ELECTRONIC APPENDIX. This is the Electronic Appendix to the article

Size: px
Start display at page:

Download "ELECTRONIC APPENDIX. This is the Electronic Appendix to the article"

Transcription

1 ELECTRONIC APPENDIX This is the Electronic Appendix to the article Mitochondrial genomes suggest that hexapods and crustaceans are mutually paraphyletic by Charles E. Cook, Qiaoyun Yue, Michael Akam Proc. R. Soc. B (doi:1.198/rspb ) Electronic appendices are refereed with the text; however, no attempt is made to impose a uniform editorial style on the electronic appendices.

2 Cook, Yue & Akam: Mitochondria suggest paraphyly of hexapods and crustaceans Supplement p.1 Supplement Table A1. List of taxa used to construct the data sets used for phylogenetic analysis. Taxa newly reported in this paper are in bold. Taxon Accession number Taxonomy Crustacea Artemia franciscana NC_162 Branchiopoda; Anostraca Daphnia pulex NC_844 Branchiopoda; Cladocera Triops cancriformis NC_4465 Branchiopoda; Notostraca Triops longicaudatus AY Branchiopoda; Notostraca Hutchinsoniella macracantha AY Cephalocarida Parhyale hawaiiensis AY Malacostraca; Amphipoda Pagurus longicarpus AF15756 Malacostraca; Decapoda Panulirus japonicus NC_4251 Malacostraca; Decapoda Penaeus monodon NC_2184 Malacostraca; Decapoda Portunus trituberculatus NC_537 Malacostraca; Decapoda Squilla mantis AY Malacostraca; Hoplocarida Argulus americus AY Maxilliopoda; Branchiura Pollicipes polymerus AY Maxilliopoda; Cirripedia Tigriopus japnoicus NC_3979 Maxillopoda; Copepoda Vargula hilgendorfii NC_536 Maxillopoda; Ostracoda Armillifer armillatus AY Pentastomida Speleonectes tulumensis AY45619 Remipedia Hexapoda Gomphiocephalus hodgsoni NC_5438 Collembola Onychiurus orientalis AY Collembola Podura aquatica AY Collembola Tetrodontophora bielanensis NC_2735 Collembola Insecta Crioceris duodecimpunctata NC_3372 Coleoptera Pyrocoelia rufa NC_397 Coleoptera Tribolium castaneum NC_381 Coleoptera Chrysomya putoria NC_2697 Diptera; Muscomorpha Cochliomyia hominivorax NC_266 Diptera; Muscomorpha Drosophila melanogaster NC_179 Diptera; Muscomorpha Drosophila yakuba NC_1322 Diptera; Muscomorpha Ceratitis capitata NC_857 Diptera; Muscomorpha Anopheles gambiae NC_284 Diptera; Nematocera Anopheles quadrimaculatus NC_875 Diptera; Nematocera Triatoma dimidiata NC_269 Hemiptera Apis mellifera NC_1566 Hymenoptera Bombyx mandarina NC_3395 Lepidoptera Bombyx mori NC_2355 Lepidoptera Ostrinia furnicalis NC_3368 Lepidoptera Ostrinia nubilalis NC_3367 Lepidoptera Melipona bicolor NC_4529 Neoptera; Hymenoptera Antheraea pernyi NC_4622 Neoptera; Lepidoptera lepidopsocid RS-21 NC_4816 Neoptera; Psocoptera Thrips imaginis NC_4371 Neoptera; Thysanoptera Locusta migratoria NC_1712 Orthoptera

3 Cook, Yue & Akam: Mitochondria suggest paraphyly of hexapods and crustaceans Supplement p.2 Heterodoxus macrupus NC_2651 Phthiraptera Tricholepidion gertschi NC_5437 Thysanura Thermobia domestica AY Thysanura Chelicerata Ixodes hexagonus NC_21 Arachnida; Acari; Parasitiformes Ixodes persulcatus NC_437 Arachnida; Acari; Parasitiformes Ornithodoros moubata NC_4357 Arachnida; Acari; Parasitiformes Rhipicephalus sanguineus NC_274 Arachnida; Acari; Parasitiformes Varroa destructor NC_4454 Arachnida; Acari; Parasitiformes Limulus polyphemus AF21623 Merostomata; Xiphosura Myriapoda Lithobius forficatus NC_2629 Chilopoda Narceus annularus NC_3343 Diplopoda Thyropygus sp. NC_3344 Diplopoda

4 Cook, Yue & Akam: Mitochondria suggest paraphyly of hexapods and crustaceans Supplement p.3 Supplement Table A2. Percentage of each gene retained for phylogenetic analysis after elimination of poorly aligned regions using Gblocks. Note that the second column, total aa, refers to the number of amino acid positions in the complete alignment. Because there are gaps in some alignments this figure is greater than the total number of amino acid residues in a gene for any single taxon. Similarly, column five, percentage retained, is calculated based upon the total number of amino acid residues in the complete alignment. Gene Total aa aa retained Nucleotides retained Percentage retained atp atp8 58 cox cox cob nad nad nad nad nad4l nad nad Total

5 Cook, Yue & Akam: Mitochondria suggest paraphyly of hexapods and crustaceans Supplement p.4 Supplement Table A3. Results of composition-bias test from Tree-Puzzle for each of the 3 taxa used in the analysis, for each of four different data sets: nucleotide first and second positions only, all nucleotide positions, nucleotide data set in which first and third positions were RYencoded, nucleotide data set in which third positions were RY-encoded, and amino acids. Note that when third positions are RY-encoded no taxa fail the composition-bias test. Taxon 3taxa 3taxa 1st2nd all 3taxa 1st3rdRY 3taxa Amino 3rdRY acid Argulus americus f f f p f Armillifer armillatus f f f p f Artemia franciscana f f p p p Bombyx mandarina f f f p f Ceratitis capitata f f p p p Daphnia pulex f f p p f Gomphiocephalus hodgsoni p f p p p Hutchinsoniella macracantha f f p p p lepidopsocid RS-21 f f p p f Limulus polyphemus p f p p p Lithobius forficatus f f p p p Locusta migratoria p f p p p Narceus annularus f f p p p Onychiurus orientalis p f p p p Pagurus longicarpus p f p p p Parhyale hawaiiensis f f p p p Penaeus monodon p f p p p Podura aquatica p f p p p Pollicipes polymerus p f p p p Speleonectes tulumensis p f p p p Squilla mantis p f p p f Tetrodontophora bielanensis f f p p p Thermobia domestica p f p p p Thyropygus sp. p f p p p Tigriopus japnoicus f f p p p Triatoma dimidiata p f p p p Tribolium castaneum f f f p f Tricholepidion gertschi p f p p p Triops longicaudatus p f p p p Vargula hilgendorfii f f f p f number passing

6 Cook, Yue & Akam: Mitochondria suggest paraphyly of hexapods and crustaceans Supplement p.5 (a) First positions (b) First positions RY encoded (c) Second positions (d) First and second positions p-distances (e) Third positions (f) Third positions RY encoded (g) First, second + third RY (h) All positions GTR+I+G distances GTR+I+G distances Supplement Figure A1. Saturation testing. X-axis: maximum likelihood distances calculated using the best-fit model (GTR+I+G8). Y-axis: uncorrected p-distances. Distances were calculated with PAUP* [Swofford, 1998 #212] for the 3-taxon data set using various combinations of 1st, 2nd, and 3rd positions, including those data sets in which 1st and/or 3rd positions were RY encoded as indicated by each label. For each subset parameters were re-optimized before ML distances were calculated. If there is no saturation in the nucleotide substition process the points will fall on the line of Y=X. As saturation increases the line deviates. All axes have been normalized for comparison, except the X-axis for the third position data set. This data set shows near complete saturation when all four nucleotides are used to calculate distances (e), but reveals some signal when nucleotides are RY-encoded (f).

7 Cook, Yue & Akam: Mitochondria suggest paraphyly of hexapods and crustaceans Supplement p % 28.6% 21.9% 3.% 3.3% 3.8% 3.% 7.3% 3.4% 5.4% 3.8% 22.4% 27.7% 3.1% 28.5% 28.2% 3.5% 27.5% 22.4% 3.6% 22.2% 1st positions: 83.6% 2nd positions: 84.3% 3rd positions: 66.5% 31.6% 3% 17.3% 1.4% 2.3% 5.3% 1.2% 1.% 1.8% 1.7% 4.5% 32.% 31.6% 1.3% 32.% All positions: 95.2% 3% 1.7% 31.5% 1st&2nd positions: 92.5% 18.1% 5.3% 17.5% 3rd positions RY: 52.9% 31.6% 28.7% 32.3% 1.5% 2.8% 1.3% 1.3% 1.1% 3.% 4.2% 1.4% % 32.% 1.2% 31.3% 1st2nd3rdRY: 94.9% 29.3% 3.2% 28.9% 1stRY2nd3rdYR: 86.9% 31.6% 1.5% 31.4% Amino acids: 95.3% Supplement Figure A2. Likelihood maps for 3 taxa nucleotide data sets using various combinations of 1st, 2nd, and 3rd positions, including those data sets in which 1st and/or 3rd positions were RY encoded. Corners represent well-resolved quartets. The percentage of quartets within each region is indicated, and the total for all three corners is shown. The higher the total the more phylogenetic signal there is in that data set.

8 Cook, Yue & Akam: Mitochondria suggest paraphyly of hexapods and crustaceans Supplement p Vargula hilgendorfii Maxillopoda Ostracoda Artemia franciscana Branchiopoda Tigriopus japonicus Maxillopoda Copepoda Armillifer armillatus Maxillopoda Branchiura Argulus americus Maxillopoda Pentastomida Hutchinsoniella macracantha Maxillopoda Cephalocarida Parhyale hawaiiensis Malacostraca Gomphiocephalus hodgsoni Podura aquatica Collembola Onychiurus orientalis Tetrodontophora bielanensis Bombyx mandarina Tribolium castaneum lepidopsocid RS-21 Triatoma dimidiata Ceratitis capitata Locusta migratoria Thermobia domestica Tricholepidion gertschi Daphnia pulex Triops longicaudatus Squilla mantis Pagurus longicarpus Penaeus monodon Pollicipes polymerus Maxillopoda Cirripedia Speleonectes tulumensis Remmipedia Narceus annularis Thyropygus sp. Lithobius forficatus Insecta Branchiopoda Malacostraca Myriapoda Limulus polyphemus Chelicerata Supplement Figure A3. Estimates of arthropod phylogeny using an amino acid data set with 3 taxa. This is the consensus tree generated by MrBayes. Numbers indicate posterior probabilities for that branch of the tree in the Bayesian analysis. The positions of four taxa; A. franciscana, H. macracantha, P. hawaiiensis, and S. tulumensis, are different from the positions of these taxa in Figure 1.

Hexapoda Origins: Monophyletic, Paraphyletic or Polyphyletic? Rob King and Matt Kretz

Hexapoda Origins: Monophyletic, Paraphyletic or Polyphyletic? Rob King and Matt Kretz Hexapoda Origins: Monophyletic, Paraphyletic or Polyphyletic? Rob King and Matt Kretz Outline Review Hexapod Origins Response to Hexapod Origins How the same data = different trees Arthropod Origins The

More information

The Relationship Between the Rate of Molecular Evolution and the Rate of Genome Rearrangement in Animal Mitochondrial Genomes

The Relationship Between the Rate of Molecular Evolution and the Rate of Genome Rearrangement in Animal Mitochondrial Genomes J Mol Evol (2006) 63:375 392 DOI: 10.1007/s00239-005-0246-5 The Relationship Between the Rate of Molecular Evolution and the Rate of Genome Rearrangement in Animal Mitochondrial Genomes Wei Xu, 1 Daniel

More information

Hexapods Resurrected

Hexapods Resurrected Hexapods Resurrected (Technical comment on: "Hexapod Origins: Monophyletic or Paraphyletic?") Frédéric Delsuc, Matthew J. Phillips and David Penny The Allan Wilson Centre for Molecular Ecology and Evolution

More information

ALEXANDRE HASSANIN, 1 NELLY LÉGER, 2 AND JEAN DEUTSCH 3

ALEXANDRE HASSANIN, 1 NELLY LÉGER, 2 AND JEAN DEUTSCH 3 Syst. Biol. 54(2):277 298, 2005 Copyright c Society of Systematic Biologists ISSN: 1063-5157 print / 1076-836X online DOI: 10.1080/10635150590947843 Evidence for Multiple Reversals of Asymmetric Mutational

More information

Major rearrangements characterize the mitochondrial genome of the isopod Idotea baltica (Crustacea: Peracarida)

Major rearrangements characterize the mitochondrial genome of the isopod Idotea baltica (Crustacea: Peracarida) Molecular Phylogenetics and Evolution 40 (2006) 893 899 Short communication www.elsevier.com/locate/ympev Major rearrangements characterize the mitochondrial genome of the isopod Idotea baltica (Crustacea:

More information

A Site- and Time-Heterogeneous Model of Amino Acid Replacement

A Site- and Time-Heterogeneous Model of Amino Acid Replacement A Site- and Time-Heterogeneous Model of Amino Acid Replacement Samuel Blanquart and Nicolas Lartillot Laboratoire d Informatique, de Robotique et de Microélectronique de Montpellier, UMR 5506, CNRS-Université

More information

The Evolution of trna-leu Genes in Animal Mitochondrial Genomes

The Evolution of trna-leu Genes in Animal Mitochondrial Genomes The Evolution of trna-leu Genes in Animal Mitochondrial Genomes Paul G Higgs 1, Daniel Jameson 2, Howsun Jow 3 and Magnus Rattray 3. 1. Department of Physics, McMaster University, Hamilton, Ontario L8S

More information

Elongation Factor-2: A Useful Gene for Arthropod Phylogenetics

Elongation Factor-2: A Useful Gene for Arthropod Phylogenetics Molecular Phylogenetics and Evolution Vol. 20, No. 1, July, pp. 136 148, 2001 doi:10.1006/mpev.2001.0956, available online at http://www.idealibrary.com on Elongation Factor-2: A Useful Gene for Arthropod

More information

Biology ENTOMOLOGY Dr. Tatiana Rossolimo, Class syllabus

Biology ENTOMOLOGY Dr. Tatiana Rossolimo,   Class syllabus Biology 3327.03 ENTOMOLOGY Dr. Tatiana Rossolimo, e-mail: trossoli@dal.ca Class syllabus Insects are the most biodiverse group of organisms on the Earth. They far surpass other terrestrial animals in abundance

More information

Comparative insect mitochondrial genomes: Differences despite conserved genome synteny

Comparative insect mitochondrial genomes: Differences despite conserved genome synteny African Journal of Biotechnology Vol. 5 (14), pp. 1308-1318, 16 July 2006 Available online at http://www.academicjournals.org/ajb ISSN 1684 5315 2006 Academic Journals Full Length Research Paper Comparative

More information

Adam D. Miller, Thuy T.T. Nguyen, Christopher P. Burridge, Christopher M. Austin*

Adam D. Miller, Thuy T.T. Nguyen, Christopher P. Burridge, Christopher M. Austin* Gene 331 (2004) 65 72 www.elsevier.com/locate/gene Complete mitochondrial DNA sequence of the Australian freshwater crayfish, Cherax destructor (Crustacea: Decapoda: Parastacidae): a novel gene order revealed

More information

The complete mitochondrial genome of the subterranean crustacean Metacrangonyx longipes

The complete mitochondrial genome of the subterranean crustacean Metacrangonyx longipes The complete mitochondrial genome of the subterranean crustacean Metacrangonyx longipes (mphipoda): a unique gene order and extremely short control region MRI DEL MR BZÀ-RIBOT 1, DMIÀ JME 2, RLOS JN 1,

More information

Author's personal copy

Author's personal copy Molecular Phylogenetics and Evolution 52 (2009) 268 272 Contents lists available at ScienceDirect Molecular Phylogenetics and Evolution journal homepage: www.elsevier.com/locate/ympev Short Communication

More information

Arthropods (Arthropoda)

Arthropods (Arthropoda) Arthropods (Arthropoda) Davide Pisani Laboratory of Evolutionary Biology, Department of Biology, The National University of Ireland, Maynooth, Co. Kildare, Ireland (davide. pisani@nuim.ie) Abstract Living

More information

Arthropod Structure & Development

Arthropod Structure & Development Arthropod Structure & Development 39 (2010) 88 110 Contents lists available at ScienceDirect Arthropod Structure & Development journal homepage: www.elsevier.com/locate/asd Arthropod phylogeny revisited,

More information

A Contribution to the Phylogeny of the Ciidae and its Relationships with Other Cucujoid and Tenebrionoid Beetles (Coleoptera: Cucujiformia)

A Contribution to the Phylogeny of the Ciidae and its Relationships with Other Cucujoid and Tenebrionoid Beetles (Coleoptera: Cucujiformia) Arthropod Systematics & Phylogeny I 66 (2) Electronic Supplement Museum für Tierkunde Dresden, ISSN 1863-7221, 5.12.2008 A Contribution to the Phylogeny of the Ciidae and its Relationships with Other Cucujoid

More information

Complete Mitochondrial Genome of a Tongue Worm Armillifer agkistrodontis

Complete Mitochondrial Genome of a Tongue Worm Armillifer agkistrodontis ISSN (Print) 0023-4001 ISSN (Online) 1738-0006 BRIEF COMMUNICATION Korean J Parasitol Vol. 54, No. 6: 813-817, December 2016 https://doi.org/10.3347/kjp.2016.54.6.813 Complete Mitochondrial Genome of a

More information

Large-scale gene family analysis of 76 Arthropods

Large-scale gene family analysis of 76 Arthropods Large-scale gene family analysis of 76 Arthropods i5k webinar / September 5, 28 Gregg Thomas @greggwcthomas Indiana University The genomic basis of Arthropod diversity https://www.biorxiv.org/content/early/28/8/4/382945

More information

Appendix 1: Chemical properties of all habitats and study plot 1 of FCRE Naturally Recovering Pasture

Appendix 1: Chemical properties of all habitats and study plot 1 of FCRE Naturally Recovering Pasture APPENDICES Chen and Mahlab, 2008. Chemical analysis Chemical Appendix 1: Chemical properties of all habitats and study plot 1 of FCRE Naturally Primary regenerated Hardwood Thick Thin Recovering Unit Bamboo

More information

Resolving Arthropod Phylogeny: Exploring Phylogenetic Signal within 41 kb of Protein-Coding Nuclear Gene Sequence

Resolving Arthropod Phylogeny: Exploring Phylogenetic Signal within 41 kb of Protein-Coding Nuclear Gene Sequence USYB #357247, VOL 57, ISS 6 Resolving Arthropod Phylogeny: Exploring Phylogenetic Signal within 41 kb of Protein-Coding Nuclear Gene Sequence JEROME C. REGIER, JEFFREY W. SHULTZ, AUSTEN R. D. GANLEY, APRIL

More information

Main arthropod clades (Regier et al 2010)

Main arthropod clades (Regier et al 2010) Main arthropod clades (Regier et al 2010) Trilobita Chelicerata Mandibulata Myriapoda (Chilopoda, Diplopoda) Pancrustacea Oligostraca (Ostracoda, Branchiura) Altocrustacea Vericrustacea» (Branchiopoda,

More information

, $9000 9/1/99 8/30/2004 PI

, $9000 9/1/99 8/30/2004 PI Results from Prior NSF Support (Regier and Shultz, last 5 years) Regier, J.C., Friedlander, T.P., Mitter, C., and Peigler, R.S. "Multiple Nuclear Genes for Lepidopteran Phylogenetics," DEB-9509174. 9/1/95-2/28/97.

More information

... Arthropod phylogeny based on eight molecular loci and morphology

... Arthropod phylogeny based on eight molecular loci and morphology melanogaster (U341), mosquito Anopheles quadrimaculatus (L04272), mosquito Anopheles gambiae (L20934), med y Ceratitis capitata (CCA242872), Cochliomyia hominivorax (AF260826), locust Locusta migratoria

More information

Evidence from Mitochondrial Genomics on Interordinal Relationships in Insects

Evidence from Mitochondrial Genomics on Interordinal Relationships in Insects Arthropod Systematics & Phylogeny 27 64 (1) 27 34 Museum für Tierkunde Dresden, ISSN 1863-7221, 30.10.2006 Evidence from Mitochondrial Genomics on Interordinal Relationships in Insects STEPHEN L. CAMERON

More information

A Comparative Analysis of Mitochondrial Genomes in Coleoptera (Arthropoda: Insecta) and Genome Descriptions of Six New Beetles

A Comparative Analysis of Mitochondrial Genomes in Coleoptera (Arthropoda: Insecta) and Genome Descriptions of Six New Beetles A Comparative Analysis of Mitochondrial Genomes in Coleoptera (Arthropoda: Insecta) and Genome Descriptions of Six New Beetles N.C. Sheffield,* H. Song,* S.L. Cameron, and M.F. Whiting* *Department of

More information

Ecdysozoan phylogeny and Bayesian inference: first use of nearly complete 28S and 18S rrna gene sequences to classify the arthropods and their kin q

Ecdysozoan phylogeny and Bayesian inference: first use of nearly complete 28S and 18S rrna gene sequences to classify the arthropods and their kin q Molecular Phylogenetics and Evolution 31 (2004) 178 191 MOLECULAR PHYLOGENETICS AND EVOLUTION www.elsevier.com/locate/ympev Ecdysozoan phylogeny and Bayesian inference: first use of nearly complete 28S

More information

Molecular phylogenetic analyses support the monophyly of Hexapoda and suggest the paraphyly of Entognatha

Molecular phylogenetic analyses support the monophyly of Hexapoda and suggest the paraphyly of Entognatha Molecular phylogenetic analyses support the monophyly of Hexapoda and suggest the paraphyly of Sasaki et al. Sasaki et al. BMC Evolutionary Biology 2013, 13:236 Sasaki et al. BMC Evolutionary Biology 2013,

More information

Chapter 12: Aquatic Mandibulates

Chapter 12: Aquatic Mandibulates Chapter 12: Aquatic Mandibulates Phylum Arthropoda Subphylum: Crustacea (Latin crusta = shell) Class: Malacostraca Order: Decapoda Order: Euphausiacea Order: Amphipoda Order: Isopoda Class: Maxillopoda

More information

BIOLOGICAL SCIENCE FUNDAMENTALS AND SYSTEMATICS Vol. III - Arthropods other than Insects - Frederick R. Schram, Sven Lange, Alessandro Minelli,

BIOLOGICAL SCIENCE FUNDAMENTALS AND SYSTEMATICS Vol. III - Arthropods other than Insects - Frederick R. Schram, Sven Lange, Alessandro Minelli, ARTHROPODS OTHER THAN INSECTS Frederick R. Schram and Sven Lange Institute of Biodiversity and Ecosystem Dynamics, University of Amsterdam, Netherland Alessandro Minelli, Department of Biology, University

More information

BMC Evolutionary Biology

BMC Evolutionary Biology BMC Evolutionary Biology BioMed Central Research article Revealing pancrustacean relationships: Phylogenetic analysis of ribosomal protein genes places Collembola (springtails) in a monophyletic Hexapoda

More information

On the Phylogenetic Position of Insects in the Pancrustacea Clade

On the Phylogenetic Position of Insects in the Pancrustacea Clade ISSN 0026-8933, Molecular Biology, 2009, Vol. 43, No. 5, pp. 804 818. Pleiades Publishing, Inc., 2009. Original Russian Text V.V. Aleshin, K.V. Mikhailov, A.V. Konstantinova, M.A. Nikitin, L.Yu. Rusin,

More information

Recent advances in crustacean genomics

Recent advances in crustacean genomics 852 Recent advances in crustacean genomics Jonathon H. Stillman, 1, John K. Colbourne, Carol E. Lee, Nipam H. Patel,,ô Michelle R. Phillips, k David W. Towle, # Brian D. Eads, Greg W. Gelembuik, Raymond

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

Molecular Phylogenetics and Evolution

Molecular Phylogenetics and Evolution Molecular Phylogenetics and Evolution 56 (2010) 796 807 Contents lists available at ScienceDirect Molecular Phylogenetics and Evolution journal homepage: www.elsevier.com/locate/ympev Nucleotide substitution

More information

Supporting Information

Supporting Information Supporting Information Pueyo et al. 10.1073/pnas.0804093105 SI Text Periplaneta americana (Delta GenBank Accession Number FJ222590). MR- WTQQTRVQGAVVVVILAALQQVCCSGVFELRLKSF- INDYGKDSVGQCCSGTPSPGTKACSGPCRTRFRVCL-

More information

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila

More information

SCIENCE CHINA Life Sciences

SCIENCE CHINA Life Sciences SCIENCE CHINA Life Sciences RESEARCH PAPER July 2012 Vol.55 No.7: 591 598 doi: 10.1007/s11427-012-4348-1 Complete mitochondrial genome of the Japanese snapping shrimp Alpheus japonicus (Crustacea: Decapoda:

More information

SEQUENCE ALIGNMENT, PARAMETER SENSITIVIT~ AND THE PHYLOGENETIC ANALYSIS OF MOLECULAR DATA

SEQUENCE ALIGNMENT, PARAMETER SENSITIVIT~ AND THE PHYLOGENETIC ANALYSIS OF MOLECULAR DATA Syst. BioI. 44(3):321-331, 1995 SEQUENCE ALIGNMENT, PARAMETER SENSITIVIT AND THE PHYLOGENETIC ANALYSIS OF MOLECULAR DATA WARD C. WHEELER Department of Invertebrates, American Museum of Natural History,

More information

Classification in General

Classification in General Classification in General Domains Carl Woese-1980s Based upon modern techniques Sequence of rrna in ribosomes trna Plasma membrane lipid structure Sensitivity to antibiotics Three cell types based upon

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

Evolutionary History of Chemosensory-Related Gene Families across the Arthropoda

Evolutionary History of Chemosensory-Related Gene Families across the Arthropoda Evolutionary History of Chemosensory-Related Gene Families across the Arthropoda Seong-il Eyun,,1 Ho Young Soh, 2 Marijan Posavi, 3 James B. Munro, 4 Daniel S.T. Hughes, 5 Shwetha C. Murali, 5 Jiaxin Qu,

More information

Corresponding author: J.S. Hao / Q. Yang /

Corresponding author: J.S. Hao / Q. Yang   / Complete mitochondrial genomes of the Bright Sunbeam Curetis bulis and the Small Copper Lycaena phlaeas (Lepidoptera: Lycaenidae) and their phylogenetic implications L.L. Zhang 1, J.S. Hao 1,2, D.Y. Huang

More information

Unit 3 Insect Orders

Unit 3 Insect Orders Unit 3 Insect Orders General Directions: 1. To complete this study guide, please read the assigned readings for Unit 3 and watch the lecture. If you need additional information to complete this study guide,

More information

Biomass estimates of terrestrial arthropods based on body length

Biomass estimates of terrestrial arthropods based on body length J. Biosci., Vol. 22, Number 2, March 1997, pp 219 224. Printed in India. Biomass estimates of terrestrial arthropods based on body length S R GANIHAR Department of Zoology, Dhempe College of Arts and Science,

More information

Comparative genomic analysis of crustacean hyperglycemic hormone (CHH) neuropeptide genes across diverse crustacean species

Comparative genomic analysis of crustacean hyperglycemic hormone (CHH) neuropeptide genes across diverse crustacean species RESEARCH ARTICLE Comparative genomic analysis of crustacean hyperglycemic hormone (CHH) neuropeptide genes across diverse crustacean species [version 1; referees: 1 approved with reservations] Wai Hoong

More information

Columbia River Project Water Use Plan. Lower Columbia River Fish Management

Columbia River Project Water Use Plan. Lower Columbia River Fish Management Columbia River Project Water Use Plan Lower Columbia River Fish Management Implementation Year 2 Reference: CLBMON-45 Addendum Lower Columbia River Fish Indexing Survey Study Period: 2008 Golder Associates

More information

Martin Bader June 25, On Reversal and Transposition Medians

Martin Bader June 25, On Reversal and Transposition Medians Martin Bader June 25, 2009 On Reversal and Transposition Medians Page 2 On Reversal and Transposition Medians Martin Bader June 25, 2009 Genome Rearrangements During evolution, the gene order in a chromosome

More information

Hox genes and evolution of body plan

Hox genes and evolution of body plan Hox genes and evolution of body plan Prof. LS Shashidhara Indian Institute of Science Education and Research (IISER), Pune ls.shashidhara@iiserpune.ac.in 2009 marks 150 years since Darwin and Wallace proposed

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:1.138/nature1213 Supplementary Table 1. The Taxonomy of the Organisms Used in this Study Organism (acronym) Taxonomy Yeasts Zygosacharomyces rouxii (Zrou) Verterbrates Xenopus tropicalis (Xtro) Gallus

More information

Phylogeny of Spiralia

Phylogeny of Spiralia Phylogeny of Spiralia Pogonophora Ectoprocta Mollusca Annelida Eutrochozoa Lophophorata Lophotrochozoa Spiralia Practice Exam Essay Pretend that I am cookie monster and I ask you to explain the animal

More information

The Wonderful World of Insects. James A. Bethke University of California Cooperative Extension Farm Advisor Floriculture and Nursery San Diego County

The Wonderful World of Insects. James A. Bethke University of California Cooperative Extension Farm Advisor Floriculture and Nursery San Diego County The Wonderful World of Insects James A. Bethke University of California Cooperative Extension Farm Advisor Floriculture and Nursery San Diego County Taxonomy The Insects The Orders Part I Taxonomy Scientific

More information

ASSESSING INVERTEBRATE PREY PRODUCTION IN THE SKOKOMISH ESTUARY

ASSESSING INVERTEBRATE PREY PRODUCTION IN THE SKOKOMISH ESTUARY USGS - Page 1 of 15 Western Ecological Research Center San Francisco Bay Estuary Field Station, 55 Azuar Drive, Vallejo, CA 94592 ASSESSING INVERTEBRATE PREY PRODUCTION IN THE SKOKOMISH ESTUARY JANUARY

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

The complete mitochondrial genome of Scutigerella causeyae (Myriapoda: Symphyla) and the phylogenetic position of Symphyla

The complete mitochondrial genome of Scutigerella causeyae (Myriapoda: Symphyla) and the phylogenetic position of Symphyla Molecular Phylogenetics and Evolution 45 (2007) 251 260 www.elsevier.com/locate/ympev The complete mitochondrial genome of Scutigerella causeyae (Myriapoda: Symphyla) and the phylogenetic position of Symphyla

More information

Supplemental Tables. Table S1: Summary of all cave and landscape metrics. Variable Description Values (min / max) Species composition - MDS1.

Supplemental Tables. Table S1: Summary of all cave and landscape metrics. Variable Description Values (min / max) Species composition - MDS1. Supplemental Tables Table S1: Summary of all cave and landscape metrics. Variable Description Values (min / max) Species composition - MDS1 Species composition - MDS2 Scores calculated from Non-metric

More information

Pancrustacean phylogeny in the light of new phylogenomic. data: support for Remipedia as the possible sister group of

Pancrustacean phylogeny in the light of new phylogenomic. data: support for Remipedia as the possible sister group of MBE Advance Access published November 1, 2011 Pancrustacean phylogeny in the light of new phylogenomic data: support for Remipedia as the possible sister group of Hexapoda Research Article Bjoern M von

More information

Dr.Mahesha H B, Yuvaraja s College, University of Mysore, Mysuru.

Dr.Mahesha H B, Yuvaraja s College, University of Mysore, Mysuru. Classification of sericigenous insects, characteristic features of the order Lepidoptera and the detailed study of the families Bombycidae and Saturnidae. Dr.Mahesha H B, Yuvaraja s College, University

More information

MOLECULAR INSIGHTS TO CRUSTACEAN PHYLOGENY

MOLECULAR INSIGHTS TO CRUSTACEAN PHYLOGENY MOLECULAR INSIGHTS TO CRUSTACEAN PHYLOGENY DISSERTATION zur Erlangung des Doktorgrades (Dr. rer. nat.) an der Mathematisch-Naturwissenschaftlichen Fakultät der Rheinischen Friedrich-Wilhelms-Universität

More information

Phylum Arthropoda. Phylum Arthropoda. Arthropods dominate the planet by number of species 7/5/2017. Out of Chaos, Order(s) Lots and lots of relatives

Phylum Arthropoda. Phylum Arthropoda. Arthropods dominate the planet by number of species 7/5/2017. Out of Chaos, Order(s) Lots and lots of relatives Out of Chaos, Order(s) 2017 Master Gardener College Erwin Duke Elsner Consumer Horticulture/Small Fruit Extension Educator 520 W. Front Street elsner@anr.msu.edu 231-922-4822 Phylum Arthropoda Insects

More information

ENTOMOLOGY Updated 3/4/15

ENTOMOLOGY Updated 3/4/15 ENTOMOLOGY Updated 3/4/15 Purpose: To increase the educational value of the curriculum through visual aids during Entomology course work and to produce more hands on experiences. Objectives: - To develop

More information

How Molecules Evolve. Advantages of Molecular Data for Tree Building. Advantages of Molecular Data for Tree Building

How Molecules Evolve. Advantages of Molecular Data for Tree Building. Advantages of Molecular Data for Tree Building How Molecules Evolve Guest Lecture: Principles and Methods of Systematic Biology 11 November 2013 Chris Simon Approaching phylogenetics from the point of view of the data Understanding how sequences evolve

More information

Phylogenetic Tree Reconstruction

Phylogenetic Tree Reconstruction I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven

More information

MORE ON INSECT IDENTIFICATION

MORE ON INSECT IDENTIFICATION MORE ON INSECT IDENTIFICATION An earlier item in the Newsletter (2(2): 42-45) offered some suggestions for ways in which systematists and the users of identifications could work together for mutual benefit

More information

Report. Molecular Timetrees Reveal a Cambrian Colonization of Land and a New Scenario for Ecdysozoan Evolution

Report. Molecular Timetrees Reveal a Cambrian Colonization of Land and a New Scenario for Ecdysozoan Evolution Current Biology 23, 392 398, March 4, 2013 ª2013 Elsevier Ltd All rights reserved http://dx.doi.org/10.1016/j.cub.2013126 Molecular Timetrees Reveal a Cambrian Colonization of Land and a New Scenario for

More information

C.DARWIN ( )

C.DARWIN ( ) C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11510 Supplementary Table 1. Indel Index Removal Gene Number of Starting Sequences Number of Final Sequences Percentage of Sequences Removed based on the Indel

More information

Neurophylogeny: Architecture of the nervous system and a fresh view on arthropod phyologeny

Neurophylogeny: Architecture of the nervous system and a fresh view on arthropod phyologeny 162 Neurophylogeny: Architecture of the nervous system and a fresh view on arthropod phyologeny Steffen Harzsch 1 Universität Ulm, Abteilung Neurobiologie and Sektion Biosystematische Dokumentation, Albert-Einstein-Strasse

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Effects of Gap Open and Gap Extension Penalties

Effects of Gap Open and Gap Extension Penalties Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See

More information

Centre Robert-Cedergren pour la Bioinformatique, Département de Biochimie, Université de Montréal, Québec,

Centre Robert-Cedergren pour la Bioinformatique, Département de Biochimie, Université de Montréal, Québec, April 9, 2013 PhyloBayes MPI. Supplementary information Nicolas Lartillot, Nicolas Rodrigue, Daniel Stubbs, Jacques Richer. Centre Robert-Cedergren pour la Bioinformatique, Département de Biochimie, Université

More information

BMC Biology. Open Access. Abstract. BioMed Central

BMC Biology. Open Access. Abstract. BioMed Central BMC Biology BioMed Central Research article The colonization of land by animals: molecular phylogeny and divergence times among arthropods Davide Pisani 1, Laura L Poling 1,2, Maureen Lyons-Weiler 1,3

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

www.ugaextension.com 1 General Entomology Susan Ellis, www.insectimages.org Prepared from information written by Dr. Kris Braman, Dr. Beverly Sparks, Dr. David Adams Learning objectives Basic classification

More information

Analysis of 18S rrna gene of Octostigma sinensis (Projapygoidea: Octostigmatidae) supports the monophyly of Diplura

Analysis of 18S rrna gene of Octostigma sinensis (Projapygoidea: Octostigmatidae) supports the monophyly of Diplura Pedobiologia 48 (2004) 453 459 6th INTERNATIONAL SEMINAR ON APTERYGOTA, SIENA, ITALY, 2002 Analysis of 18S rrna gene of Octostigma sinensis (Projapygoidea: Octostigmatidae) supports the monophyly of Diplura

More information

Ode-to-nata (Aeshna canadensis) productions presents

Ode-to-nata (Aeshna canadensis) productions presents Ode-to-nata (Aeshna canadensis) productions presents Taxonomy and Anatomy of Apis millefera What s in a (Latin)name? Apis= bee Melli= honey Ferre= to bear honey bearing bee A quick overview of classification.

More information

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species

More information

Remipedia and the Evolution of Hexapods

Remipedia and the Evolution of Hexapods and the Evolution of Hexapods Björn M von Reumont, Zoologisches Forschungsmuseum Alexander Koenig, Adenauerallee, Bonn, Germany Thorsten Burmester, Biozentrum Grindel und Zoologisches Museum, Universität

More information

Accelerated Evolution of Mitochondrial but Not Nuclear Genomes of Hymenoptera: New Evidence from Crabronid Wasps

Accelerated Evolution of Mitochondrial but Not Nuclear Genomes of Hymenoptera: New Evidence from Crabronid Wasps Accelerated Evolution of Mitochondrial but Not Nuclear Genomes of Hymenoptera: New Evidence from Crabronid Wasps Martin Kaltenpoth 1,2,3 *, Patrice Showers Corneli 4, Diane M. Dunn 2, Robert B. Weiss 2,

More information

Gene 424 (2008) Contents lists available at ScienceDirect. Gene. journal homepage:

Gene 424 (2008) Contents lists available at ScienceDirect. Gene. journal homepage: Gene 424 (2008) 18 24 Contents lists available at ScienceDirect Gene journal homepage: www.elsevier.com/locate/gene The complete mitochondrial genome of Parafronurus youi (Insecta: Ephemeroptera) and phylogenetic

More information

A novel laminin β gene BmLanB1-w regulates wing-specific cell adhesion in silkworm, Bombyx mori

A novel laminin β gene BmLanB1-w regulates wing-specific cell adhesion in silkworm, Bombyx mori Supplementary information A novel laminin β gene BmLanB1-w regulates wing-specific cell adhesion in silkworm, Bombyx mori Xiaoling Tong*, Songzhen He *, Jun Chen, Hai Hu, Zhonghuai Xiang, Cheng Lu and

More information

Phylogenetic inference at different insect taxonomic levels

Phylogenetic inference at different insect taxonomic levels Phylogenetic inference at different insect taxonomic levels Inferència filogenètica a diferents nivells taxonòmics d insectes - TESI DOCTORAL - Gerard Talavera Mor Bellaterra, Octubre del 2012 Facultat

More information

Figure A1. Phylogenetic trees based on concatenated sequences of eight MLST loci. Phylogenetic trees were constructed based on concatenated sequences

Figure A1. Phylogenetic trees based on concatenated sequences of eight MLST loci. Phylogenetic trees were constructed based on concatenated sequences A. B. Figure A1. Phylogenetic trees based on concatenated sequences of eight MLST loci. Phylogenetic trees were constructed based on concatenated sequences of eight housekeeping loci for 12 unique STs

More information

Consensus Methods. * You are only responsible for the first two

Consensus Methods. * You are only responsible for the first two Consensus Trees * consensus trees reconcile clades from different trees * consensus is a conservative estimate of phylogeny that emphasizes points of agreement * philosophy: agreement among data sets is

More information

Modern cellular organisms. From

Modern cellular organisms. From Modern cellular organisms From http://www.ucmp.berkeley.edu/exhibit/phylogeny.html Endothelial cell Lysosomes, mitochondria and nucleus See the cellular cytoskeleton, ER and nucleus Modern cells are complex

More information

Marine medaka ATP-binding cassette (ABC) superfamily and new insight into teleost Abch nomenclature

Marine medaka ATP-binding cassette (ABC) superfamily and new insight into teleost Abch nomenclature Supplementary file for: Marine medaka ATP-binding cassette (ABC) superfamily and new insight into teleost Abch nomenclature Chang-Bum Jeong a,b,#, Bo-Mi Kim a,#, Hye-Min Kang a, Ik-Young Choi c, Jae-Sung

More information

Supplementary Figure 1 Histogram of the marginal probabilities of the ancestral sequence reconstruction without gaps (insertions and deletions).

Supplementary Figure 1 Histogram of the marginal probabilities of the ancestral sequence reconstruction without gaps (insertions and deletions). Supplementary Figure 1 Histogram of the marginal probabilities of the ancestral sequence reconstruction without gaps (insertions and deletions). Supplementary Figure 2 Marginal probabilities of the ancestral

More information

Sampling Daphnia's expressed genes: preservation, expansion and invention of crustacean genes with reference to insect genomes

Sampling Daphnia's expressed genes: preservation, expansion and invention of crustacean genes with reference to insect genomes University of New Hampshire University of New Hampshire Scholars' Repository Hubbard Center for Genome Studies (HCGS) Research Institutes, Centers and Programs 7-6-2007 Sampling Daphnia's expressed genes:

More information

Garden Insects of Central WA

Garden Insects of Central WA Garden Insects of Central WA Ø Ruth Hardison Ø Mike Bush Ø Master Gardener Training- January 27, 2016 Photo courtesy- Susan Spain, Yakima Co. Master Gardener A Little Taxonomy Kingdom = Animal Phylum =

More information

Phylogenetics: Bayesian Phylogenetic Analysis. COMP Spring 2015 Luay Nakhleh, Rice University

Phylogenetics: Bayesian Phylogenetic Analysis. COMP Spring 2015 Luay Nakhleh, Rice University Phylogenetics: Bayesian Phylogenetic Analysis COMP 571 - Spring 2015 Luay Nakhleh, Rice University Bayes Rule P(X = x Y = y) = P(X = x, Y = y) P(Y = y) = P(X = x)p(y = y X = x) P x P(X = x 0 )P(Y = y X

More information

Contents. 1 Introduction to Meiobenthology Meiobenthos and Meiofauna: Definitions A History of Meiobenthology...

Contents. 1 Introduction to Meiobenthology Meiobenthos and Meiofauna: Definitions A History of Meiobenthology... Contents 1 Introduction to Meiobenthology................................ 1 1.1 Meiobenthos and Meiofauna: Definitions..................... 1 1.2 A History of Meiobenthology...............................

More information

Importance of Taxonomic Collections

Importance of Taxonomic Collections Importance of Taxonomic Collections Document earth s biodiversity Facilitate the process of researching relationships among and within different groups of organisms Study ecological processes using special

More information

PHYLOGENY AND SYSTEMATICS

PHYLOGENY AND SYSTEMATICS AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study

More information

Evolution of sex-dependent mtdna transmission in freshwater mussels (Bivalvia: Unionida)

Evolution of sex-dependent mtdna transmission in freshwater mussels (Bivalvia: Unionida) Evolution of sex-dependent mtdna transmission in freshwater mussels (Bivalvia: Unionida) Davide Guerra 1, Federico Plazzi 2, Donald T. Stewart 3, Arthur E. Bogan 4, Walter R. Hoeh 5 & Sophie Breton 1 1

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Advances in Crustacean Phylogenetics *

Advances in Crustacean Phylogenetics * Arthropod Systematics & Phylogeny 275 67 (2) 275 286 Museum für Tierkunde Dresden, eissn 1864-8312, 25.8.2009 Advances in Crustacean Phylogenetics * STEFAN RICHTER, OLE S. MØLLER & CHRISTIAN S. WIRKNER

More information

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments

More information

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree) I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by

More information

Mitochondrial Genome Annotation

Mitochondrial Genome Annotation Protein Genes 1,2 1 Institute of Bioinformatics University of Leipzig 2 Department of Bioinformatics Lebanese University TBI Bled 2015 Outline Introduction Mitochondrial DNA Problem Tools Training Annotation

More information

Reconstruction of species trees from gene trees using ASTRAL. Siavash Mirarab University of California, San Diego (ECE)

Reconstruction of species trees from gene trees using ASTRAL. Siavash Mirarab University of California, San Diego (ECE) Reconstruction of species trees from gene trees using ASTRAL Siavash Mirarab University of California, San Diego (ECE) Phylogenomics Orangutan Chimpanzee gene 1 gene 2 gene 999 gene 1000 Gorilla Human

More information

Calculating the Evolutionary Rates of Different Genes: A Fast, Accurate Estimator with Applications to Maximum Likelihood Phylogenetic Analysis

Calculating the Evolutionary Rates of Different Genes: A Fast, Accurate Estimator with Applications to Maximum Likelihood Phylogenetic Analysis Syst. Biol. 54(6):900 915, 2005 Copyright c Society of Systematic Biologists ISSN: 1063-5157 print / 1076-836X online DOI: 10.1080/10635150500354829 Calculating the Evolutionary Rates of Different Genes:

More information