Modeling studies of chromatin fiber structure as a function of DNA linker length Supplemental material
|
|
- Carmella May
- 5 years ago
- Views:
Transcription
1 Modeling studies of chromatin fiber structure as a function of DNA linker length Supplemental material Ognjen Perišić a,,rosanacollepardo-guevara a,, Tamar Schlick a,b, a Department of Chemistry, New York University, 100 Washington Square East, New York, New York b Courant Institute of Mathematical Sciences, New York University, 251 Mercer Street, New York, New York 10012, Tel.: ; fax: These authors contributed equally to the work Corresponding author address: schlick@nyu.edu (Tamar Schlick) Preprint submitted to Journal of Molecular Biology July 24, 2010
2 q l (e) x y z (nm) q l (e) x y z (nm) q l (e) x y z (nm) q l (e) x y z (nm) Table S1: Nucleosome pseudo-charges and relative postions on the nucleosome surface at C S obtained with the DiSCO approach. 2 =0.15M
3 Parameter Description Value T Temperature K C S Monovalent salt concentration (NaCl) 0.15 M l 0 Equilibrium DNA segment length 3.0 nm L p Persistence length of linker DNA in monovalent salt 50 nm h Stretching rigidity of linker DNA 100k B T/lo 2 g Bending rigidity of linker DNA L p k B T/l o s Torsional rigidity constant of linker DNA erg.nm θ 0 Angular separation between linker segments at core 108 2w 0 Width of wound DNA supercoil 3.6 nm r 0 Radius of wound DNA supercoil 4.8 nm σ tt Excluded vol. distance for tail/tail interactions 1.8 nm σ tc Excluded vol. distance for tail/core interactions 1.8 nm σ cc Excluded vol. distance for core/core interactions 1.2 nm σ tl Excluded volume distance for tail/linker DNA interactions 2.7 nm σ cl Excluded vol. distance for core/linker DNA interactions 2.4 nm σ glhc Excluded vol. distance for globular link. hist./core interactions 2.2 nm σ glh1 Excluded vol. distance for globular link. hist./link.dna interactions 3.4 nm σ clhc Excluded vol. distance for C-term. link. hist./core interactions 2.4 nm σ clh1 Excluded vol. distance for C-term. link. hist./link.dna interactions 3.6 nm k ev Excluded vol. energy param for all components except for tail beads k B T k evt Tail/tail excluded volume interaction energy parameter 0.1 k B T q glh Charge on the globular linker histone bead 13.88e q clh Charge on the C-terminal linker histone bead 25.62e σ LHLH Excluded volume distance for link.histone/link.histone interactions 2.0 nm Table S2: Parameters employed in mesoscale modeling/simulation. 3
4 Bond k b Average SD Tail i-j (kcal/mol/aa) [Å] [Å] N-ter H N-ter H N-ter H2A C-ter H2A N-ter H2B Table S3: Protein bead stretching parameters. Angle k θ Average SD Tail i-j (kcal/mol/aa) [Å] [Å] N-ter H N-ter H N-ter H2A C-ter H2A N-ter H2B Table S4: Protein bond-angle parameters. 4
5 (a) Interdigitated solenoid (b) zigzag Figure S1: Initial configurations and their interaction patterns. 5
6 kcal/mol (a) Energy, 182 bp zigzag start solenoid start (b) Bending angle, 182 bp (c) Triplet angle, 182 bp (d) Dihedral angle, 182 bp million MC steps million MC steps (e) Energy, 218bp (f) Bending angle, 218 bp kcal/mol (g) Triplet angle, 218 bp (h) Dihedral angle, 218 bp million MC steps million MC steps Figure S2: Convergence of different quantities for 24-core 182-bp (top half) and 218-bp (bottom half) oligonucleosome trajectories simulated with LH. 6
7 j I (i,j) i 0 Figure S3: Internucleosome interaction matrix I (i, j). 7
8 Figure S4: Triplet, dihedral, and bending angles cartoons. 8
9 CS = 0.01 M without LH CS = 0.15 M without LH CS = 0.15 M with LH CS = 0.2 M with LH CS = 0.15 M with Mg and LH Short NRL Medium NRL Long NRL Figure S5: Space filling model for representative 48-core arrays (short NRL: 173 bp, medium NRL: 209 bp, and long NRL: 226 bp) at different salt concentrations. Nucleosomes, DNA linkers, and LH are colored as in Figure 2. 9
10 Figure S6: Description of the fiber axis calculation for 24-unit oligonucleosome. (a) Cyan - nucleosome cores, Red lines - connections between consecutive nucleosomes, Green line - fiber axis, as estimated by the least squares procedure; (b) Fiber axis decomposition into three separate curves for three vectors (x, y, and z); Blue dots - nucleosome centers, Green line - fiber axis, Reddots-separatorsbetweenlinesegmentsofthe fiber axis. 10
11 Figure S7: Geometry of the mesoscale oligonucleosome showing (a) assembly of oligonucleosome components into a chain, (b) entering/exiting linker DNA, and (c) individual coordinate systems for the linker DNA beads and nucleosome core, and Euler angle β depicting the linker DNA bending. For nucleosome core i, a i and b i lie in the nucleosome core plane, with a i pointing along the tangent at the attachment site of the entering DNA, and b i in the direction normal to this tangent. For linker DNA bead i, thevectora i points from the geometric center of i to either the center of the following DNA bead or to the attachment point in points from the attachment point of the exiting linker DNA to the center of the following DNA linker bead. The vectors a + i and a i represent the local tangents on the nucleosome cores at the exiting and entering points of attachment, respectively. the nucleosome (if i +1isacore). Thevectora DNA i 11
Biophysical Journal, Volume 99. Supporting Material. Chromatin ionic atmosphere analyzed by a mesoscale electrostatic approach
Biophysical Journal, Volume 99 Supporting Material Chromatin ionic atmosphere analyzed by a mesoscale electrostatic approach Hin Hark Gan and Tamar Schlick Supporting Material Chromatin ionic atmosphere
More informationDynamic condensation of linker histone C-terminal domain regulates. chromatin structure
Dynamic condensation of linker histone C-terminal domain regulates chromatin structure Supplementary Information Antoni Luque, Rosana Collepardo-Guevara, Sergei A. Grigoryev, and Tamar Schlick Refined
More informationJournal of Molecular Biology
ASB YJMBI-62480; No. of pages: 26; 4C: 4, 6, 7, 8, 9, 10, 11, 12 doi:10.1016/j.jmb.2010.07.057 J. Mol. Biol. (2010) xx, xxx xxx Contents lists available at www.sciencedirect.com Journal of Molecular Biology
More informationSupplementary Information
Supplementary Information Gi-Moon Nam and Gaurav Arya Department of NanoEngineering, University of California at San Diego, 9500 Gilman Drive, La Jolla, CA 9093-0448 1 Coarse-grained (CG) model of nucleosome
More informationMesoscale simulations of two nucleosome-repeat length oligonucleosomesw
PAPER www.rsc.org/pccp Physical Chemistry Chemical Physics Mesoscale simulations of two nucleosome-repeat length oligonucleosomesw Tamar Schlick* and Ognjen Perisˇ ić Received 8th September 2009, Accepted
More informationSupporting Material for Dynamics of forced nucleosome unraveling and role of nonuniform histone-dna interactions
Supporting Material for Dynamics of forced nucleosome unraveling and role of nonuniform histone-dna interactions Irina V. Dobrovolskaia and Gaurav Arya 1 Department of NanoEngineering, University of California,
More informationMacroscopic modeling and simulations of supercoiled DNA with bound proteins
JOURNAL OF CHEMICAL PHYSICS VOLUME 117, NUMBER 18 8 NOVEMBER 2002 Macroscopic modeling and simulations of supercoiled DNA with bound proteins Jing Huang a) and Tamar Schlick b) Department of Chemistry
More informationThe Effect of Internucleosomal Interaction on Folding of the Chromatin Fiber
Biophysical Journal Volume 95 October 2008 3677 3691 3677 The Effect of Internucleosomal Interaction on Folding of the Chromatin Fiber René Stehr,* Nick Kepper, y Karsten Rippe, y and Gero Wedemann* *University
More informationBase pair level modeling of the nucleosome and higher order structure
Base pair level modeling of the nucleosome and higher order structure THESIS submitted in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE in PHYSICS Author : L.K. Visscher Student
More informationChromatin folding and the dynamic interplay between chromatin
Electrostatic mechanism of nucleosomal array folding revealed by computer simulation Jian Sun, Qing Zhang, and Tamar Schlick* Department of Chemistry and Courant Institute of Mathematical Sciences, New
More informationMultimedia : Fibronectin and Titin unfolding simulation movies.
I LECTURE 21: SINGLE CHAIN ELASTICITY OF BIOMACROMOLECULES: THE GIANT PROTEIN TITIN AND DNA Outline : REVIEW LECTURE #2 : EXTENSIBLE FJC AND WLC... 2 STRUCTURE OF MUSCLE AND TITIN... 3 SINGLE MOLECULE
More informationSingle molecule force spectroscopy reveals a highly compliant helical
Supplementary Information Single molecule force spectroscopy reveals a highly compliant helical folding for the 30 nm chromatin fiber Maarten Kruithof, Fan-Tso Chien, Andrew Routh, Colin Logie, Daniela
More informationSupporting Information for. DNA elasticity from short DNA to nucleosomal DNA
Supporting Information for DNA elasticity from short DNA to nucleosomal DNA Ashok Garai, 1 Suman Saurabh, 1 Yves Lansac, 2 and Prabal K. Maiti* 1 1 Centre for Condensed Matter Theory, Department of Physics,
More informationLecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ].
Lecture 26: Polymers: DA Packing and Protein folding 26.1 Problem Set 4 due today. eading for Lectures 22 24: PKT hapter 8 DA Packing for Eukaryotes: The packing problem for the larger eukaryotic genomes
More informationnucleus: DNA & chromosomes
nucleus: DNA & chromosomes chapter 5 nuclear organization nuclear structure nuclear envelope nucleoplasm nuclear matrix nucleolus nuclear envelope nucleolus nuclear matrix nucleoplasm nuclear pore nuclear
More informationpolymers ISSN
Polymers 2014, 6, 1655-1675; doi:10.3390/polym6061655 Article OPEN ACCESS polymers ISSN 2073-4360 www.mdpi.com/journal/polymers A Coarse-Grained DNA Model Parameterized from Atomistic Simulations by Inverse
More informationMagnetic tweezers and its application to DNA mechanics
Biotechnological Center Research group DNA motors (Seidel group) Handout for Practical Course Magnetic tweezers and its application to DNA mechanics When: 9.00 am Where: Biotec, 3 rd Level, Room 317 Tutors:
More informationChiral selection in wrapping, crossover, and braiding of DNA mediated by asymmetric bend-writhe elasticity
http://www.aimspress.com/ AIMS Biophysics, 2(4): 666-694. DOI: 10.3934/biophy.2015.4.666 Received date 28 August 2015, Accepted date 29 October 2015, Published date 06 November 2015 Research article Chiral
More informationMultiscale Simulations of DNA and Nucleosome Core Particles
Multiscale Simulations of DNA and Nucleosome Core Particles Alexander Lyubartsev Department of Materials and Environmental Chemistry, Stockholm University Molecular Mobility and Order in Polymer Systems
More informationIntroduction to Polymer Physics
Introduction to Polymer Physics Enrico Carlon, KU Leuven, Belgium February-May, 2016 Enrico Carlon, KU Leuven, Belgium Introduction to Polymer Physics February-May, 2016 1 / 28 Polymers in Chemistry and
More informationA Combined Wormlike-Chain and Bead Model for Dynamic Simulations of Long Linear DNA
JOURNAL OF COMPUTATIONAL PHYSICS 136, 168 179 (1997) ARTICLE NO. CP975765 A Combined Wormlike-Chain and Bead Model for Dynamic Simulations of Long Linear DNA Hongmei Jian* and Alexander V. Vologodskii
More informationNucleus. The nucleus is a membrane bound organelle that store, protect and express most of the genetic information(dna) found in the cell.
Nucleus The nucleus is a membrane bound organelle that store, protect and express most of the genetic information(dna) found in the cell. Since regulation of gene expression takes place in the nucleus,
More informationActivity of Topotecan toward the DNA/Topoisomerase I Complex: A Theoretical Rationalization (Supporting Information)
Activity of Topotecan toward the DNA/Topoisomerase I Complex: A Theoretical Rationalization (Supporting Information) Semiha Kevser Bali 1, Antoine Marion*,2, Ilke Ugur 3, Ayse Kumru Dikmenli 4, Saron Catak
More informationThe Effect of Linker DNA on the Structure and Interaction of Nucleosome Core Particles
Electronic Supplementary Material (ESI) for Soft Matter. This journal is The Royal Society of Chemistry 2018 SUPPLEMENTARY INFORMATION The Effect of Linker DNA on the Structure and Interaction of Nucleosome
More informationEvaluation of Elastic Rod Models with Long Range Interactions for Predicting Nucleosome Stability
Open Access Article The authors, the publisher, and the right holders grant the right to use, reproduce, and disseminate the work in digital form to all users. Journal of Biomolecular Structure & Dynamics,
More informationCell Division. Genetic info must be copied. Each cell gets a complete copy of that info. It occurs in two main stages:
10-2 Cell Division Key Questions: 1)What is the role of chromosomes in cell division? 2) What are the main events of the cell cycle? 3) What events occur during each of the four phases of mitosis? 4) How
More informationStructure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits. AhpC and AhpF from Escherichia coli
Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits AhpC and AhpF from Escherichia coli Phat Vinh Dip 1,#, Neelagandan Kamariah 2,#, Malathy Sony Subramanian Manimekalai
More informationNucleosome Switching
Nucleosome Switching David J. Schwab, Robijn F. Bruinsma, Joseph Rudnick Department of Physics and Astronomy, University of California, Los Angeles, Los Angeles, CA, 90024 & Jonathan Widom Department of
More informationThe nature of genomes. Viral genomes. Prokaryotic genome. Nonliving particle. DNA or RNA. Compact genomes with little spacer DNA
The nature of genomes Genomics: study of structure and function of genomes Genome size variable, by orders of magnitude number of genes roughly proportional to genome size Plasmids symbiotic DNA molecules,
More informationMolecular Mechanics, Dynamics & Docking
Molecular Mechanics, Dynamics & Docking Lawrence Hunter, Ph.D. Director, Computational Bioscience Program University of Colorado School of Medicine Larry.Hunter@uchsc.edu http://compbio.uchsc.edu/hunter
More informationThe Molecular Dynamics Method
H-bond energy (kcal/mol) - 4.0 The Molecular Dynamics Method Fibronectin III_1, a mechanical protein that glues cells together in wound healing and in preventing tumor metastasis 0 ATPase, a molecular
More informationWhy Proteins Fold? (Parts of this presentation are based on work of Ashok Kolaskar) CS490B: Introduction to Bioinformatics Mar.
Why Proteins Fold? (Parts of this presentation are based on work of Ashok Kolaskar) CS490B: Introduction to Bioinformatics Mar. 25, 2002 Molecular Dynamics: Introduction At physiological conditions, the
More informationMolecular Dynamics, Monte Carlo and Docking. Lecture 21. Introduction to Bioinformatics MNW2
Molecular Dynamics, Monte Carlo and Docking Lecture 21 Introduction to Bioinformatics MNW2 If you throw up a stone, it is Physics. If you throw up a stone, it is Physics. If it lands on your head, it is
More informationV = 2ze 2 n. . a. i=1
IITS: Statistical Physics in Biology Assignment # 3 KU Leuven 5/29/2013 Coulomb Interactions & Polymers 1. Flory Theory: The Coulomb energy of a ball of charge Q and dimension R in d spacial dimensions
More informationUniversity of Washington Department of Chemistry Chemistry 355 Spring Quarter 2005
University of Washington Department of Chemistry Chemistry 55 Spring Quarter 5 Homework Assignment 7: Due no later than 5: pm on 5/14/4 8., 8.6, 8.1 8.) According to text equation 16, after N jumps the
More informationA systematic analysis of nucleosome core particle and nucleosome-nucleosome stacking structure
www.nature.com/scientificreports Received: 6 November 2017 Accepted: 4 January 2018 Published: xx xx xxxx OPEN A systematic analysis of nucleosome core particle and nucleosome-nucleosome stacking structure
More informationComputer Modeling Demonstrates that Electrostatic Attraction of Nucleosomal DNA is Mediated by Histone Tails
Biophysical Journal Volume 90 June 2006 4305 4316 4305 Computer Modeling Demonstrates that Electrostatic Attraction of Nucleosomal DNA is Mediated by Histone Tails Nikolay Korolev,* Alexander P. Lyubartsev,
More informationEffect of DNA Superhelicity and Bound Proteins on Mechanistic Aspects of the Hin-Mediated and Fis-Enhanced Inversion
804 Biophysical Journal Volume 85 August 2003 804 817 Effect of DNA Superhelicity and Bound Proteins on Mechanistic Aspects of the Hin-Mediated and Fis-Enhanced Inversion Jing Huang, Qing Zhang, and Tamar
More informationFaculty of math and natural science. Universty of Split. Kratky-Porod model. Nataša Vučemilovid-Alagid. February, 2013.
Faculty of math and natural science Universty of Split Kratky-Porod model Nataša Vučemilovid-Alagid February, 2013. Table of contents 1.Introduction:... 3 1. DNA:... 4 2. Models of polymer elasticity:...
More informationLecture 18 June 2 nd, Gene Expression Regulation Mutations
Lecture 18 June 2 nd, 2016 Gene Expression Regulation Mutations From Gene to Protein Central Dogma Replication DNA RNA PROTEIN Transcription Translation RNA Viruses: genome is RNA Reverse Transcriptase
More informationWeek 3: Differential Geometry of Curves
Week 3: Differential Geometry of Curves Introduction We now know how to differentiate and integrate along curves. This week we explore some of the geometrical properties of curves that can be addressed
More informationTHE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION
THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION AND CALIBRATION Calculation of turn and beta intrinsic propensities. A statistical analysis of a protein structure
More informationThe Process of Cell Division. Lesson Overview. Lesson Overview The Process of Cell Division
Lesson Overview 10.2 The Process of Cell Division Chromosomes genetic information passed from parent to offspring is carried by chromosomes. Chromosomes enable precise DNA separation during cell division.
More informationYanping Fan 1, Nikolay Korolev 1 *, Alexander P. Lyubartsev 2 *, Lars Nordenskiöld 1. Abstract. Introduction
An Advanced Coarse-Grained Nucleosome Core Particle Model for Computer Simulations of Nucleosome- Nucleosome Interactions under Varying Ionic Conditions Yanping Fan 1, Nikolay Korolev 1 *, Alexander P.
More informationMitosis and Meiosis Cell growth and division
Mitosis and Meiosis Cell growth and division The larger the cell, the more trouble the cell has moving nutrients and waste across the cell membrane. 1. DNA/information overload As a cell increases in size,
More informationMolecular Mechanics. Yohann Moreau. November 26, 2015
Molecular Mechanics Yohann Moreau yohann.moreau@ujf-grenoble.fr November 26, 2015 Yohann Moreau (UJF) Molecular Mechanics, Label RFCT 2015 November 26, 2015 1 / 29 Introduction A so-called Force-Field
More informationCellular Reproduction = Cell Division. Passes on Genes from Cells to Cells Reproduction of Organisms
Cellular Reproduction = Cell Division Passes on Genes from Cells to Cells Reproduction of Organisms Genes DNA Chromatin fiber Chromosomes Fig. 9.6 Genes, the segments of DNA, are part of chromatin fiber
More informationTable S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.
Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-
More informationSupplementary Information
Supplementary Information Ballistic Thermal Transport in Carbyne and Cumulene with Micron-Scale Spectral Acoustic Phonon Mean Free Path Mingchao Wang and Shangchao Lin * Department of Mechanical Engineering,
More informationDNA topology in chromosomes: a quantitative survey and its physiological implications
J. Math. Biol. DOI 10.1007/s00285-012-0621-y Mathematical Biology DNA topology in chromosomes: a quantitative survey and its physiological implications Maria Barbi Julien Mozziconacci Hua Wong Jean-Marc
More informationElectrostatic Origin of Salt-Induced Nucleosome Array Compaction
1896 Biophysical Journal Volume 99 September 2010 1896 1905 Electrostatic Origin of Salt-Induced Nucleosome Array Compaction Nikolay Korolev, Abdollah Allahverdi, Ye Yang, Yanping Fan, Alexander P. Lyubartsev,
More informationMolecular Dynamics, Monte Carlo and Docking. Lecture 21. Introduction to Bioinformatics MNW2
Molecular Dynamics, Monte Carlo and Docking Lecture 21 Introduction to Bioinformatics MNW2 Allowed phi-psi angles Red areas are preferred, yellow areas are allowed, and white is avoided 2.3a Hamiltonian
More informationThe Molecular Dynamics Method
The Molecular Dynamics Method Thermal motion of a lipid bilayer Water permeation through channels Selective sugar transport Potential Energy (hyper)surface What is Force? Energy U(x) F = d dx U(x) Conformation
More informationT6.2 Molecular Mechanics
T6.2 Molecular Mechanics We have seen that Benson group additivities are capable of giving heats of formation of molecules with accuracies comparable to those of the best ab initio procedures. However,
More informationLecture 5: Macromolecules, polymers and DNA
1, polymers and DNA Introduction In this lecture, we focus on a subfield of soft matter: macromolecules and more particularly on polymers. As for the previous chapter about surfactants and electro kinetics,
More informationDNA supercoiling: plectonemes or curls?
DNA supercoiling: plectonemes or curls? Sébastien Neukirch CNRS & UPMC Univ. Paris 6 (France) John F. Marko Northwestern University (IL. USA) Why study DNA mechanical properties? mechanical properties
More informationCoil to Globule Transition: This follows Giant Molecules by Alexander Yu. Grosberg and Alexei R. Khokhlov (1997).
Coil to Globule Transition: This follows Giant Molecules by Alexander Yu. Grosberg and Alexei R. Khokhlov (1997). The Flory Krigbaum expression for the free energy of a self-avoiding chain is given by,
More information8.592J HST.452J: Statistical Physics in Biology
Assignment # 4 8.592J HST.452J: Statistical Physics in Biology Coulomb Interactions 1. Flory Theory: The Coulomb energy of a ball of charge Q and dimension R in d spacial dimensions scales as Q 2 E c.
More informationHomology modeling. Dinesh Gupta ICGEB, New Delhi 1/27/2010 5:59 PM
Homology modeling Dinesh Gupta ICGEB, New Delhi Protein structure prediction Methods: Homology (comparative) modelling Threading Ab-initio Protein Homology modeling Homology modeling is an extrapolation
More informationarxiv:cond-mat/ v1 [cond-mat.soft] 21 Mar 2003
arxiv:cond-mat/0303455v1 [cond-mat.soft] 21 Mar 2003 The physics of chromatin Contents Helmut Schiessel Max-Planck-Institut für Polymerforschung, Theory Group, P.O.Box 3148, D-55021 Mainz, Germany Abstract.
More information3. An Introduction to Molecular Mechanics
3. An Introduction to Molecular Mechanics Introduction When you use Chem3D to draw molecules, the program assigns bond lengths and bond angles based on experimental data. The program does not contain real
More informationContents. xiii. Preface v
Contents Preface Chapter 1 Biological Macromolecules 1.1 General PrincipIes 1.1.1 Macrornolecules 1.2 1.1.2 Configuration and Conformation Molecular lnteractions in Macromolecular Structures 1.2.1 Weak
More informationOn the Topology of Chromatin Fibers
On the Topology of Chromatin Fibers Maria Barbi Multiscale modeling of living matter (M3V) group" Laboratoire de Physique Théorique de la Matière Condensée (LPTMC), " CNRS-Université Paris VI, France"
More informationSupporting Information
Supporting Information Roles of Zeolite Confinement and Cu O Cu Angle on the Direct Conversion of Methane to Methanol by [Cu 2 (µ-o)] 2+ -exchanged AEI, CHA, AFX, and MFI Zeolites M. Haris Mahyuddin,,
More informationPotential Energy (hyper)surface
The Molecular Dynamics Method Thermal motion of a lipid bilayer Water permeation through channels Selective sugar transport Potential Energy (hyper)surface What is Force? Energy U(x) F = " d dx U(x) Conformation
More informationVideos. Bozeman, transcription and translation: https://youtu.be/h3b9arupxzg Crashcourse: Transcription and Translation - https://youtu.
Translation Translation Videos Bozeman, transcription and translation: https://youtu.be/h3b9arupxzg Crashcourse: Transcription and Translation - https://youtu.be/itsb2sqr-r0 Translation Translation The
More informationAssignment 2: Conformation Searching (50 points)
Chemistry 380.37 Fall 2015 Dr. Jean M. Standard September 16, 2015 Assignment 2: Conformation Searching (50 points) In this assignment, you will use the Spartan software package to investigate some conformation
More informationCHAPTER-IV. FT-IR and FT-Raman investigation on m-xylol using ab-initio HF and DFT calculations
4.1. Introduction CHAPTER-IV FT-IR and FT-Raman investigation on m-xylol using ab-initio HF and DFT calculations m-xylol is a material for thermally stable aramid fibers or alkyd resins [1]. In recent
More informationSupplementary Information. The Solution Structural Ensembles of RNA Kink-turn Motifs and Their Protein Complexes
Supplementary Information The Solution Structural Ensembles of RNA Kink-turn Motifs and Their Protein Complexes Xuesong Shi, a Lin Huang, b David M. J. Lilley, b Pehr B. Harbury a,c and Daniel Herschlag
More informationPhys 450 Spring 2011 Solution set 6. A bimolecular reaction in which A and B combine to form the product P may be written as:
Problem Phys 45 Spring Solution set 6 A bimolecular reaction in which A and combine to form the product P may be written as: k d A + A P k d k a where k d is a diffusion-limited, bimolecular rate constant
More informationSolutions to Assignment #4 Getting Started with HyperChem
Solutions to Assignment #4 Getting Started with HyperChem 1. This first exercise is meant to familiarize you with the different methods for visualizing molecules available in HyperChem. (a) Create a molecule
More informationSUPPLEMENTARY INFORMATION
Table of Contents Page Supplementary Table 1. Diffraction data collection statistics 2 Supplementary Table 2. Crystallographic refinement statistics 3 Supplementary Fig. 1. casic1mfc packing in the R3
More informationCell Growth, Division, and Reproduction
Cell Growth, Division, and Reproduction Human Development: Mitosis and Meiosis Division of the Cell Before a cell grows too large, it divides into two new daughter cells in a process called cell division.
More informationHyeyoung Shin a, Tod A. Pascal ab, William A. Goddard III abc*, and Hyungjun Kim a* Korea
The Scaled Effective Solvent Method for Predicting the Equilibrium Ensemble of Structures with Analysis of Thermodynamic Properties of Amorphous Polyethylene Glycol-Water Mixtures Hyeyoung Shin a, Tod
More informationSUPPLEMENTAL MATERIAL
SUPPLEMENTAL MATERIAL Systematic Coarse-Grained Modeling of Complexation between Small Interfering RNA and Polycations Zonghui Wei 1 and Erik Luijten 1,2,3,4,a) 1 Graduate Program in Applied Physics, Northwestern
More informationSelf-Assembly. Lecture 2 Lecture 2 Models of Self-Assembly
Self-Assembly Lecture 2 Lecture 2 Models of Self-Assembly Models of Self-Assembly The eaim: Solving the engineering ee g problems of self-assembly: forward, backward and the yield. understand the feasibility
More informationarxiv:cond-mat/ v3 [cond-mat.soft] 11 Oct 2001
Chromatin: a tunable spring at work inside chromosomes Eli Ben-Haïm, Annick Lesne and Jean-Marc Victor Laboratoire de Physique Théorique des Liquides, Université Pierre et Marie Curie, Case courrier 121,
More informationENG202 Statics Lecture 16, Section 7.1
ENG202 Statics Lecture 16, Section 7.1 Internal Forces Developed in Structural Members - Design of any structural member requires an investigation of the loading acting within the member in order to be
More informationPhysics Graduate Group. Saturday, September 15 th 2007
UNIVERSITY OF CALIFORNIA, MERCED Physics Graduate Group Saturday, September 15 th 2007 9:00 am 1:00 pm Instructions: 1 SHOW ALL WORK. 2 This is a closed book exam. 3 Do all eight (8) problems. 4 You have
More informationFigure 1. Molecules geometries of 5021 and Each neutral group in CHARMM topology was grouped in dash circle.
Project I Chemistry 8021, Spring 2005/2/23 This document was turned in by a student as a homework paper. 1. Methods First, the cartesian coordinates of 5021 and 8021 molecules (Fig. 1) are generated, in
More informationWhy study protein dynamics?
Why study protein dynamics? Protein flexibility is crucial for function. One average structure is not enough. Proteins constantly sample configurational space. Transport - binding and moving molecules
More informationGEM4 Summer School OpenCourseWare
GEM4 Summer School OpenCourseWare http://gem4.educommons.net/ http://www.gem4.org/ Lecture: Polymer Chains by Ju Li. Given August 16, 2006 during the GEM4 session at MIT in Cambridge, MA. Please use the
More informationProteins polymer molecules, folded in complex structures. Konstantin Popov Department of Biochemistry and Biophysics
Proteins polymer molecules, folded in complex structures Konstantin Popov Department of Biochemistry and Biophysics Outline General aspects of polymer theory Size and persistent length of ideal linear
More informationLesson Overview. Ribosomes and Protein Synthesis 13.2
13.2 The Genetic Code The first step in decoding genetic messages is to transcribe a nucleotide base sequence from DNA to mrna. This transcribed information contains a code for making proteins. The Genetic
More informationarxiv: v1 [cond-mat.soft] 22 Oct 2007
Conformational Transitions of Heteropolymers arxiv:0710.4095v1 [cond-mat.soft] 22 Oct 2007 Michael Bachmann and Wolfhard Janke Institut für Theoretische Physik, Universität Leipzig, Augustusplatz 10/11,
More informationDescribe the process of cell division in prokaryotic cells. The Cell Cycle
The Cell Cycle Objective # 1 In this topic we will examine the cell cycle, the series of changes that a cell goes through from one division to the next. We will pay particular attention to how the genetic
More informationSupporting Information for: Mechanism of Reversible Peptide-Bilayer. Attachment: Combined Simulation and Experimental Single-Molecule Study
Supporting Information for: Mechanism of Reversible Peptide-Bilayer Attachment: Combined Simulation and Experimental Single-Molecule Study Nadine Schwierz a,, Stefanie Krysiak c, Thorsten Hugel c,d, Martin
More informationTorsion Spring Oscillator with Dry Friction
Torsion Spring Oscillator with Dry Friction Manual Eugene Butikov Annotation. The manual includes a description of the simulated physical system and a summary of the relevant theoretical material for students
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature12242 C. thermophilum 666 RPAVLDNVYIRPALE-GKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQN S. pombe 659 RPAHINDVYVRPAID-GKRLPGFIEIHQNGIRYQSPLRSDSHIDLLFSNMKHLFFQPCEG
More informationForce Fields for Classical Molecular Dynamics simulations of Biomolecules. Emad Tajkhorshid
Force Fields for Classical Molecular Dynamics simulations of Biomolecules Emad Tajkhorshid Theoretical and Computational Biophysics Group, Beckman Institute Departments of Biochemistry and Pharmacology,
More informationUncoupling shear and uniaxial elastic moduli of semiflexible biopolymer networks:
Supplemental document for: Uncoupling shear and uniaxial elastic moduli of semiflexible biopolymer networks: compression-softening and stretch-stiffening Anne S. G. van Oosten 1, Mahsa Vahabi 2, Albert
More informationThree types of RNA polymerase in eukaryotic nuclei
Three types of RNA polymerase in eukaryotic nuclei Type Location RNA synthesized Effect of α-amanitin I Nucleolus Pre-rRNA for 18,.8 and 8S rrnas Insensitive II Nucleoplasm Pre-mRNA, some snrnas Sensitive
More informationRobotics I. Figure 1: Initial placement of a rigid thin rod of length L in an absolute reference frame.
Robotics I September, 7 Exercise Consider the rigid body in Fig., a thin rod of length L. The rod will be rotated by an angle α around the z axis, then by an angle β around the resulting x axis, and finally
More informationStress Analysis Lecture 4 ME 276 Spring Dr./ Ahmed Mohamed Nagib Elmekawy
Stress Analysis Lecture 4 ME 76 Spring 017-018 Dr./ Ahmed Mohamed Nagib Elmekawy Shear and Moment Diagrams Beam Sign Convention The positive directions are as follows: The internal shear force causes a
More informationSupporting Information
Projection of atomistic simulation data for the dynamics of entangled polymers onto the tube theory: Calculation of the segment survival probability function and comparison with modern tube models Pavlos
More informationQuantitative Analysis of Forces in Cells
Quantitative Analysis of Forces in Cells Anders Carlsson Washington University in St Louis Basic properties of forces in cells Measurement methods and magnitudes of particular types of forces: Polymerization
More informationAssignment 1: Molecular Mechanics (PART 1 25 points)
Chemistry 380.37 Fall 2015 Dr. Jean M. Standard August 19, 2015 Assignment 1: Molecular Mechanics (PART 1 25 points) In this assignment, you will perform some molecular mechanics calculations using the
More informationFacilitated diffusion of DNA-binding proteins
Facilitated diffusion of DNA-binding proteins Konstantin Klenin, Joerg Langowski, DKFZ Heidelberg, Germany Holger Merlitz, Chen-Xu Wu, Xiamen University Content: What is facilitated diffusion? Two competing
More informationLecture #13 10/3 Dr. Wormington
Lecture #13 10/3 Dr. Wormington The Molecular "Logic" of the Cell Cycle Recap 1. Cdks generally present throughout cell cycle but are inactive w/o cyclin subunits. 2. Cyclin subunits synthesized in discrete
More informationFinal Test CHEM 3121 and 6111 December 10 th, 1997
Name: Final Test CHEM 3121 and 6111 December 10 th, 1997 Numbers in bold indicate the maximum points available for that question. 1) Give the ground state electron configurations for the following atoms
More information