RNA and Protein Structure Prediction
|
|
- Patience King
- 6 years ago
- Views:
Transcription
1 RNA and Protein Structure Prediction Bioinformatics: Issues and Algorithms CSE Spring 2007 Lecture 18-1-
2 Outline Multi-Dimensional Nature of Life RNA Secondary Structure Prediction Protein Structure Determination Protein Threading -2-
3 Life is not one-dimensional Secondary and tertiary structures for trna (tranfser RNA) Sample protein structures
4 RNA secondary structure: Base-pairing rules similar to basic sequence alignment. Unlike DNA, single-stranded RNA can fold back on itself. Recall that C-G and A-U form stable pairs ( Watson-Crick ). In addition, G-U forms a weaker pair ( wobble ) RNA secondary structure
5 Modeling RNA secondary structure Let R = r1r2... rn be an RNA sequence, where ri {A, C, G, U}. A secondary structure is a set of ordered pairs (i, j) such that: (1) j i > 4 pairing can't be too tight (2) if (i, j) and (i', j') are two base pairs, with i i', then either: (a) i = i' and j = j' i.e., same base pair or (b) i < j < i' < j' (i, j) precedes (i', j') or (c) i < i' < j' < j (i, j) encloses (i', j') This is also known as a folding
6 Visualizing RNA secondary structure Circular representation Computer predicted folding of Bacillus subtilis RNase P RNA H M = multi-loop I = interior loop B = bulge loop H = hairpin loop I base 0 I B I base 400 I H M H Dot plot representation H M H H M H M Hlower base pair precedes upper pair (i < j < i' < j') H M I H H this base pair encloses H all others (i < i' < j' < j ) place dot for each (i, j) pair
7 Predicting RNA secondary structure Premise: Base pairings have a stabilizing effect on a structure's free energy. Loops have a destabiling effect. Goal: to determine a secondary structure with minimum free energy. Hairpin loop Stacked base pairs Two popular approaches: Ignore loops, maximize number of base pairings (a bit simplistic, but leads to a nice algorithm). Employ loop-specific energy models (more realistic, but also more complex algorithms). -7-
8 An approach for predicting RNA secondary structure Assumption: Energy of each base pair is independent of all other base pairs and of loop structure. Consequence: Total free energy is sum of energies for all base pairs. Downside: Predictions only approximate reality. Key observation: We can use solutions for shorter subsequences to determine solution for longer sequences. Should sound familiar: precisely the kind of decoupling required for dynamic programming to work. -8-
9 Notation and definitions S(i, j) = secondary structure of RNA strand (i.e., set of base pairings) from base ri to base rj, inclusive. e(a, b) = free energy of base pair (a, b). E(S(i, j)) = free energy of secondary structure S(i, j). So we have: E S i, j = e a, b a, b S i, j Note: we can define e(a, b) to be a very large value when physical constraints are violated (e.g., b a 4, so that hairpin loop would be too tight). -9-
10 Algorithm for predicting RNA secondary structure Consider RNA strand from base position i to base position j: What is optimal folding for this? ri rk rj-1 rj Two possible cases depending on whether rj base-pairs: If rj does not base-pair, then E(S(i, j)) = E(S(i, j-1)). We already computed this. ri rk rj-1 rj If rj does pair, E(S(i, j)) = E(S(i, k-1)) + e(k, j) + E(S(k+1, j-1)). Already computed. ri Already computed. rk rj rj
11 Algorithm for predicting RNA secondary structure Optimize free energy over increasingly longer subsequences. For each partial folding S(i, j), free energy is given by: E S i, j = { min E S i 1, j 1 e i, j min {E S i, k 1 e k, j E S k 1, j 1 } for i k j Free energy of optimal folding for entire strand is E(S(1,n)). How do we deal with case where ri is not paired? Define e(k, j) to be 0 when k = j }
12 Time and space complexity What are time and space requirements of this algorithm? For each partial folding S(i, j), free energy is given by: E S i, j = { min E S i 1, j 1 e i, j min {E S i, k 1 e k, j E S k 1, j 1 } for i k j For RNA sequence of length n, we must be an n x n matrix. Each entry requires exploring an average of n/2 values for k. Hence, time complexity is O(n3), space complexity is O(n2) }
13 Summary of RNA secondary structure prediction #1 General summary of the situation: Tertiary structure is difficult to model and compute. Determining secondary structure is more amendable to a solution. While only an approximation, it gives good hints. No knots planar graph. Solved using dynamic programming in O(n3) time
14 Summary of RNA secondary structure prediction #2 Better results can be obtained by modeling loops. This problem is also solvable in O(n3) time using some tricks. Bulge Hairpin loop red = destabilizing ( bad ) green = stabilizing ( good ) Helical region Interior loop
15 Protein structure Primary structure of protein is determined by number and order of amino acids within polypeptide chain. Protein's secondary structure is defined as local conformation of its backbone, which consists of molecules that make up an amino acid's frame excluding side chains. Two common motifs include beta-pleated sheets and alpha helices. Tertiary structure is formed when attractions of side chains and secondary structure combine to form distinct 3-dimensional structure. This gives protein its specific function. Sometimes distinct proteins must combine to form correct 3-dimensional structure for a particular protein to function properly. E.g., hemoglobin is made of four similar proteins that combine to form its quaternary structure
16 Protein structure
17 Sequence structure function structure medicine sequence function
18 How is true 3-D structure determined? As of today, must be determined experimentally. Techniques include x-ray crystallography and NMR. diffraction pattern
19 X-ray crystallography A diffraction pattern: the white spots are the reflections
20 From electron density map to structure
21 Protein structure determination backbone... w/ side chains electron density map
22 Two common protein secondary structures Alpha Helix R groups of amino acids all extend to outside. Helix makes a complete turn every 3.6 amino acids. Helix is right-handed; it twists in clockwise direction. Carbonyl group (-C=O) of each peptide bond extends parallel to axis of helix and points directly at -N-H group of peptide bond 4 amino acids below it in helix. A hydrogen bond forms between them [-N-H O=C-]. Beta Conformation Consists of pairs of chains lying side-by-side and stabilized by hydrogen bonds between carbonyl oxygen atom on one chain and -NH group on adjacent chain. Chains are often "anti-parallel"; N-terminal to C-terminal direction of one being reverse of other
23 Alpha helix Alpha-helix (also written α-helix) is rod-like structure stabilized by hydrogen bonds between CO and NH groups of main chain. Ribbon representation of righthanded alpha-helix with only the alpha carbons represented. Examining backbone structure, note that alpha carbons spaced three and four in linear sequence are actually quite close together in helix structure. The hydrogen bonds are shown in green; all main chain CO and NH groups are hydrogen bonded. This structure is quite sturdy
24 Beta sheet
25 Protein structure Some proteins are made up of mostly alpha helicies. Both marine bloodworm hemoglobin (left) and E. coli cytochrome B562 (right) are composed of mostly alpha helicies. The 4 helix bundle of the cytochrome is a common motif. Some are mostly beta sheet. The green alga plastocyanin (left) and sea snake neurotoxin (right) are mostly beta sheets. Red = alpha helix Green = beta sheet Black = misc. loops
26 Protein structure Many proteins are a mix of alpha helicies and beta sheets. Two simple proteins with a mix of 2o components: ribonuclease T1 (left) and pancreatic trypsin inhibitor (right)
27 Protein Domains Tertiary structure of many proteins is built from several domains. Often each has a separate function to perform, such as: binding a small ligand (e.g., a peptide in the molecule shown here) spanning the plasma membrane (transmembrane proteins) containing the catalytic site (enzymes) DNA-binding (in transcription factors) providing a surface to bind specifically to another protein. In some cases, each domain is encoded by a separate exon in the gene. The histocompatibility molecule shown here has three domains: α1, α2, and α3 are each encoded by its own exon
28 Moving towards protein structure prediction... Most important information seems to be contained in alpha helices and beta sheets (which form core), not in loops. Given amino acid sequence, we want to determine locations of helices, sheets, and loops, and their arrangements. How to do this? Experimental techniques are expensive and time-consuming. Exhaustive enumeration at molecular level (taking structure with smallest free energy)? Nah... As of 2002, the NIH protein structure database contained approximately 15,000 entries. Hmm... Idea: given sequence, see if it could fit a known structure. This is known as protein threading
29 PDB new vs. old folding growth Old fold New fold Number of unique folds in nature is fairly small (possibly a few thousands). 90% of new structures submitted to PDB in the past three years have similar structural folds in PDB
30 Protein threading Somewhat similar to sequence alignment we studied earlier: homology modeling: align sequence to sequence, threading: align sequence to structure (templates)
31 The protein threading problem Given: new protein sequence, and library of templates: Find: best alignment of sequence to some template
32 The protein threading problem One possible threading (note non-local interactions):
33 The protein threading problem Input: 1. Protein sequence A with n amino acids ai. 2. Core structural model C, with m core segments Ci. Also: (a) Length ci of each core segment. (b) Core segments Ci and Ci+1 are connected by loop λi for which we know max (lmaxi) and min (lmini) lengths. (c) Structural environment for each amino acid position. 3. Scoring function f(t) to evaluate each threading T. Output: set of integers T = {t1, t2,..., tm} such that value of ti indicates which amino acid from A occupies first position in core segment i
34 Core templates with interactions Small circles represent amino acid positions. Thin lines indicate interactions represented in model
35 The protein threading problem Possible threadings: Unfortunately, due to variable-length gaps between core segments and non-local interactions, this problem is NP-hard. Fortunately, it is amenable to solution by a general-purpose optimization strategy known as branch-and-bound
36 Digression: branch-and-bound Basic idea: Partion solution space into distinct sets. Compute lower bound that applies to all solutions in given set. If we can find a solution that is better than this lower bound, we don't need to explore any solution in that set. Important note: branch and bound will find optimal solution (it's not heuristic)... but... it might take exponential time to do it. Still, it is often much faster than naive exhaustive search
37 Digression: branch-and-bound Let's see how this works for the traveling salesman problem, which we know is also NP-complete (protein threading is a bit too complicated for now). Given: a set of cities and costs to travel between them. Find: a minimum cost tour that visits each city once. A B 7 5 D C 2 5 E A B C D E A B C D E
38 Branch-and-bound Start search at A: Now let's try going from A to C: A A 2 12 B B C C 3 B +3=5 C =7 D 5 D E D + 4 = 11 E E + 2 = 13 No point in exploring any of these subtrees any further! Total cost for this tour is
39 Branch-and-bound In traveling salesman, we were able to eliminate from consideration all tours starting with: A-C-B-... and A-C-D-... and A-C-E-... because we knew they could never be optimal; we already had a tour with total cost less than their partial costs. General observation: complete solution with cost w partial solutions lower bound x w partial solutions lower bound y < w partial solutions lower bound z < y don't bother exploring this explore this if/when bound becomes best explore this first
40 Back to protein threading... Recall that ti indicates which amino acid occupies the first position in core segment i. Our scoring function is: f T = g 1 i, t i g 2 i, j, t i, t j i i j i As we know sizes of core segments and min and max lengths for loops, we can determine ranges for ti's. di-1 ti di di This will form basis for branchand-bound.
41 Branch-and-bound for protein threading Given a set of threadings T *, the optimization problem is: min f T = min g 1 i, t i g 2 i, j, t i, t j T T * T T * i i [ j i = min g 1 i, t i g 2 i, j, t i, t j T T * i j i ] What's a lower bound we can use? i [ min g 1 i, x min g 2 i, j, y, z bi x d i j i bi y d i b j z d j ] Note this is determined by the interval [bi, di] that ti may fall in
42 Branch-and-bound for protein threading Now we must split solution space into disjoint sets. Do this by selecting largest current interval for a ti and cutting it in half
43 Branch-and-bound for protein threading
44 CAFASP3 Example CAFASP: Critical Assessment of Fully Automated Structure Prediction CAFASP3 evaluated by MaxSub, a computer program. Predicted structures are superimposed to the experimental structures to see how long is superimposable. Red: Experimental Structure Blue: Correct Prediction Green: Incorrect Prediction
45 Wrap-up Readings for next time: "The Invention of the Genetic Code," Brian Hayes, American Scientist, vol. 86, no. 1, Jan. Feb., 1998, pp "Ode to the Code," Brian Hayes, American Scientist, vol. 92, no. 6, Nov. Dec., 2004, pp (Both papers are in the Readings folder on Blackboard.) Remember: Come to class having done the readings. Check Blackboard regularly for updates
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationBio nformatics. Lecture 23. Saad Mneimneh
Bio nformatics Lecture 23 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely
More informationProtein folding. α-helix. Lecture 21. An α-helix is a simple helix having on average 10 residues (3 turns of the helix)
Computat onal Biology Lecture 21 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationProtein Structure Basics
Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationCOMP 598 Advanced Computational Biology Methods & Research. Introduction. Jérôme Waldispühl School of Computer Science McGill University
COMP 598 Advanced Computational Biology Methods & Research Introduction Jérôme Waldispühl School of Computer Science McGill University General informations (1) Office hours: by appointment Office: TR3018
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationModel Mélange. Physical Models of Peptides and Proteins
Model Mélange Physical Models of Peptides and Proteins In the Model Mélange activity, you will visit four different stations each featuring a variety of different physical models of peptides or proteins.
More informationBiomolecules: lecture 10
Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More information98 Algorithms in Bioinformatics I, WS 06, ZBIT, D. Huson, December 6, 2006
98 Algorithms in Bioinformatics I, WS 06, ZBIT, D. Huson, December 6, 2006 8.3.1 Simple energy minimization Maximizing the number of base pairs as described above does not lead to good structure predictions.
More informationCombinatorial approaches to RNA folding Part I: Basics
Combinatorial approaches to RNA folding Part I: Basics Matthew Macauley Department of Mathematical Sciences Clemson University http://www.math.clemson.edu/~macaule/ Math 4500, Spring 2015 M. Macauley (Clemson)
More informationProtein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds
Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino
More informationFrom Amino Acids to Proteins - in 4 Easy Steps
From Amino Acids to Proteins - in 4 Easy Steps Although protein structure appears to be overwhelmingly complex, you can provide your students with a basic understanding of how proteins fold by focusing
More informationExamples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE
Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationHomology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB
Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded
More informationWhat is the central dogma of biology?
Bellringer What is the central dogma of biology? A. RNA DNA Protein B. DNA Protein Gene C. DNA Gene RNA D. DNA RNA Protein Review of DNA processes Replication (7.1) Transcription(7.2) Translation(7.3)
More informationD Dobbs ISU - BCB 444/544X 1
11/7/05 Protein Structure: Classification, Databases, Visualization Announcements BCB 544 Projects - Important Dates: Nov 2 Wed noon - Project proposals due to David/Drena Nov 4 Fri PM - Approvals/responses
More informationBi 8 Midterm Review. TAs: Sarah Cohen, Doo Young Lee, Erin Isaza, and Courtney Chen
Bi 8 Midterm Review TAs: Sarah Cohen, Doo Young Lee, Erin Isaza, and Courtney Chen The Central Dogma Biology Fundamental! Prokaryotes and Eukaryotes Nucleic Acid Components Nucleic Acid Structure DNA Base
More informationMolecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007
Molecular Modeling Prediction of Protein 3D Structure from Sequence Vimalkumar Velayudhan Jain Institute of Vocational and Advanced Studies May 21, 2007 Vimalkumar Velayudhan Molecular Modeling 1/23 Outline
More informationOrientational degeneracy in the presence of one alignment tensor.
Orientational degeneracy in the presence of one alignment tensor. Rotation about the x, y and z axes can be performed in the aligned mode of the program to examine the four degenerate orientations of two
More information1/23/2012. Atoms. Atoms Atoms - Electron Shells. Chapter 2 Outline. Planetary Models of Elements Chemical Bonds
Chapter 2 Outline Atoms Chemical Bonds Acids, Bases and the p Scale Organic Molecules Carbohydrates Lipids Proteins Nucleic Acids Are smallest units of the chemical elements Composed of protons, neutrons
More informationDana Alsulaibi. Jaleel G.Sweis. Mamoon Ahram
15 Dana Alsulaibi Jaleel G.Sweis Mamoon Ahram Revision of last lectures: Proteins have four levels of structures. Primary,secondary, tertiary and quaternary. Primary structure is the order of amino acids
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More informationMotif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
More informationProtein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1
Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2
More informationConformational Geometry of Peptides and Proteins:
Conformational Geometry of Peptides and Proteins: Before discussing secondary structure, it is important to appreciate the conformational plasticity of proteins. Each residue in a polypeptide has three
More informationDetails of Protein Structure
Details of Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Anne Mølgaard, Kemisk Institut, Københavns Universitet Learning Objectives
More informationThe Structure and Functions of Proteins
Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science and Engineering 2003 The Structure and Functions of Proteins Dan E. Krane Wright State University
More informationAdvanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions
BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start
More informationProtein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror
Protein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror Please interrupt if you have questions, and especially if you re confused! Assignment
More informationChapter
Chapter 17 17.4-17.6 Molecular Components of Translation A cell interprets a genetic message and builds a polypeptide The message is a series of codons on mrna The interpreter is called transfer (trna)
More informationAnalysis and Prediction of Protein Structure (I)
Analysis and Prediction of Protein Structure (I) Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 2006 Free for academic use. Copyright @ Jianlin Cheng
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationRNA-Strukturvorhersage Strukturelle Bioinformatik WS16/17
RNA-Strukturvorhersage Strukturelle Bioinformatik WS16/17 Dr. Stefan Simm, 01.11.2016 simm@bio.uni-frankfurt.de RNA secondary structures a. hairpin loop b. stem c. bulge loop d. interior loop e. multi
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More information1. (5) Draw a diagram of an isomeric molecule to demonstrate a structural, geometric, and an enantiomer organization.
Organic Chemistry Assignment Score. Name Sec.. Date. Working by yourself or in a group, answer the following questions about the Organic Chemistry material. This assignment is worth 35 points with the
More informationEnzyme Catalysis & Biotechnology
L28-1 Enzyme Catalysis & Biotechnology Bovine Pancreatic RNase A Biochemistry, Life, and all that L28-2 A brief word about biochemistry traditionally, chemical engineers used organic and inorganic chemistry
More informationMULTIPLE CHOICE. Circle the one alternative that best completes the statement or answers the question.
Summer Work Quiz - Molecules and Chemistry Name MULTIPLE CHOICE. Circle the one alternative that best completes the statement or answers the question. 1) The four most common elements in living organisms
More information1. What is an ångstrom unit, and why is it used to describe molecular structures?
1. What is an ångstrom unit, and why is it used to describe molecular structures? The ångstrom unit is a unit of distance suitable for measuring atomic scale objects. 1 ångstrom (Å) = 1 10-10 m. The diameter
More informationProtein Threading. BMI/CS 776 Colin Dewey Spring 2015
Protein Threading BMI/CS 776 www.biostat.wisc.edu/bmi776/ Colin Dewey cdewey@biostat.wisc.edu Spring 2015 Goals for Lecture the key concepts to understand are the following the threading prediction task
More informationCh 3: Chemistry of Life. Chemistry Water Macromolecules Enzymes
Ch 3: Chemistry of Life Chemistry Water Macromolecules Enzymes Chemistry Atom = smallest unit of matter that cannot be broken down by chemical means Element = substances that have similar properties and
More informationBCH 4053 Spring 2003 Chapter 6 Lecture Notes
BCH 4053 Spring 2003 Chapter 6 Lecture Notes 1 CHAPTER 6 Proteins: Secondary, Tertiary, and Quaternary Structure 2 Levels of Protein Structure Primary (sequence) Secondary (ordered structure along peptide
More informationStructure-Based Comparison of Biomolecules
Structure-Based Comparison of Biomolecules Benedikt Christoph Wolters Seminar Bioinformatics Algorithms RWTH AACHEN 07/17/2015 Outline 1 Introduction and Motivation Protein Structure Hierarchy Protein
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2004 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More informationCopyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years.
Structure Determination and Sequence Analysis The vast majority of the experimentally determined three-dimensional protein structures have been solved by one of two methods: X-ray diffraction and Nuclear
More informationPacking of Secondary Structures
7.88 Lecture Notes - 4 7.24/7.88J/5.48J The Protein Folding and Human Disease Professor Gossard Retrieving, Viewing Protein Structures from the Protein Data Base Helix helix packing Packing of Secondary
More informationSupersecondary Structures (structural motifs)
Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric
More informationFrom gene to protein. Premedical biology
From gene to protein Premedical biology Central dogma of Biology, Molecular Biology, Genetics transcription replication reverse transcription translation DNA RNA Protein RNA chemically similar to DNA,
More informationProtein Structures: Experiments and Modeling. Patrice Koehl
Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:
More informationALL LECTURES IN SB Introduction
1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL
More informationObjective: Students will be able identify peptide bonds in proteins and describe the overall reaction between amino acids that create peptide bonds.
Scott Seiple AP Biology Lesson Plan Lesson: Primary and Secondary Structure of Proteins Purpose:. To understand how amino acids can react to form peptides through peptide bonds.. Students will be able
More informationComputational Biology: Basics & Interesting Problems
Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information
More informationBioinformatics. Macromolecular structure
Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure Structure analysis Structure alignment Domain
More informationUnit 1: Chemistry - Guided Notes
Scientific Method Notes: Unit 1: Chemistry - Guided Notes 1 Common Elements in Biology: Atoms are made up of: 1. 2. 3. In order to be stable, an atom of an element needs a full valence shell of electrons.
More informationFinal Chem 4511/6501 Spring 2011 May 5, 2011 b Name
Key 1) [10 points] In RNA, G commonly forms a wobble pair with U. a) Draw a G-U wobble base pair, include riboses and 5 phosphates. b) Label the major groove and the minor groove. c) Label the atoms of
More informationCHEM 463: Advanced Inorganic Chemistry Modeling Metalloproteins for Structural Analysis
CHEM 463: Advanced Inorganic Chemistry Modeling Metalloproteins for Structural Analysis Purpose: The purpose of this laboratory is to introduce some of the basic visualization and modeling tools for viewing
More informationAP Biology. Proteins. AP Biology. Proteins. Multipurpose molecules
Proteins Proteins Multipurpose molecules 2008-2009 1 Proteins Most structurally & functionally diverse group Function: involved in almost everything u enzymes (pepsin, DNA polymerase) u structure (keratin,
More informationF. Piazza Center for Molecular Biophysics and University of Orléans, France. Selected topic in Physical Biology. Lecture 1
Zhou Pei-Yuan Centre for Applied Mathematics, Tsinghua University November 2013 F. Piazza Center for Molecular Biophysics and University of Orléans, France Selected topic in Physical Biology Lecture 1
More informationRead more about Pauling and more scientists at: Profiles in Science, The National Library of Medicine, profiles.nlm.nih.gov
2018 Biochemistry 110 California Institute of Technology Lecture 2: Principles of Protein Structure Linus Pauling (1901-1994) began his studies at Caltech in 1922 and was directed by Arthur Amos oyes to
More informationProtein Structure and Function. Protein Architecture:
BCHS 6229 Protein Structure and Function Lecture 2 (October 13, 2011) Protein Architecture: Symmetry relationships and protein structure Primary & Secondary Structure Motifs & Super-secondary Structure
More informationproteins are the basic building blocks and active players in the cell, and
12 RN Secondary Structure Sources for this lecture: R. Durbin, S. Eddy,. Krogh und. Mitchison, Biological sequence analysis, ambridge, 1998 J. Setubal & J. Meidanis, Introduction to computational molecular
More informationAlgorithms in Computational Biology (236522) spring 2008 Lecture #1
Algorithms in Computational Biology (236522) spring 2008 Lecture #1 Lecturer: Shlomo Moran, Taub 639, tel 4363 Office hours: 15:30-16:30/by appointment TA: Ilan Gronau, Taub 700, tel 4894 Office hours:??
More informationProtein Structure Prediction Using Multiple Artificial Neural Network Classifier *
Protein Structure Prediction Using Multiple Artificial Neural Network Classifier * Hemashree Bordoloi and Kandarpa Kumar Sarma Abstract. Protein secondary structure prediction is the method of extracting
More informationBME 5742 Biosystems Modeling and Control
BME 5742 Biosystems Modeling and Control Lecture 24 Unregulated Gene Expression Model Dr. Zvi Roth (FAU) 1 The genetic material inside a cell, encoded in its DNA, governs the response of a cell to various
More informationAnnouncements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure
Announcements TA Office Hours: Brian Eckenroth Monday 3-4 pm Thursday 11 am-12 pm Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Margaret Daugherty Fall 2003 Homework II posted
More informationNewly made RNA is called primary transcript and is modified in three ways before leaving the nucleus:
m Eukaryotic mrna processing Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: Cap structure a modified guanine base is added to the 5 end. Poly-A tail
More informationTable 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2
Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell
More informationBA, BSc, and MSc Degree Examinations
Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes
More informationNMR, X-ray Diffraction, Protein Structure, and RasMol
NMR, X-ray Diffraction, Protein Structure, and RasMol Introduction So far we have been mostly concerned with the proteins themselves. The techniques (NMR or X-ray diffraction) used to determine a structure
More informationCS273: Algorithms for Structure Handout # 2 and Motion in Biology Stanford University Thursday, 1 April 2004
CS273: Algorithms for Structure Handout # 2 and Motion in Biology Stanford University Thursday, 1 April 2004 Lecture #2: 1 April 2004 Topics: Kinematics : Concepts and Results Kinematics of Ligands and
More informationBIRKBECK COLLEGE (University of London)
BIRKBECK COLLEGE (University of London) SCHOOL OF BIOLOGICAL SCIENCES M.Sc. EXAMINATION FOR INTERNAL STUDENTS ON: Postgraduate Certificate in Principles of Protein Structure MSc Structural Molecular Biology
More information15.2 Prokaryotic Transcription *
OpenStax-CNX module: m52697 1 15.2 Prokaryotic Transcription * Shannon McDermott Based on Prokaryotic Transcription by OpenStax This work is produced by OpenStax-CNX and licensed under the Creative Commons
More information1. Protein Data Bank (PDB) 1. Protein Data Bank (PDB)
Protein structure databases; visualization; and classifications 1. Introduction to Protein Data Bank (PDB) 2. Free graphic software for 3D structure visualization 3. Hierarchical classification of protein
More informationRNA & PROTEIN SYNTHESIS. Making Proteins Using Directions From DNA
RNA & PROTEIN SYNTHESIS Making Proteins Using Directions From DNA RNA & Protein Synthesis v Nitrogenous bases in DNA contain information that directs protein synthesis v DNA remains in nucleus v in order
More informationPresentation Outline. Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy
Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy Burkhard Rost and Chris Sander By Kalyan C. Gopavarapu 1 Presentation Outline Major Terminology Problem Method
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2003 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More informationLS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor
LS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor Note: Adequate space is given for each answer. Questions that require a brief explanation should
More informationDesign of a Novel Globular Protein Fold with Atomic-Level Accuracy
Design of a Novel Globular Protein Fold with Atomic-Level Accuracy Brian Kuhlman, Gautam Dantas, Gregory C. Ireton, Gabriele Varani, Barry L. Stoddard, David Baker Presented by Kate Stafford 4 May 05 Protein
More informationMotivating the need for optimal sequence alignments...
1 Motivating the need for optimal sequence alignments... 2 3 Note that this actually combines two objectives of optimal sequence alignments: (i) use the score of the alignment o infer homology; (ii) use
More informationTypes of RNA. 1. Messenger RNA(mRNA): 1. Represents only 5% of the total RNA in the cell.
RNAs L.Os. Know the different types of RNA & their relative concentration Know the structure of each RNA Understand their functions Know their locations in the cell Understand the differences between prokaryotic
More informationProperties of amino acids in proteins
Properties of amino acids in proteins one of the primary roles of DNA (but not the only one!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids repeated
More informationProtein Secondary Structure Prediction
Protein Secondary Structure Prediction Doug Brutlag & Scott C. Schmidler Overview Goals and problem definition Existing approaches Classic methods Recent successful approaches Evaluating prediction algorithms
More informationProtein Structure. Role of (bio)informatics in drug discovery. Bioinformatics
Bioinformatics Protein Structure Principles & Architecture Marjolein Thunnissen Dep. of Biochemistry & Structural Biology Lund University September 2011 Homology, pattern and 3D structure searches need
More informationBiochemistry Quiz Review 1I. 1. Of the 20 standard amino acids, only is not optically active. The reason is that its side chain.
Biochemistry Quiz Review 1I A general note: Short answer questions are just that, short. Writing a paragraph filled with every term you can remember from class won t improve your answer just answer clearly,
More informationProtein Structure & Motifs
& Motifs Biochemistry 201 Molecular Biology January 12, 2000 Doug Brutlag Introduction Proteins are more flexible than nucleic acids in structure because of both the larger number of types of residues
More informationIntroduction to Protein Folding
Introduction to Protein Folding Chapter 4 Proteins: Three Dimensional Structure and Function Conformation - three dimensional shape Native conformation - each protein folds into a single stable shape (physiological
More informationReview. Membrane proteins. Membrane transport
Quiz 1 For problem set 11 Q1, you need the equation for the average lateral distance transversed (s) of a molecule in the membrane with respect to the diffusion constant (D) and time (t). s = (4 D t) 1/2
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationTHE UNIVERSITY OF MANITOBA. PAPER NO: 409 LOCATION: Fr. Kennedy Gold Gym PAGE NO: 1 of 6 DEPARTMENT & COURSE NO: CHEM 4630 TIME: 3 HOURS
PAPER NO: 409 LOCATION: Fr. Kennedy Gold Gym PAGE NO: 1 of 6 DEPARTMENT & COURSE NO: CHEM 4630 TIME: 3 HOURS EXAMINATION: Biochemistry of Proteins EXAMINER: J. O'Neil Section 1: You must answer all of
More informationNGF - twenty years a-growing
NGF - twenty years a-growing A molecule vital to brain growth It is twenty years since the structure of nerve growth factor (NGF) was determined [ref. 1]. This molecule is more than 'quite interesting'
More informationGetting To Know Your Protein
Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research
More informationBiochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture - 06 Protein Structure IV
Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur Lecture - 06 Protein Structure IV We complete our discussion on Protein Structures today. And just to recap
More informationHIV protease inhibitor. Certain level of function can be found without structure. But a structure is a key to understand the detailed mechanism.
Proteins are linear polypeptide chains (one or more) Building blocks: 20 types of amino acids. Range from a few 10s-1000s They fold into varying three-dimensional shapes structure medicine Certain level
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationHMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder
HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding
More informationProtein Structures. 11/19/2002 Lecture 24 1
Protein Structures 11/19/2002 Lecture 24 1 All 3 figures are cartoons of an amino acid residue. 11/19/2002 Lecture 24 2 Peptide bonds in chains of residues 11/19/2002 Lecture 24 3 Angles φ and ψ in the
More informationBIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) PROTEINS
BIOLOGY BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) NAME NAME PERIOD PROTEINS GENERAL CHARACTERISTICS AND IMPORTANCES: Polymers of amino acids Each has unique 3-D shape Vary in sequence of amino
More information