Multiple Sequence Alignment
|
|
- Russell Thornton
- 5 years ago
- Views:
Transcription
1 Multiple Sequence Alignment
2 Multiple Alignment versus Pairwise Alignment Up until now we have only tried to align two sequences. What about more than two? And what for? A faint similarity between two sequences becomes significant if present in many Multiple alignments can reveal subtle similarities that pairwise alignments do not reveal
3 Generalizing the Notion of Pairwise Alignment Alignment of 2 sequences is represented as a 2-row matrix In a similar way, we represent alignment of 3 sequences as a 3-row matrix A T - G C G - A _ C G T - A A T C A C - A Score: more conserved columns, better alignment
4 Aligning Three Sequences Same strategy as aligning two sequences Use a 3-D Manhattan Cube, with each axis representing a sequence to align For global alignments, go from source to sink source sink
5 2-D cell versus 2-D Alignment Cell In 2-D, 3 edges in each unit square In 3-D, 7 edges in each unit cube
6 Architecture of 3-D Alignment Cell (i-1,j-1,k-1) (i-1,j,k-1) (i-1,j-1,k) (i-1,j,k) (i,j-1,k-1) (i,j,k-1) (i,j-1,k) (i,j,k)
7 s i,j,k = max Multiple Alignment: Dynamic Programming s i-1,j-1,k-1 + δ(v i, w j, u k ) s i-1,j-1,k + δ (v i, w j, _ ) s i-1,j,k-1 + δ (v i, _, u k ) s i,j-1,k-1 + δ (_, w j, u k ) s i-1,j,k + δ (v i, _, _) s i,j-1,k + δ (_, w j, _) s i,j,k-1 + δ (_, _, u k ) cube diagonal: no indels face diagonal: one indel edge diagonal: two indels δ(x, y, z) is an entry in the 3-D scoring matrix
8 Multiple Alignment: Running Time For 3 sequences of length n, the run time is 7n 3 ; O(n 3 ) For k sequences, build a k-dimensional Manhattan, with run time (2 k -1)(n k ); O(2 k n k ) Conclusion: dynamic programming approach for alignment between two sequences is easily extended to k sequences but it is impractical due to exponential running time
9 Practically speaking Multiple alignment is a hard problem Yet, it is of extreme practical importance Comparing several species is a very common task Doing this for the entire genome is an increasingly common demand! Several heuristic-based algorithms have been developed that employ greedy, divide-andconquer, dynamic programming approaches in various combinations The algorithms we will see today are actually used by current multiple aligners
10 Multiple Alignment Induces Pairwise Alignments Every multiple alignment induces pairwise alignments Induces: x: AC-GCGG-C y: AC-GC-GAG z: GCCGC-GAG x: ACGCGG-C; x: AC-GCGG-C; y: AC-GCGAG y: ACGC-GAC; z: GCCGC-GAG; z: GCCGCGAG
11 Reverse Problem: Constructing Multiple Alignment from Pairwise Alignments Given 3 arbitrary pairwise alignments: x: ACGCTGG-C; x: AC-GCTGG-C; y: AC-GC-GAG y: ACGC--GAC; z: GCCGCA-GAG; z: GCCGCAGAG can we construct a multiple alignment that induces them?
12 Reverse Problem: Constructing Multiple Alignment from Pairwise Alignments Given 3 arbitrary pairwise alignments: x: ACGCTGG-C; x: AC-GCTGG-C; y: AC-GC-GAG y: ACGC--GAC; z: GCCGCA-GAG; z: GCCGCAGAG can we construct a multiple alignment that induces them? NOT ALWAYS Pairwise alignments may be inconsistent
13 Multiple Alignment: Greedy Approach Choose most similar pair of strings and combine into a profile, thereby reducing alignment of k sequences to an alignment of of k-1 sequences/profiles. Repeat This is a heuristic greedy method k u 1 = ACGTACGTACGT u 2 = TTAATTAATTAA u 3 = ACTACTACTACT u k = CCGGCCGGCCGG u 1 = ACg/tTACg/tTACg/cT u 2 = TTAATTAATTAA u k = CCGGCCGGCCGG k-1
14 Progressive Alignment Progressive alignment is a variation of greedy algorithm with a somewhat more intelligent strategy for choosing the order of alignments.
15 Clustal Popular multiple alignment tool today Uses progressive alignment Three-step process 1.) Construct pairwise alignments 2.) Build Guide Tree 3.) Progressive Alignment guided by the tree
16 Step 1: Pairwise Alignment Aligns each sequence again each other giving a similarity matrix Similarity = exact matches / sequence length (percent identity) v 1 v 2 v 3 v 4 v 1 - v v v
17 Step 2: Guide Tree Create Guide Tree using the similarity matrix ClustalW uses the neighbor-joining method Guide tree roughly reflects evolutionary relations
18 Step 2: Guide Tree (cont d) v 1 v 2 v 3 v 4 v 1 - v v v v 1 v 3 v 4 v 2 Calculate: v 1,3 = alignment (v 1, v 3 ) v 1,3,4 = alignment((v 1,3 ),v 4 ) v 1,2,3,4 = alignment((v 1,3,4 ),v 2 )
19 Step 3: Progressive Alignment Start by aligning the two most similar sequences Following the guide tree, add in the next sequences, aligning to the existing alignment An alignment is stored as a consensus sequence, to be aligned with other sequences or alignments later Consensus sequence: Residue a if 75% of aligned sequences have an a at that position.otherwise X.
20 Evaluation Evaluating alignment programs is very difficult What is a benchmark here? We haven t witnessed the process of evolution, so we cannot say for certain what the true alignment of extant sequences should be One approach: simulate evolution
21 Simulating evolution Generate a random sequence and introduce realistic evolutionary changes to it, along branches of an assumed phylogeny Substitutions, insertions, deletions, insertion & deletion rates, duplications, introduction of repeat elements, etc.
22 Evaluating alignment Once simulation done, take all the sequences at the leaf nodes of the phylogeny (started with root) Align these sequences using software Compare computed alignment and known ( true ) alignment sensitivity and specificity
Multiple Sequence Alignment
Multiple Sequence Alignment Multiple Alignment versus Pairwise Alignment Up until now we have only tried to align two sequences.! What about more than two? And what for?! A faint similarity between two
More informationp(-,i)+p(,i)+p(-,v)+p(i,v),v)+p(i,v)
Multile Sequence Alignment Given: Set of sequences Score matrix Ga enalties Find: Alignment of sequences such that otimal score is achieved. Motivation Aligning rotein families Establish evolutionary relationshis
More informationMultiple Alignment. Slides revised and adapted to Bioinformática IST Ana Teresa Freitas
n Introduction to Bioinformatics lgorithms Multiple lignment Slides revised and adapted to Bioinformática IS 2005 na eresa Freitas n Introduction to Bioinformatics lgorithms Outline Dynamic Programming
More informationLecture 14: Multiple Sequence Alignment (Gene Finding, Conserved Elements) Scribe: John Ekins
Lecture 14: Multiple Sequence Alignment (Gene Finding, Conserved Elements) 2 19 2015 Scribe: John Ekins Multiple Sequence Alignment Given N sequences x 1, x 2,, x N : Insert gaps in each of the sequences
More informationPatterns, Profiles, and
Patterns, Profiles, and Mltiple l Alignments Otline Profiles, Position Specific Scoring Matrices Profile Hidden Markov Models Alignment of Profiles Mltiple Alignment Algorithms Problem definition Can we
More informationPatterns, Profiles, and
Patterns, Profiles, and Mltiple l Alignments Otline Profiles, Position Specific Scoring Matrices Profile Hidden Markov Models Alignment of Profiles Mltiple Alignment Algorithms Problem definition Can we
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationEvolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
More information17 Non-collinear alignment Motivation A B C A B C A B C A B C D A C. This exposition is based on:
17 Non-collinear alignment This exposition is based on: 1. Darling, A.E., Mau, B., Perna, N.T. (2010) progressivemauve: multiple genome alignment with gene gain, loss and rearrangement. PLoS One 5(6):e11147.
More informationEVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
More informationCopyright 2000 N. AYDIN. All rights reserved. 1
Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment
More informationMultiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:
Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:50 5001 5 Multiple Sequence Alignment The first part of this exposition is based on the following sources, which are recommended reading:
More informationPhylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
More informationMULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr
More informationInDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
More informationLecture 5,6 Local sequence alignment
Lecture 5,6 Local sequence alignment Chapter 6 in Jones and Pevzner Fall 2018 September 4,6, 2018 Evolution as a tool for biological insight Nothing in biology makes sense except in the light of evolution
More information5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT
5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:
More information08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega
BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments
More informationTree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
More informationLecture 8 Multiple Alignment and Phylogeny
Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 8 Multiple Alignment and Phylogeny Multiple Alignment & Phylogeny Multiple Alignment Scoring Complexity
More informationMultiple Alignment. Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis
Multiple Alignment Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis gorm@cbs.dtu.dk Refresher: pairwise alignments 43.2% identity; Global alignment score: 374 10 20
More informationPage 1. Evolutionary Trees. Why build evolutionary tree? Outline
Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny
More informationBMI/CS 776 Lecture #20 Alignment of whole genomes. Colin Dewey (with slides adapted from those by Mark Craven)
BMI/CS 776 Lecture #20 Alignment of whole genomes Colin Dewey (with slides adapted from those by Mark Craven) 2007.03.29 1 Multiple whole genome alignment Input set of whole genome sequences genomes diverged
More informationBasics on bioinforma-cs Lecture 7. Nunzio D Agostino
Basics on bioinforma-cs Lecture 7 Nunzio D Agostino nunzio.dagostino@entecra.it; nunzio.dagostino@gmail.com Multiple alignments One sequence plays coy a pair of homologous sequence whisper many aligned
More informationSara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)
Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More informationI519 Introduction to Bioinformatics, Genome Comparison. Yuzhen Ye School of Informatics & Computing, IUB
I519 Introduction to Bioinformatics, 2015 Genome Comparison Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Whole genome comparison/alignment Build better phylogenies Identify polymorphism
More informationEffects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationBioinformatics for Computer Scientists (Part 2 Sequence Alignment) Sepp Hochreiter
Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Institute of Bioinformatics Johannes Kepler University, Linz, Austria Sequence Alignment 2. Sequence Alignment Sequence Alignment 2.1
More informationTandem Mass Spectrometry: Generating function, alignment and assembly
Tandem Mass Spectrometry: Generating function, alignment and assembly With slides from Sangtae Kim and from Jones & Pevzner 2004 Determining reliability of identifications Can we use Target/Decoy to estimate
More informationMultiple Sequence Alignment: A Critical Comparison of Four Popular Programs
Multiple Sequence Alignment: A Critical Comparison of Four Popular Programs Shirley Sutton, Biochemistry 218 Final Project, March 14, 2008 Introduction For both the computational biologist and the research
More information3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT
3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode
More informationBioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
More informationPhylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
More informationI519 Introduction to Bioinformatics, Genome Comparison. Yuzhen Ye School of Informatics & Computing, IUB
I519 Introduction to Bioinformatics, 2011 Genome Comparison Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Whole genome comparison/alignment Build better phylogenies Identify polymorphism
More informationPhylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science
Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.
More informationQuantifying sequence similarity
Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity
More informationBiochemistry 324 Bioinformatics. Pairwise sequence alignment
Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene
More informationMultiple sequence alignment
Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics Lecture : p he biological problem p lobal alignment p Local alignment p Multiple alignment 6 Background: comparative genomics p Basic question in biology: what properties
More informationConstructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
More informationAdditive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive.
Additive distances Let T be a tree on leaf set S and let w : E R + be an edge-weighting of T, and assume T has no nodes of degree two. Let D ij = e P ij w(e), where P ij is the path in T from i to j. Then
More informationPhylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches
Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell
More informationSequence analysis and Genomics
Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute
More informationPairwise & Multiple sequence alignments
Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived
More informationNetwork alignment and querying
Network biology minicourse (part 4) Algorithmic challenges in genomics Network alignment and querying Roded Sharan School of Computer Science, Tel Aviv University Multiple Species PPI Data Rapid growth
More informationMultiple Whole Genome Alignment
Multiple Whole Genome Alignment BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 206 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by
More informationPhylogeny: traditional and Bayesian approaches
Phylogeny: traditional and Bayesian approaches 5-Feb-2014 DEKM book Notes from Dr. B. John Holder and Lewis, Nature Reviews Genetics 4, 275-284, 2003 1 Phylogeny A graph depicting the ancestor-descendent
More informationDid you know that Multiple Alignment is NP-hard? Isaac Elias Royal Institute of Technology Sweden
Did you know that Multiple Alignment is NP-hard? Isaac Elias Royal Institute of Technology Sweden 1 Results Multiple Alignment with SP-score Star Alignment Tree Alignment (with given phylogeny) are NP-hard
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 03: Edit distance and sequence alignment Slides adapted from Dr. Shaojie Zhang (University of Central Florida) KUMC visit How many of you would like to attend
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationOverview Multiple Sequence Alignment
Overview Multiple Sequence Alignment Inge Jonassen Bioinformatics group Dept. of Informatics, UoB Inge.Jonassen@ii.uib.no Definition/examples Use of alignments The alignment problem scoring alignments
More informationMultiple Sequence Alignment
Multiple Sequence Alignment BMI/CS 576 www.biostat.wisc.edu/bmi576.html Colin Dewey cdewey@biostat.wisc.edu Multiple Sequence Alignment: Tas Definition Given a set of more than 2 sequences a method for
More informationComputational Biology
Computational Biology Lecture 6 31 October 2004 1 Overview Scoring matrices (Thanks to Shannon McWeeney) BLAST algorithm Start sequence alignment 2 1 What is a homologous sequence? A homologous sequence,
More informationIntroduction to Bioinformatics Introduction to Bioinformatics
Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11510 Supplementary Table 1. Indel Index Removal Gene Number of Starting Sequences Number of Final Sequences Percentage of Sequences Removed based on the Indel
More informationMoreover, the circular logic
Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationCSCI1950 Z Computa4onal Methods for Biology Lecture 5
CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC
More information5 Integer Linear Programming (ILP) E. Amaldi Foundations of Operations Research Politecnico di Milano 1
5 Integer Linear Programming (ILP) E. Amaldi Foundations of Operations Research Politecnico di Milano 1 Definition: An Integer Linear Programming problem is an optimization problem of the form (ILP) min
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More informationLecture 9: Search 8. Victor R. Lesser. CMPSCI 683 Fall 2010
Lecture 9: Search 8 Victor R. Lesser CMPSCI 683 Fall 2010 ANNOUNCEMENTS REMEMBER LECTURE ON TUESDAY! EXAM ON OCTOBER 18 OPEN BOOK ALL MATERIAL COVERED IN LECTURES REQUIRED READINGS WILL MOST PROBABLY NOT
More informationRNA Search and! Motif Discovery" Genome 541! Intro to Computational! Molecular Biology"
RNA Search and! Motif Discovery" Genome 541! Intro to Computational! Molecular Biology" Day 1" Many biologically interesting roles for RNA" RNA secondary structure prediction" 3 4 Approaches to Structure
More informationEvaluation Measures of Multiple Sequence Alignments. Gaston H. Gonnet, *Chantal Korostensky and Steve Benner. Institute for Scientic Computing
Evaluation Measures of Multiple Sequence Alignments Gaston H. Gonnet, *Chantal Korostensky and Steve Benner Institute for Scientic Computing ETH Zurich, 8092 Zuerich, Switzerland phone: ++41 1 632 74 79
More informationMath 239: Discrete Mathematics for the Life Sciences Spring Lecture 14 March 11. Scribe/ Editor: Maria Angelica Cueto/ C.E.
Math 239: Discrete Mathematics for the Life Sciences Spring 2008 Lecture 14 March 11 Lecturer: Lior Pachter Scribe/ Editor: Maria Angelica Cueto/ C.E. Csar 14.1 Introduction The goal of today s lecture
More informationSequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University
Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of
More informationGraph Alignment and Biological Networks
Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale
More informationSequence Alignment (chapter 6)
Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6 Background: comparative genomics Basic question in biology:
More informationA Comparative Analysis of Popular Phylogenetic. Reconstruction Algorithms
A Comparative Analysis of Popular Phylogenetic Reconstruction Algorithms Evan Albright, Jack Hessel, Nao Hiranuma, Cody Wang, and Sherri Goings Department of Computer Science Carleton College MN, 55057
More informationRECOVERING NORMAL NETWORKS FROM SHORTEST INTER-TAXA DISTANCE INFORMATION
RECOVERING NORMAL NETWORKS FROM SHORTEST INTER-TAXA DISTANCE INFORMATION MAGNUS BORDEWICH, KATHARINA T. HUBER, VINCENT MOULTON, AND CHARLES SEMPLE Abstract. Phylogenetic networks are a type of leaf-labelled,
More informationMarkov Model. Model representing the different resident states of a system, and the transitions between the different states
Markov Model Model representing the different resident states of a system, and the transitions between the different states (applicable to repairable, as well as non-repairable systems) System behavior
More informationConsistency Index (CI)
Consistency Index (CI) minimum number of changes divided by the number required on the tree. CI=1 if there is no homoplasy negatively correlated with the number of species sampled Retention Index (RI)
More informationConstructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationA (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
More information"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
More informationSequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir
Sequence Bioinformatics Multiple Sequence Alignment Waqas Nasir 2010-11-12 Multiple Sequence Alignment One amino acid plays coy; a pair of homologous sequences whisper; many aligned sequences shout out
More informationPhylogeny Tree Algorithms
Phylogeny Tree lgorithms Jianlin heng, PhD School of Electrical Engineering and omputer Science University of entral Florida 2006 Free for academic use. opyright @ Jianlin heng & original sources for some
More informationPerformance comparison between k-tuple distance and four model-based distances in phylogenetic tree reconstruction
Published online 22 February 2008 Nucleic Acids Research, 2008, Vol. 36, No. 5 e33 doi:10.1093/nar/gkn075 Performance comparison between k-tuple distance and four model-based distances in phylogenetic
More informationPhylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction
More informationWhat is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
More informationToday s Lecture: HMMs
Today s Lecture: HMMs Definitions Examples Probability calculations WDAG Dynamic programming algorithms: Forward Viterbi Parameter estimation Viterbi training 1 Hidden Markov Models Probability models
More informationTrees. A tree is a graph which is. (a) Connected and. (b) has no cycles (acyclic).
Trees A tree is a graph which is (a) Connected and (b) has no cycles (acyclic). 1 Lemma 1 Let the components of G be C 1, C 2,..., C r, Suppose e = (u, v) / E, u C i, v C j. (a) i = j ω(g + e) = ω(g).
More informationExamining Phylogenetic Reconstruction Algorithms
Examining Phylogenetic Reconstruction Algorithms Evan Albright ichbinevan@gmail.com Jack Hessel jmhessel@gmail.com Cody Wang mcdy143@gmail.com Nao Hiranuma hiranumn@gmail.com Abstract Understanding the
More informationEvolutionary Models. Evolutionary Models
Edit Operators In standard pairwise alignment, what are the allowed edit operators that transform one sequence into the other? Describe how each of these edit operations are represented on a sequence alignment
More informationCSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary
CSCI1950 Z Computa4onal Methods for Biology Lecture 4 Ben Raphael February 2, 2009 hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary Parsimony Probabilis4c Method Input Output Sankoff s & Fitch
More informationSimilarity or Identity? When are molecules similar?
Similarity or Identity? When are molecules similar? Mapping Identity A -> A T -> T G -> G C -> C or Leu -> Leu Pro -> Pro Arg -> Arg Phe -> Phe etc If we map similarity using identity, how similar are
More informationNJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
More informationCombinatorial optimization problems
Combinatorial optimization problems Heuristic Algorithms Giovanni Righini University of Milan Department of Computer Science (Crema) Optimization In general an optimization problem can be formulated as:
More informationSequence Analysis '17- lecture 8. Multiple sequence alignment
Sequence Analysis '17- lecture 8 Multiple sequence alignment Ex5 explanation How many random database search scores have e-values 10? (Answer: 10!) Why? e-value of x = m*p(s x), where m is the database
More informationSequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
More informationBackground: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6)
Sequence lignment (chapter ) he biological problem lobal alignment Local alignment Multiple alignment Background: comparative genomics Basic question in biology: what properties are shared among organisms?
More informationComparing whole genomes
BioNumerics Tutorial: Comparing whole genomes 1 Aim The Chromosome Comparison window in BioNumerics has been designed for large-scale comparison of sequences of unlimited length. In this tutorial you will
More informationA Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationSupporting Information
Supporting Information Das et al. 10.1073/pnas.1302500110 < SP >< LRRNT > < LRR1 > < LRRV1 > < LRRV2 Pm-VLRC M G F V V A L L V L G A W C G S C S A Q - R Q R A C V E A G K S D V C I C S S A T D S S P E
More informationCISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)
CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST
More informationLecture Notes: Markov chains
Computational Genomics and Molecular Biology, Fall 5 Lecture Notes: Markov chains Dannie Durand At the beginning of the semester, we introduced two simple scoring functions for pairwise alignments: a similarity
More information