Protein Secondary Structure Prediction
|
|
- Tyler Welch
- 5 years ago
- Views:
Transcription
1 Protein Secondary Structure Prediction Doug Brutlag & Scott C. Schmidler
2 Overview Goals and problem definition Existing approaches Classic methods Recent successful approaches Evaluating prediction algorithms Shortcomings of existing approaches Current research
3 Protein structure prediction Sequence of 984 amino acids: PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIG PENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKK KKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGW KGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEE LRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVN DIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAEN REILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARM RGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQA TWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVT NKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQP DKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIG PENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKK KKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGW KGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEE LRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVN DIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAELELAEN REILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARM RGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQA TWIPEWEFVNTPPLVKLWYQ HIV reverse transcriptase 3D coordinates of 7404 atoms:
4 Abstracting the problem 3D coords of all atoms: 3D coords of C-α backbone: 3D coords of secondary structure elements: C-α groups:
5 Secondary structure prediction for protein folding Sequence of amino acids: Predict structural segments: Goal: Recover 3D coords PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEK EGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQD FWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTA FTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFK KQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLT TPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQ KLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAEL ELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQE PFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTP KFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE KEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTT NQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESE LVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEK EGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQD FWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTA FTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFK KQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLT TPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQ KLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAEL ELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQE PFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTP KFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ The secondary structure prediction problem: Given a protein sequence: NWVLST VLSTAADMQGVVTDGMASGLDKD... D... Predict a secondary structure sequence: LLEEEE EEEELLLLHHHHHHHHHHLHHHL... H = α-helix E = Extended β- strand L = Loop/coil
6 Defining the secondary structure of a protein sequence α-helix and anti-parallel β sheet: Residue Sequence: Secondary Structure: NWVLSTAADMQGVVTDGMASFLDKD LLEEEELLLLHHHHHHHHHHLHHHL Fig. 1: Syntactic formulation of secondary structure problem
7 Abstracted version of protein structure prediction Sequence of 984 amino acids: 3D coords of 179 structural elements: PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIG PENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKK KKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGW KGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEE LRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVN DIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAEN REILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARM RGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQA TWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVT NKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQP DKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIG PENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKK KKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGW KGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEE LRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVN DIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAELELAEN REILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARM RGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQA TWIPEWEFVNTPPLVKLWYQ
8 The Secondary Structure Prediction problem Given a protein sequence: NWVLST VLSTAADMQGVVTDGMASGLDKD... D... Predict a secondary structure sequence: LLEEEE EEEELLLLHHHHHHHHHHLHHHL... 3-state problem: {ARNDCQEGHILKMFPSTWYV} n -> {L,H,E} n
9 Chou-Fasman method (Chou & Fasman, 1974) Calculate propensity for each amino acid to be in helix, strand, coil ( ) P( A) P A S = n A,S n S n A n Classify by propensity
10 Chou-Fasman prediction Search for nucleation sites helix nucleation: score > 4 in window of 6 where Propagate to until termination criteria met helix termination: tetrapeptide with mean propensity < 1 Rules for conflict resolution, exceptions Accuracy: 70-80% (< 55% Nishikawa, 83)
11 GOR (Garnier et al,1978) Calculate information content for each amino acid: I( S; R) = log[ P( S R) P( S) ] (same as CF propensity ) Information difference ( ) = I( S;R) I ( S;R) ( ) P ( S, R) I S; R = log P S, R (likelihood ratio) [ ] + log[ P ( S) P( S) ] Predict max using window of size 17 Accuracy: 64% (< 55% Nishikawa, 83)
12 Window-based prediction For each position in a protein sequence:...lstaadmqgvvtdgmasgldkd... TDGMASGLDKD... Predict its secondary structure based on a local window:...lstaadmqgv MQGVVTDGMASGLDKD... Slide window along sequence:...lstaadmqgvv QGVVTDGMASGLDKD......LSTAADMQGVVT GVVTDGMASGLDKD... GLDKD......LSTAADMQGVVTD VVTDGMASGLDKD...
13 Modeling structural correlations NAIVE-BAYES CLASSIFIER Conditional independence models: { L,H,E } A R N D C Q E G H I L K M F P S T W Y P(A H) V... P(A E) P(A L) HELIX STRAND LOOP i-4 i-3 i-2 i-1 i i+1 i+2 i+3 i+4 Pair-wise dependence: A R N D A R N D C Q E G H I L K M F P S T W Y V * * * KLINGER : STRUCTURAL CORRELATIONS... i i+1 i+2 i+3 i+4 W Y V
14 Hydrolase (β-lactamase)( with amphipathic α-helix
15 Amphipathic α-helix: hydrophobic side chains
16 Amphipathic α-helix: side chain periodicity Sequence: NLAKMVVKTAEAILKD
17 Structural correlations in β-strands E E E E
18 PHD (Rost & Sander, 1993) MULTI-LAYER PERCEPTRON (FULLY-CONNECTED) Neural network based 2 levels: Sequence -> Structure Structure -> Structure i-4 Uses multiple sequence alignment Amino acid frequencies Structure Predictions -> Conservation weight Post-processing by dynamic programming i-3 i-2 H L E i-1 i i+1 i+2 i+3 i+4 <-...Amino Acid Sequence... ->
19 Special case: helical transmembrane proteins Membrane proteins biologically important Difficult to determine experimentally Easier to predict Constraints imposed by lipid bilayer Strong hydrophobicity signal Cytoplasmic residues positively charged 2-state bacteriorhodopsin Accuracy: 95% (Multiple alignment)
20 Predator (Frishman & Argos, 1996) Nearest-neighbor classifier Represent subsequence as a vector Define a distance metric Find closest vectors in training set, vote Adds non-local terms for hydrogen bonding propensity (helices, sheets) Accuracy: 68% single sequence; 75% multiple alignment
21 SSPAL (Salamov & Solovyev, 1997) Nearest-neighbor can be viewed as fixed length, non-gapped local alignment Find K (= 50) best non-overlapping local alignments with known structures Predict each position by consensus of alignment structures, weighted by score Accuracy: Single sequence: 71.2% Multiple sequence alignment: 73.5%
22 Evaluation of secondary structure prediction Large database of protein sequences: Known structures X-ray crystallography, NMR Gold-standard assignment Non-homologous < 25-30% identity Cross-validation
23 What to measure? Q3 (3-state accuracy) percent residues correct Matthews correlation coefficient adjust for prevalence Segment-based measures Rost et al 94, Taylor 84, Presnell et al 92
24 Bayesian Segmentation of Protein Secondary Structure Scott C.Schmidler 1,3 Jun S. Liu Douglas L. Brutlag Section on Medical Informatics Department of Statistics Department of Biochemistry Stanford University
25 Goals Improved secondary structure prediction > 70% accuracy (75% MSA) accurate estimates of prediction variability Combining structural data with scientific knowledge
26 Bayesian structure prediction Model-based structure prediction Probabilistic modeling of segments Hydrophobicity patterns Side chain interactions Helical capping Predict structure to maximize probability Optimal segmentation of protein sequence L E L H L H L Doug Brutlag, NW VLST AADM QGVVTDGMAS F LDK D...
27 Model Joint distribution: P( R, S,T ) = P( S,T ) P R [ S j 1 +1:S j ] S, T Conditional independence model for inter- segment residues: Markovian dependence in S,T: ( ) = P T j T j 1 P R, S,T m j =1 m j =1 ( )P( S j S j 1,T j )P R Sj 1 +1:S j [ ] S j 1, S j,t j Example: L E L H L H L R = NWVLSTAADMQGVVTDGMASFLDKD SS = LLEEEELLLLHHHHHHHHHHLHHHL
28 Position-specific preferences Helix N-cap model, positions 1&2 Helix internal position model A R N D C Q E G H I L K M F P S T W Y V X 0 A R N D C Q E G H I L K M F P S T W Y V Amino acid Amino acid Strand internal position model Loop/coil N-cap model, positions 1& A R N D C Q E G H I L K M F P S T W Y V 0 A R N D C Q E G H I L K M F P S T W Y V Amino acid Amino acid
29 Segment likelihood Modeling correlations among properties j ( ) = P Helix R [i] H i P R [k: j] S q 1,S q, Helix P R [k: j] S q 1,S q,strand i = k ( ) = P Strand ( R [i ] H i ) i = k ( ) = P Loop R [i ] H i P R [k: j] S q 1,S q, Loop j ( )P Helix H i H i 2, H i 3,H i 4, H i 7 ( ) P Strand H i H i 2, H i 3 j i =k ( )P Loop H i H i 2 ( ) ( ) H1 H2 H3 H4 H5 H6 R1 R2 R3 R4 R5 R6 HELIX MODEL
30 Segment length distributions Helix Strand Segment length
31 Probabilistic model Structureand positionspecific frequencies: P( Sequence Structure) P( Structure) Segment length priors: Helix Strand Segment length Conditional independence of inter-segment residues: L E L H Markovian dependence in segment types: L H L
32 Benefits Explicit probabilistic model: Sound semantics Coherent treatment of uncertainty/noisy data Explicit, testable assumptions Fully Bayesian prediction: Averaged over all possible models Accurate estimates of uncertainty
33 Example prediction: Cytochrome C5 (1cc5) True: Predicted:
34 Prediction confidence Prediction threshold Prediction threshold Prediction threshold %H %E %L
35 Evaluation 453 structures selected from the Brookhaven Protein Data Bank < 2.5A resolution < 25% sequence similarity Cross-validation results (single sequence): Bayesian Segmentation algorithm: Marginal mode prediction: 68.8% MAP segmentation prediction: 64.2% Previous best-published: 68% (Frishman&Argos 96) 71% (Salamov&Solovyev 97)
36 Beyond secondary structure: predicting 3D contacts Model captures local dependencies Structure-specific residue propensities Intra-segment side chain correlations Tertiary interactions β-sheets Coiled-coils Disulfide bonds
37 β-sheet side chain correlations Odds ratio: P A i, A j Struct ( ) P A i Struct ( )P A j Struct ( ) Charged-pair interaction in Glutaredoxin Disulfide bonds Stabilizing pairs from (Smith & Regan, Science 1995) Hydrophobic side chains
38 Incorporating non-local information Segment interaction models Replace terms P ( Segment j ) and P Segment k with ( ) P( Segment j,segment k) Parallel β-sheet in 1nzy β H L β L L E L E L H L E L E but computation... L
39 Prediction of β-strand Contact Map for 5pti Predicted contacts: True contacts: Pairing and register of β-hairpin correctly predicted
40 Previous Approaches: Hubbard (1995) Predicted contacts (single sequence): Predicted contacts (multiple sequence alignment):
41 Flavodoxin (5nul) Predicted contacts: True contacts: β-strands well-predicted but poor specificity in strand pairing
42 Future work Models for subclasses of segments Environment: amphipathic/buried/exposed Structure: 3-10 helices, β, γ turns Model selection Multiple sequence alignment information
43 Conclusions Probabilistic modeling of protein structure Prediction by segmentation of sequence Independent segment models perform comparably to existing approaches General framework for modeling non-local interactions to predict 3D contacts
Basics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationProtein Secondary Structure Prediction
part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 the goal is the prediction of the secondary structure conformation which is local each amino
More informationProtein Structure Prediction and Display
Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each
More informationBioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction. Sepp Hochreiter
Bioinformatics III Structural Bioinformatics and Genome Analysis Part Protein Secondary Structure Prediction Institute of Bioinformatics Johannes Kepler University, Linz, Austria Chapter 4 Protein Secondary
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationPresentation Outline. Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy
Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy Burkhard Rost and Chris Sander By Kalyan C. Gopavarapu 1 Presentation Outline Major Terminology Problem Method
More informationSUPPLEMENTARY MATERIALS
SUPPLEMENTARY MATERIALS Enhanced Recognition of Transmembrane Protein Domains with Prediction-based Structural Profiles Baoqiang Cao, Aleksey Porollo, Rafal Adamczak, Mark Jarrell and Jaroslaw Meller Contact:
More informationProtein Secondary Structure Assignment and Prediction
1 Protein Secondary Structure Assignment and Prediction Defining SS features - Dihedral angles, alpha helix, beta stand (Hydrogen bonds) Assigned manually by crystallographers or Automatic DSSP (Kabsch
More informationImproved Protein Secondary Structure Prediction
Improved Protein Secondary Structure Prediction Secondary Structure Prediction! Given a protein sequence a 1 a 2 a N, secondary structure prediction aims at defining the state of each amino acid ai as
More informationProtein Structures: Experiments and Modeling. Patrice Koehl
Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:
More informationOrientational degeneracy in the presence of one alignment tensor.
Orientational degeneracy in the presence of one alignment tensor. Rotation about the x, y and z axes can be performed in the aligned mode of the program to examine the four degenerate orientations of two
More informationProtein structure. Protein structure. Amino acid residue. Cell communication channel. Bioinformatics Methods
Cell communication channel Bioinformatics Methods Iosif Vaisman Email: ivaisman@gmu.edu SEQUENCE STRUCTURE DNA Sequence Protein Sequence Protein Structure Protein structure ATGAAATTTGGAAACTTCCTTCTCACTTATCAGCCACCT...
More informationProtein Secondary Structure Prediction using Feed-Forward Neural Network
COPYRIGHT 2010 JCIT, ISSN 2078-5828 (PRINT), ISSN 2218-5224 (ONLINE), VOLUME 01, ISSUE 01, MANUSCRIPT CODE: 100713 Protein Secondary Structure Prediction using Feed-Forward Neural Network M. A. Mottalib,
More informationBayesian Protein Structure Prediction
This is page 1 Printer: Opaque this Bayesian Protein Structure Prediction Scott C. Schmidler Jun S. Liu Douglas L. Brutlag ABSTRACT An important role for statisticians in the age of the Human Genome Project
More informationBIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer Protein Structure Prediction I
BIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer 2013 9. Protein Structure Prediction I Structure Prediction Overview Overview of problem variants Secondary structure prediction
More informationHIV protease inhibitor. Certain level of function can be found without structure. But a structure is a key to understand the detailed mechanism.
Proteins are linear polypeptide chains (one or more) Building blocks: 20 types of amino acids. Range from a few 10s-1000s They fold into varying three-dimensional shapes structure medicine Certain level
More informationNeural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha
Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this
More informationSupersecondary Structures (structural motifs)
Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationConditional Graphical Models
PhD Thesis Proposal Conditional Graphical Models for Protein Structure Prediction Yan Liu Language Technologies Institute University Thesis Committee Jaime Carbonell (Chair) John Lafferty Eric P. Xing
More informationPROTEIN SECONDARY STRUCTURE PREDICTION USING NEURAL NETWORKS AND SUPPORT VECTOR MACHINES
PROTEIN SECONDARY STRUCTURE PREDICTION USING NEURAL NETWORKS AND SUPPORT VECTOR MACHINES by Lipontseng Cecilia Tsilo A thesis submitted to Rhodes University in partial fulfillment of the requirements for
More informationStatistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics
Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia
More informationGetting To Know Your Protein
Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research
More informationSteps in protein modelling. Structure prediction, fold recognition and homology modelling. Basic principles of protein structure
Structure prediction, fold recognition and homology modelling Marjolein Thunnissen Lund September 2012 Steps in protein modelling 3-D structure known Comparative Modelling Sequence of interest Similarity
More informationProtein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds
Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino
More informationHMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder
HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More informationProtein Secondary Structure Prediction using Pattern Recognition Neural Network
Protein Secondary Structure Prediction using Pattern Recognition Neural Network P.V. Nageswara Rao 1 (nagesh@gitam.edu), T. Uma Devi 1, DSVGK Kaladhar 1, G.R. Sridhar 2, Allam Appa Rao 3 1 GITAM University,
More informationBioinformatics: Secondary Structure Prediction
Bioinformatics: Secondary Structure Prediction Prof. David Jones d.jones@cs.ucl.ac.uk LMLSTQNPALLKRNIIYWNNVALLWEAGSD The greatest unsolved problem in molecular biology:the Protein Folding Problem? Entries
More informationProtein Structure Prediction, Engineering & Design CHEM 430
Protein Structure Prediction, Engineering & Design CHEM 430 Eero Saarinen The free energy surface of a protein Protein Structure Prediction & Design Full Protein Structure from Sequence - High Alignment
More informationOptimization of the Sliding Window Size for Protein Structure Prediction
Optimization of the Sliding Window Size for Protein Structure Prediction Ke Chen* 1, Lukasz Kurgan 1 and Jishou Ruan 2 1 University of Alberta, Department of Electrical and Computer Engineering, Edmonton,
More informationBCB 444/544 Fall 07 Dobbs 1
BCB 444/544 Lecture 21 Protein Structure Visualization, Classification & Comparison Secondary Structure #21_Oct10 Required Reading (before lecture) Mon Oct 8 - Lecture 20 Protein Secondary Structure Chp
More informationLecture 7. Protein Secondary Structure Prediction. Secondary Structure DSSP. Master Course DNA/Protein Structurefunction.
C N T R F O R N T G R A T V B O N F O R M A T C S V U Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 7 Protein Secondary Structure Prediction Protein primary structure 20 amino
More information7 Protein secondary structure
78 Grundlagen der Bioinformatik, SS 1, D. Huson, June 17, 21 7 Protein secondary structure Sources for this chapter, which are all recommended reading: Introduction to Protein Structure, Branden & Tooze,
More informationPROTEIN SECONDARY STRUCTURE PREDICTION: AN APPLICATION OF CHOU-FASMAN ALGORITHM IN A HYPOTHETICAL PROTEIN OF SARS VIRUS
Int. J. LifeSc. Bt & Pharm. Res. 2012 Kaladhar, 2012 Research Paper ISSN 2250-3137 www.ijlbpr.com Vol.1, Issue. 1, January 2012 2012 IJLBPR. All Rights Reserved PROTEIN SECONDARY STRUCTURE PREDICTION:
More informationGibbs Sampling Methods for Multiple Sequence Alignment
Gibbs Sampling Methods for Multiple Sequence Alignment Scott C. Schmidler 1 Jun S. Liu 2 1 Section on Medical Informatics and 2 Department of Statistics Stanford University 11/17/99 1 Outline Statistical
More informationProteins: Structure & Function. Ulf Leser
Proteins: Structure & Function Ulf Leser This Lecture Proteins Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding
More informationCMPS 3110: Bioinformatics. Tertiary Structure Prediction
CMPS 3110: Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the laws of physics! Conformation space is finite
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction
CMPS 6630: Introduction to Computational Biology and Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the
More information114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009
114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009 9 Protein tertiary structure Sources for this chapter, which are all recommended reading: D.W. Mount. Bioinformatics: Sequences and Genome
More informationSequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
More informationGraphical Models and Bayesian Methods in Bioinformatics: From Structural to Systems Biology
Graphical Models and Bayesian Methods in Bioinformatics: From Structural to Systems Biology David L. Wild Keck Graduate Institute of Applied Life Sciences, Claremont, CA, USA October 3, 2005 Outline 1
More informationResearch Article Extracting Physicochemical Features to Predict Protein Secondary Structure
The Scientific World Journal Volume 2013, Article ID 347106, 8 pages http://dx.doi.org/10.1155/2013/347106 Research Article Extracting Physicochemical Features to Predict Protein Secondary Structure Yin-Fu
More informationUseful background reading
Overview of lecture * General comment on peptide bond * Discussion of backbone dihedral angles * Discussion of Ramachandran plots * Description of helix types. * Description of structures * NMR patterns
More informationImproving Protein 3D Structure Prediction Accuracy using Dense Regions Areas of Secondary Structures in the Contact Map
American Journal of Biochemistry and Biotechnology 4 (4): 375-384, 8 ISSN 553-3468 8 Science Publications Improving Protein 3D Structure Prediction Accuracy using Dense Regions Areas of Secondary Structures
More informationBayesian Segmental Models with Multiple Sequence Alignment Profiles for Protein Secondary Structure and Contact Map Prediction
1 Bayesian Segmental Models with Multiple Sequence Alignment Profiles for Protein Secondary Structure and Contact Map Prediction Wei Chu, Zoubin Ghahramani, Alexei Podtelezhnikov, David L. Wild The authors
More information8 Protein secondary structure
Grundlagen der Bioinformatik, SoSe 11, D. Huson, June 6, 211 13 8 Protein secondary structure Sources for this chapter, which are all recommended reading: Introduction to Protein Structure, Branden & Tooze,
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationComputational Molecular Biology (
Computational Molecular Biology (http://cmgm cmgm.stanford.edu/biochem218/) Biochemistry 218/Medical Information Sciences 231 Douglas L. Brutlag, Lee Kozar Jimmy Huang, Josh Silverman Lecture Syllabus
More informationProtein Structure Prediction Using Multiple Artificial Neural Network Classifier *
Protein Structure Prediction Using Multiple Artificial Neural Network Classifier * Hemashree Bordoloi and Kandarpa Kumar Sarma Abstract. Protein secondary structure prediction is the method of extracting
More information3D Structure. Prediction & Assessment Pt. 2. David Wishart 3-41 Athabasca Hall
3D Structure Prediction & Assessment Pt. 2 David Wishart 3-41 Athabasca Hall david.wishart@ualberta.ca Objectives Become familiar with methods and algorithms for secondary Structure Prediction Become familiar
More informationAmino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1
Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings
More information1-D Predictions. Prediction of local features: Secondary structure & surface exposure
1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local
More informationBioinformatics: Secondary Structure Prediction
Bioinformatics: Secondary Structure Prediction Prof. David Jones d.t.jones@ucl.ac.uk Possibly the greatest unsolved problem in molecular biology: The Protein Folding Problem MWMPPRPEEVARK LRRLGFVERMAKG
More informationSecondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure
Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationPresenter: She Zhang
Presenter: She Zhang Introduction Dr. David Baker Introduction Why design proteins de novo? It is not clear how non-covalent interactions favor one specific native structure over many other non-native
More informationProtein Structure Prediction
Protein Structure Prediction Michael Feig MMTSB/CTBP 2006 Summer Workshop From Sequence to Structure SEALGDTIVKNA Ab initio Structure Prediction Protocol Amino Acid Sequence Conformational Sampling to
More informationExamples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE
Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationRNA and Protein Structure Prediction
RNA and Protein Structure Prediction Bioinformatics: Issues and Algorithms CSE 308-408 Spring 2007 Lecture 18-1- Outline Multi-Dimensional Nature of Life RNA Secondary Structure Prediction Protein Structure
More informationProtein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1
Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2
More information12 Protein secondary structure
Grundlagen der Bioinformatik, SoSe 14, D. Huson, July 2, 214 147 12 Protein secondary structure Sources for this chapter, which are all recommended reading: Introduction to Protein Structure, Branden &
More informationTwo-Stage Multi-Class Support Vector Machines to Protein Secondary Structure Prediction. M.N. Nguyen and J.C. Rajapakse
Two-Stage Multi-Class Support Vector Machines to Protein Secondary Structure Prediction M.N. Nguyen and J.C. Rajapakse Pacific Symposium on Biocomputing 10:346-357(2005) TWO-STAGE MULTI-CLASS SUPPORT VECTOR
More informationProtein structure alignments
Protein structure alignments Proteins that fold in the same way, i.e. have the same fold are often homologs. Structure evolves slower than sequence Sequence is less conserved than structure If BLAST gives
More informationCan protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU
Can protein model accuracy be identified? Morten Nielsen, CBS, BioCentrum, DTU NO! Identification of Protein-model accuracy Why is it important? What is accuracy RMSD, fraction correct, Protein model correctness/quality
More informationPacking of Secondary Structures
7.88 Lecture Notes - 4 7.24/7.88J/5.48J The Protein Folding and Human Disease Professor Gossard Retrieving, Viewing Protein Structures from the Protein Data Base Helix helix packing Packing of Secondary
More informationPage 1. References. Hidden Markov models and multiple sequence alignment. Markov chains. Probability review. Example. Markovian sequence
Page Hidden Markov models and multiple sequence alignment Russ B Altman BMI 4 CS 74 Some slides borrowed from Scott C Schmidler (BMI graduate student) References Bioinformatics Classic: Krogh et al (994)
More informationStructural Alignment of Proteins
Goal Align protein structures Structural Alignment of Proteins 1 2 3 4 5 6 7 8 9 10 11 12 13 14 PHE ASP ILE CYS ARG LEU PRO GLY SER ALA GLU ALA VAL CYS PHE ASN VAL CYS ARG THR PRO --- --- --- GLU ALA ILE
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More informationGenomics and bioinformatics summary. Finding genes -- computer searches
Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence
More informationProtein Structure: Data Bases and Classification Ingo Ruczinski
Protein Structure: Data Bases and Classification Ingo Ruczinski Department of Biostatistics, Johns Hopkins University Reference Bourne and Weissig Structural Bioinformatics Wiley, 2003 More References
More informationSCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like
SCOP all-β class 4-helical cytokines T4 endonuclease V all-α class, 3 different folds Globin-like TIM-barrel fold α/β class Profilin-like fold α+β class http://scop.mrc-lmb.cam.ac.uk/scop CATH Class, Architecture,
More informationBayesian Models and Algorithms for Protein Beta-Sheet Prediction
0 Bayesian Models and Algorithms for Protein Beta-Sheet Prediction Zafer Aydin, Student Member, IEEE, Yucel Altunbasak, Senior Member, IEEE, and Hakan Erdogan, Member, IEEE Abstract Prediction of the three-dimensional
More informationPredicting Secondary Structures of Proteins
CHALLENGES IN PROTEOMICS BACKGROUND PHOTODISC, FOREGROUND IMAGE: U.S. DEPARTMENT OF ENERGY GENOMICS: GTL PROGRAM, HTTP://WWW.ORNL.GOV.HGMIS BY JACEK BLAŻEWICZ, PETER L. HAMMER, AND PIOTR LUKASIAK Predicting
More informationProtein Structure & Motifs
& Motifs Biochemistry 201 Molecular Biology January 12, 2000 Doug Brutlag Introduction Proteins are more flexible than nucleic acids in structure because of both the larger number of types of residues
More informationIdentification of Representative Protein Sequence and Secondary Structure Prediction Using SVM Approach
Identification of Representative Protein Sequence and Secondary Structure Prediction Using SVM Approach Prof. Dr. M. A. Mottalib, Md. Rahat Hossain Department of Computer Science and Information Technology
More informationALL LECTURES IN SB Introduction
1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL
More informationPredicting Protein Structural Features With Artificial Neural Networks
CHAPTER 4 Predicting Protein Structural Features With Artificial Neural Networks Stephen R. Holbrook, Steven M. Muskal and Sung-Hou Kim 1. Introduction The prediction of protein structure from amino acid
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationAnalysis and Prediction of Protein Structure (I)
Analysis and Prediction of Protein Structure (I) Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 2006 Free for academic use. Copyright @ Jianlin Cheng
More informationTemplate Free Protein Structure Modeling Jianlin Cheng, PhD
Template Free Protein Structure Modeling Jianlin Cheng, PhD Associate Professor Computer Science Department Informatics Institute University of Missouri, Columbia 2013 Protein Energy Landscape & Free Sampling
More informationA Machine Text-Inspired Machine Learning Approach for Identification of Transmembrane Helix Boundaries
A Machine Text-Inspired Machine Learning Approach for Identification of Transmembrane Helix Boundaries Betty Yee Man Cheng 1, Jaime G. Carbonell 1, and Judith Klein-Seetharaman 1, 2 1 Language Technologies
More informationMolecular Modeling Lecture 7. Homology modeling insertions/deletions manual realignment
Molecular Modeling 2018-- Lecture 7 Homology modeling insertions/deletions manual realignment Homology modeling also called comparative modeling Sequences that have similar sequence have similar structure.
More informationProtein Secondary Structure Prediction
C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 7 Protein Secondary Structure Prediction Protein primary
More informationHomology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6
Homology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6 Hsuan-Liang Liu* and Chin-Wen Chen Department of Chemical Engineering and Graduate Institute
More informationBiochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture - 06 Protein Structure IV
Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur Lecture - 06 Protein Structure IV We complete our discussion on Protein Structures today. And just to recap
More informationProtein secondary structure prediction with a neural network
Proc. Nati. Acad. Sci. USA Vol. 86, pp. 152-156, January 1989 Biophysics Protein secondary structure prediction with a neural network L. HOWARD HOLLEY AND MARTIN KARPLUS Department of Chemistry, Harvard
More informationPrediction of Beta Sheets in Proteins
Prediction of Beta Sheets in Proteins Anders Krogh The Sanger Centre Hinxton, Carobs CBIO IRQ, UK. Email: krogh@sanger.ac. uk S~ren Kamaric Riis Electronics Institute, Building 349 Technical University
More informationMaster s Thesis June 2018 Supervisor: Christian Nørgaard Storm Pedersen Aarhus University
P R O T E I N S E C O N D A RY S T R U C T U R E P R E D I C T I O N U S I N G A RT I F I C I A L N E U R A L N E T W O R K S judit kisistók, 201602119 bakhtawar noor, 201602561 Master s Thesis June 2018
More informationStructural biomathematics: an overview of molecular simulations and protein structure prediction
: an overview of molecular simulations and protein structure prediction Figure: Parc de Recerca Biomèdica de Barcelona (PRBB). Contents 1 A Glance at Structural Biology 2 3 1 A Glance at Structural Biology
More informationBuilding a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor
Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Presented by Stephanie Lee Research Mentor: Dr. Rob Coalson Glycine Alpha 1 Receptor (GlyRa1) Member of the superfamily
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure
More informationProtein Structure Basics
Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes
More informationA Graphical Model for Protein Secondary Structure Prediction
A Graphical Model for Protein Secondary Structure Prediction Wei Chu chuwei@gatsby.ucl.ac.uk Zoubin Ghahramani zoubin@gatsby.ucl.ac.uk Gatsby Computational Neuroscience Unit, University College London,
More informationBIOCHEMISTRY Course Outline (Fall, 2011)
BIOCHEMISTRY 402 - Course Outline (Fall, 2011) Number OVERVIEW OF LECTURE TOPICS: of Lectures INSTRUCTOR 1. Structural Components of Proteins G. Brayer (a) Amino Acids and the Polypeptide Chain Backbone...2
More informationTemplate Free Protein Structure Modeling Jianlin Cheng, PhD
Template Free Protein Structure Modeling Jianlin Cheng, PhD Professor Department of EECS Informatics Institute University of Missouri, Columbia 2018 Protein Energy Landscape & Free Sampling http://pubs.acs.org/subscribe/archive/mdd/v03/i09/html/willis.html
More informationProtein Folding Prof. Eugene Shakhnovich
Protein Folding Eugene Shakhnovich Department of Chemistry and Chemical Biology Harvard University 1 Proteins are folded on various scales As of now we know hundreds of thousands of sequences (Swissprot)
More information