectures 22 24: PKT hapter 8 DA Packing for Eukaryotes: The packing problem for the larger eukaryotic genomes
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationPROTEIN STRUCTURE AMINO ACIDS H R. Zwitterion (dipolar ion) CO 2 H. PEPTIDES Formal reactions showing formation of peptide bond by dehydration:
PTEI STUTUE ydrolysis of proteins with aqueous acid or base yields a mixture of free amino acids. Each type of protein yields a characteristic mixture of the ~ 20 amino acids. AMI AIDS Zwitterion (dipolar
More informationALL LECTURES IN SB Introduction
1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL
More informationBIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) PROTEINS
BIOLOGY BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) NAME NAME PERIOD PROTEINS GENERAL CHARACTERISTICS AND IMPORTANCES: Polymers of amino acids Each has unique 3-D shape Vary in sequence of amino
More informationBi 8 Midterm Review. TAs: Sarah Cohen, Doo Young Lee, Erin Isaza, and Courtney Chen
Bi 8 Midterm Review TAs: Sarah Cohen, Doo Young Lee, Erin Isaza, and Courtney Chen The Central Dogma Biology Fundamental! Prokaryotes and Eukaryotes Nucleic Acid Components Nucleic Acid Structure DNA Base
More informationProblem Set 1
2006 7.012 Problem Set 1 Due before 5 PM on FRIDAY, September 15, 2006. Turn answers in to the box outside of 68-120. PLEASE WRITE YOUR ANSWERS ON THIS PRINTOUT. 1. For each of the following parts, pick
More informationCentral Dogma. modifications genome transcriptome proteome
entral Dogma DA ma protein post-translational modifications genome transcriptome proteome 83 ierarchy of Protein Structure 20 Amino Acids There are 20 n possible sequences for a protein of n residues!
More informationUNIT TWELVE. a, I _,o "' I I I. I I.P. l'o. H-c-c. I ~o I ~ I / H HI oh H...- I II I II 'oh. HO\HO~ I "-oh
UNT TWELVE PROTENS : PEPTDE BONDNG AND POLYPEPTDES 12 CONCEPTS Many proteins are important in biological structure-for example, the keratin of hair, collagen of skin and leather, and fibroin of silk. Other
More informationOverview. The peptide bond. Page 1
Overview Secondary structure: the conformation of the peptide backbone The peptide bond, steric implications Steric hindrance and sterically allowed conformations. Ramachandran diagrams Side chain conformations
More informationBiochemistry Quiz Review 1I. 1. Of the 20 standard amino acids, only is not optically active. The reason is that its side chain.
Biochemistry Quiz Review 1I A general note: Short answer questions are just that, short. Writing a paragraph filled with every term you can remember from class won t improve your answer just answer clearly,
More informationAP Biology Unit 1, Chapters 2, 3, 4, 5
Name Date AP Biology Unit 1, Chapters 2, 3, 4, 5 Research Question How are chemical structures visualized? Background You can represent a molecule with either a molecular formula or a structural formula.
More informationHOMOLOGY MODELING. The sequence alignment and template structure are then used to produce a structural model of the target.
HOMOLOGY MODELING Homology modeling, also known as comparative modeling of protein refers to constructing an atomic-resolution model of the "target" protein from its amino acid sequence and an experimental
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationPresentation Outline. Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy
Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy Burkhard Rost and Chris Sander By Kalyan C. Gopavarapu 1 Presentation Outline Major Terminology Problem Method
More informationBIBC 100. Structural Biochemistry
BIBC 100 Structural Biochemistry http://classes.biology.ucsd.edu/bibc100.wi14 Papers- Dialogue with Scientists Questions: Why? How? What? So What? Dialogue Structure to explain function Knowledge Food
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationLecture 10 (10/4/17) Lecture 10 (10/4/17)
Lecture 10 (10/4/17) Reading: Ch4; 125, 138-141, 141-142 Problems: Ch4 (text); 7, 9, 11 Ch4 (study guide); 1, 2 NEXT Reading: Ch4; 125, 132-136 (structure determination) Ch4; 12-130 (Collagen) Problems:
More informationProtein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1
Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2
More informationProtein structure and folding
Protein structure and folding Levels of protein structure Theory of protein folding: Anfinsen s experiment Levinthal s paradox the folding funnel mode 05.11.2014. Amino acids and protein structure Protein
More informationMotif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
More informationCharged amino acids (side-chains)
Proteins are composed of monomers called amino acids There are 20 different amino acids Amine Group Central ydrocarbon N C C R Group Carboxyl Group ALL amino acids have the exact same structure except
More informationChem. 27 Section 1 Conformational Analysis Week of Feb. 6, TF: Walter E. Kowtoniuk Mallinckrodt 303 Liu Laboratory
Chem. 27 Section 1 Conformational Analysis TF: Walter E. Kowtoniuk wekowton@fas.harvard.edu Mallinckrodt 303 Liu Laboratory ffice hours are: Monday and Wednesday 3:00-4:00pm in Mallinckrodt 303 Course
More informationDihedral Angles. Homayoun Valafar. Department of Computer Science and Engineering, USC 02/03/10 CSCE 769
Dihedral Angles Homayoun Valafar Department of Computer Science and Engineering, USC The precise definition of a dihedral or torsion angle can be found in spatial geometry Angle between to planes Dihedral
More informationBSc and MSc Degree Examinations
Examination Candidate Number: Desk Number: BSc and MSc Degree Examinations 2018-9 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes Marking
More informationProperties of amino acids in proteins
Properties of amino acids in proteins one of the primary roles of DNA (but not the only one!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids repeated
More information1. What is an ångstrom unit, and why is it used to describe molecular structures?
1. What is an ångstrom unit, and why is it used to describe molecular structures? The ångstrom unit is a unit of distance suitable for measuring atomic scale objects. 1 ångstrom (Å) = 1 10-10 m. The diameter
More informationPeptides And Proteins
Kevin Burgess, May 3, 2017 1 Peptides And Proteins from chapter(s) in the recommended text A. Introduction B. omenclature And Conventions by amide bonds. on the left, right. 2 -terminal C-terminal triglycine
More informationCHAPTER 29 HW: AMINO ACIDS + PROTEINS
CAPTER 29 W: AMI ACIDS + PRTEIS For all problems, consult the table of 20 Amino Acids provided in lecture if an amino acid structure is needed; these will be given on exams. Use natural amino acids (L)
More informationBME Engineering Molecular Cell Biology. Structure and Dynamics of Cellular Molecules. Basics of Cell Biology Literature Reading
BME 42-620 Engineering Molecular Cell Biology Lecture 05: Structure and Dynamics of Cellular Molecules Basics of Cell Biology Literature Reading BME42-620 Lecture 05, September 13, 2011 1 Outline Review:
More informationRNA and Protein Structure Prediction
RNA and Protein Structure Prediction Bioinformatics: Issues and Algorithms CSE 308-408 Spring 2007 Lecture 18-1- Outline Multi-Dimensional Nature of Life RNA Secondary Structure Prediction Protein Structure
More informationGeometric Models for Secondary Structures in Proteins
Geometric Models for Secondary Structures in Proteins Magdalena Toda Department of Mathematics & Statistics Texas Tech University Lubbock, Texas. May 08, 2014 Magdalena Toda 1 / 1 Abstract ABSTRACT: This
More informationStudent Questions and Answers October 8, 2002
Student Questions and Answers October 8, 2002 Q l. Is the Cα of Proline also chiral? Answer: FK: Yes, there are 4 different residues bound to this C. Only in a strictly planar molecule this would not hold,
More informationTHE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION
THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION AND CALIBRATION Calculation of turn and beta intrinsic propensities. A statistical analysis of a protein structure
More informationBiomolecules: lecture 9
Biomolecules: lecture 9 - understanding further why amino acids are the building block for proteins - understanding the chemical properties amino acids bring to proteins - realizing that many proteins
More information1. (5) Draw a diagram of an isomeric molecule to demonstrate a structural, geometric, and an enantiomer organization.
Organic Chemistry Assignment Score. Name Sec.. Date. Working by yourself or in a group, answer the following questions about the Organic Chemistry material. This assignment is worth 35 points with the
More informationBasic structures of proteins
Basic structures of proteins Structural Hierarchy of Protein Primary structure Functional elements : α-helix, strands, β-sheet, loops.. - Structure, affinity, activity, specificity, stability etc. Secondary
More informationStatistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics
Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More information7.88J Protein Folding Problem Fall 2007
MIT OpenCourseWare http://ocw.mit.edu 7.88J Protein Folding Problem Fall 2007 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. Lecture Notes - 3 7.24/7.88J/5.48J
More informationUseful background reading
Overview of lecture * General comment on peptide bond * Discussion of backbone dihedral angles * Discussion of Ramachandran plots * Description of helix types. * Description of structures * NMR patterns
More informationProtein Structure Marianne Øksnes Dalheim, PhD candidate Biopolymers, TBT4135, Autumn 2013
Protein Structure Marianne Øksnes Dalheim, PhD candidate Biopolymers, TBT4135, Autumn 2013 The presentation is based on the presentation by Professor Alexander Dikiy, which is given in the course compedium:
More information4) Chapter 1 includes heredity (i.e. DNA and genes) as well as evolution. Discuss the connection between heredity and evolution?
Name- Chapters 1-5 Questions 1) Life is easy to recognize but difficult to define. The dictionary defines life as the state or quality that distinguishes living beings or organisms from dead ones and from
More information1/23/2012. Atoms. Atoms Atoms - Electron Shells. Chapter 2 Outline. Planetary Models of Elements Chemical Bonds
Chapter 2 Outline Atoms Chemical Bonds Acids, Bases and the p Scale Organic Molecules Carbohydrates Lipids Proteins Nucleic Acids Are smallest units of the chemical elements Composed of protons, neutrons
More informationProtein Secondary Structure Prediction
Protein Secondary Structure Prediction Doug Brutlag & Scott C. Schmidler Overview Goals and problem definition Existing approaches Classic methods Recent successful approaches Evaluating prediction algorithms
More informationUnit 1: Chemistry - Guided Notes
Scientific Method Notes: Unit 1: Chemistry - Guided Notes 1 Common Elements in Biology: Atoms are made up of: 1. 2. 3. In order to be stable, an atom of an element needs a full valence shell of electrons.
More informationSection Week 3. Junaid Malek, M.D.
Section Week 3 Junaid Malek, M.D. Biological Polymers DA 4 monomers (building blocks), limited structure (double-helix) RA 4 monomers, greater flexibility, multiple structures Proteins 20 Amino Acids,
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationIt s really this simple.
Background Light harvesting complexes exist to facilitate and maximize the absorption capacity of the reaction centers (RC) as well as PSI and PSII Purple bacteria utilize these functions by having an
More informationDetails of Protein Structure
Details of Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Anne Mølgaard, Kemisk Institut, Københavns Universitet Learning Objectives
More informationGetting To Know Your Protein
Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research
More information