Voltage-dependent gating of ion channels Prof. Keith S. Elmslie
|
|
- Chester Richard
- 5 years ago
- Views:
Transcription
1 Voltage-Dependent Gating of Ion Channels Department of Pharmacology A.T. Still University Kirksville College of Osteopathic Medicine 1 The action potential (AP) E Na Threshold The N eur onal AP Sensory functions Motor functions Learning and memory Car diac muscle AP Powering blood flow Skeletal muscle AP Motor output of the CNS 5 ms E K Resting membrane potential 2 Voltage-dependent channels and the AP The action potential Na + & K + conductances Hodgk in and Huxley (1952) J Physiol 117: 500 3
2 Channel gating during the AP Depolariz ation Repolariz ation Threshold Afterhyperpolariz ation 4 Voltage-dependent ion channels Potassium channels (K V ) 40 genes Function: repolarize the action potential Sodium channels (Na V ) 9 genes Function: gener ate the action potential Calcium channels (Ca V ) 10 genes Function: tr anslate electrical signals into cellular action e.g. in the CNS, AP invading the nerve terminals activates Ca V to allow influx of Ca 2+, triggering neurotransmitter release e.g. in cardiac muscles, Ca 2+ influx through Ca V channels triggers Ca 2+ release from intracellular stores, resulting in muscle contraction Yu et al., (2005) Pharmac ol Rev 57: Different channels alter AP Neuronal act ion pot ential Na V K V Na V & K V channels Different channels alter AP Cardiac action pot ential Na V Ca V K V Na V, C a V and multi ple K V channels 6
3 Voltage-dependent ionic current Yarotskyy and Elms lie (2010) Unpublis hed 7 Charge movement triggers gating Hyperpolarized Depolarized Closed Open Voltage sensor Armstrong and Bez anilla (1974) J Gen Physiol 63: Measuring voltage sensor movement Gating current Yarotskyy and Elms lie (2010) Unpublis hed 9
4 Voltage-dependent gating current Yarotskyy and Elms lie (2010) Unpublis hed 10 Gating vs. ionic current What i s the source for g ati ng current & voltag e-dependent channel g ati ng? Yarotskyy and Elms lie (2010) Unpublis hed 11 Protein sequence reveals voltage sensor Human K V 1.2 potassium channel 1 MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG 61 DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE 121 EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF 181 CLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR 241 FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR 301 VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPS 361 IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 421 TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA 481 NCTLANTNYVNITKMLTDV Six transmembrane segments (S1- S6) Positiv ely charged amino acids = Arginine (R) and Lysine (K) NCBI Referenc e Sequenc e: NP_
5 Segregated functions within the protein A single potassium channel α subunit Pongs (1992) Physiol Rev 72: S69 13 K V channels comprised of 4 α subunits Subunit 3 V region Subunit 2 V region Subunit 3 P region Subunit 4 P region Subunit 2 P region Subunit 1 P region Subunit 4 V region Subunit 1 V region Long et al., (2005) Scienc e 309: Na V channels have four domains Each domain is equivalent to one K V channel subunit Catterall et al., (2005) Pharmac ol Rev 57:
6 Ca V channels also have four domains Auxiliary subunits modify CaV channel function Catterall et al., (2005) Pharmac ol Rev 57: S4 homology Human Shaker-related potassium channel K V 1.2 S4 ILRVIRLVRVFRIFKLSRHSK NCBI Reference Sequence: NP_ Human skeletal muscle sodium channel Na V 1.4 S4 DI ALRYFRVLRALKTITVIPGLKT Na V 1.4 S4 DII VLRSFRLLRVFKLAKSWPTLNM Na V 1.4 S4 DIII ELGPIKSLRTLRALRPLRALSR Na V 1.4 S4 DIV LFRVIRLARIGRVLRLIRGAKGIR NCBI Reference Sequence: NP_ Human cardiac muscle calcium channel Ca V 1.2 S4 DI DVKALRAFRVLRPLRLVSGVPS Ca V 1.2 S4 DII GISVLRCVRLLRIFKITRYWSS Ca V 1.2 S4 DIII VVKILRVLRVLRPLRAINRAKG Ca V 1.2 S4 DIV SITFFRLFRVMRLVKLLSRGEG NCBI Reference Sequence: NP_ Evidence for S4 movement S4 DIV LFRVIRLARIGRVLRLIRGAKGIR C C C C C C C C = M ethanethiosulfonate (MTS) - ethyltrimethylammonium (ET) 18
7 Cysteine modification method S4 DIV LFRVIRLARIGRVLRLIRGAKGIR C Yang and Horn (1995) Neuron 15: Cysteine modification method (2) Membrane hyperpolarized Membrane depolarized MTSE T in the external solution Yang and Horn (1995) Neuron 15: S4 moves S4 DIV LFRVIRLARIGRVLRLIRGAKGIR C Hyperpolarized Depolarized Exter nal No effect Effect Inter nal No effect No effect Cysteine buried Cysteine exposed to the external solution Hyperpolarized Depolarized Yang and Horn (1995) Neuron 15:
8 The extent of S4 movement Depolarization S4 DIV LFRVIRLARIGRVLRLIRGAKGIR C C C C C C C C Outside Inside Hyperpolarization S4 DIV LFRVIRLARIGRVLRLIRGAKGIR C C C C C C C C Buried Inside 3 charges/domain * 4 domains = 12 charg es/channel, which matches gating current results (In this slide: Na V 1.4) Yang et al., (1996) Neuron 16: Similar conclusions for K V channels Depolarization S4 ILRVIRLVRVFRIFKLSRHS K Outside Not out Hyperpolarization S4 ILRVIRLVRVFRIFKLSRHS K Buried Inside Bezanilla (2000) Phy siol Rev 80: S4 is exposed to the cytoplasm Domain 3 Domain 2 Domain 4 Domain 1 has been removed Based on Yang et al., (1996) Neur on 16:
9 S4 moves through a gating pore Depolarized Based on Yang et al., (1996) Neur on 16: Pathogenic mutations & the gating pore G + G TTX DII + DIV Sokolov et al., (2007) Nature 446: Different functions within one domain Gate Gat ing pore Volt age sen sor Ionic pore The wor k of Hor n and others showed that S1-3 and S5 for m the structur e that all ows S4 to move acr oss the membrane el ectric fi el d 27
10 The activation/deactivation gate Catterall (2010) Neuron 67: Different models of S4 movement Cell Cell membrane Tombola et al., (2006) Annu Rev Cell Dev Biol 22: Summary Na V, Ca V and K V channels generate the cellular electrical signaling critical for functions as diverse as cardiac contraction & memor y A transmembrane segment called S4 contains positi vely charged amino acids that moves in response to changes in membrane potential Gating current is used to assess the movement of the voltage sensors S4 appears to move within a gating pore that is created by the other transmembrane segments (S1-3 & S5); As a result, mutations can cause an ionic current to flow through the gating pore that can lead to diseases such as Hypokalemic Periodic Paralysis The movement of the voltage sensor appears to alter the position of the S6 segment, which forms the gate, to open and close the ionic channels The exact way that S4 moves to trigger gating is currently an open question that is a ver y important area of research 30
11 31
Nervous System Organization
The Nervous System Chapter 44 Nervous System Organization All animals must be able to respond to environmental stimuli -Sensory receptors = Detect stimulus -Motor effectors = Respond to it -The nervous
More informationNervous System Organization
The Nervous System Nervous System Organization Receptors respond to stimuli Sensory receptors detect the stimulus Motor effectors respond to stimulus Nervous system divisions Central nervous system Command
More informationACTION POTENTIAL. Dr. Ayisha Qureshi Professor MBBS, MPhil
ACTION POTENTIAL Dr. Ayisha Qureshi Professor MBBS, MPhil DEFINITIONS: Stimulus: A stimulus is an external force or event which when applied to an excitable tissue produces a characteristic response. Subthreshold
More informationIon Channel Structure and Function (part 1)
Ion Channel Structure and Function (part 1) The most important properties of an ion channel Intrinsic properties of the channel (Selectivity and Mode of Gating) + Location Physiological Function Types
More informationChapter 37 Active Reading Guide Neurons, Synapses, and Signaling
Name: AP Biology Mr. Croft Section 1 1. What is a neuron? Chapter 37 Active Reading Guide Neurons, Synapses, and Signaling 2. Neurons can be placed into three groups, based on their location and function.
More informationNervous Systems: Neuron Structure and Function
Nervous Systems: Neuron Structure and Function Integration An animal needs to function like a coherent organism, not like a loose collection of cells. Integration = refers to processes such as summation
More informationMuscle tissue. Types. Functions. Cardiac, Smooth, and Skeletal
Types Cardiac, Smooth, and Skeletal Functions movements posture and body position Support soft tissues Guard openings body temperature nutrient reserves Muscle tissue Special Characteristics of Muscle
More informationNervous Tissue. Neurons Neural communication Nervous Systems
Nervous Tissue Neurons Neural communication Nervous Systems What is the function of nervous tissue? Maintain homeostasis & respond to stimuli Sense & transmit information rapidly, to specific cells and
More informationAction Potentials & Nervous System. Bio 219 Napa Valley College Dr. Adam Ross
Action Potentials & Nervous System Bio 219 Napa Valley College Dr. Adam Ross Review: Membrane potentials exist due to unequal distribution of charge across the membrane Concentration gradients drive ion
More informationNervous Tissue. Neurons Electrochemical Gradient Propagation & Transduction Neurotransmitters Temporal & Spatial Summation
Nervous Tissue Neurons Electrochemical Gradient Propagation & Transduction Neurotransmitters Temporal & Spatial Summation What is the function of nervous tissue? Maintain homeostasis & respond to stimuli
More informationLecture 04, 04 Sept 2003 Chapters 4 and 5. Vertebrate Physiology ECOL 437 University of Arizona Fall instr: Kevin Bonine t.a.
Lecture 04, 04 Sept 2003 Chapters 4 and 5 Vertebrate Physiology ECOL 437 University of Arizona Fall 2003 instr: Kevin Bonine t.a.: Bret Pasch Vertebrate Physiology 437 1. Membranes (CH4) 2. Nervous System
More informationPHYSIOLOGY CHAPTER 9 MUSCLE TISSUE Fall 2016
PHYSIOLOGY CHAPTER 9 MUSCLE TISSUE Fall 2016 2 Chapter 9 Muscles and Muscle Tissue Overview of Muscle Tissue types of muscle: are all prefixes for muscle Contractility all muscles cells can Smooth & skeletal
More informationPhysiology Unit 2. MEMBRANE POTENTIALS and SYNAPSES
Physiology Unit 2 MEMBRANE POTENTIALS and SYNAPSES Neuron Communication Neurons are stimulated by receptors on dendrites and cell bodies (soma) Ligand gated ion channels GPCR s Neurons stimulate cells
More informationVoltage-clamp and Hodgkin-Huxley models
Voltage-clamp and Hodgkin-Huxley models Read: Hille, Chapters 2-5 (best Koch, Chapters 6, 8, 9 See also Hodgkin and Huxley, J. Physiol. 117:500-544 (1952. (the source Clay, J. Neurophysiol. 80:903-913
More informationNeurons and Nervous Systems
34 Neurons and Nervous Systems Concept 34.1 Nervous Systems Consist of Neurons and Glia Nervous systems have two categories of cells: Neurons, or nerve cells, are excitable they generate and transmit electrical
More informationFundamentals of the Nervous System and Nervous Tissue
Chapter 11 Part B Fundamentals of the Nervous System and Nervous Tissue Annie Leibovitz/Contact Press Images PowerPoint Lecture Slides prepared by Karen Dunbar Kareiva Ivy Tech Community College 11.4 Membrane
More informationMEMBRANE STRUCTURE. Lecture 9. Biology Department Concordia University. Dr. S. Azam BIOL 266/
MEMBRANE STRUCTURE Lecture 9 BIOL 266/4 2014-15 Dr. S. Azam Biology Department Concordia University RED BLOOD CELL MEMBRANE PROTEINS The Dynamic Nature of the Plasma Membrane SEM of human erythrocytes
More informationPeripheral Nerve II. Amelyn Ramos Rafael, MD. Anatomical considerations
Peripheral Nerve II Amelyn Ramos Rafael, MD Anatomical considerations 1 Physiologic properties of the nerve Irritability of the nerve A stimulus applied on the nerve causes the production of a nerve impulse,
More informationNerve Signal Conduction. Resting Potential Action Potential Conduction of Action Potentials
Nerve Signal Conduction Resting Potential Action Potential Conduction of Action Potentials Resting Potential Resting neurons are always prepared to send a nerve signal. Neuron possesses potential energy
More informationMembrane Protein Channels
Membrane Protein Channels Potassium ions queuing up in the potassium channel Pumps: 1000 s -1 Channels: 1000000 s -1 Pumps & Channels The lipid bilayer of biological membranes is intrinsically impermeable
More informationNOTES: CH 48 Neurons, Synapses, and Signaling
NOTES: CH 48 Neurons, Synapses, and Signaling A nervous system has three overlapping functions: 1) SENSORY INPUT: signals from sensory receptors to integration centers 2) INTEGRATION: information from
More informationDendrites - receives information from other neuron cells - input receivers.
The Nerve Tissue Neuron - the nerve cell Dendrites - receives information from other neuron cells - input receivers. Cell body - includes usual parts of the organelles of a cell (nucleus, mitochondria)
More informationلجنة الطب البشري رؤية تنير دروب تميزكم
1) Hyperpolarization phase of the action potential: a. is due to the opening of voltage-gated Cl channels. b. is due to prolonged opening of voltage-gated K + channels. c. is due to closure of the Na +
More informationLecture 2. Excitability and ionic transport
Lecture 2 Excitability and ionic transport Selective membrane permeability: The lipid barrier of the cell membrane and cell membrane transport proteins Chemical compositions of extracellular and intracellular
More informationNeurophysiology. Danil Hammoudi.MD
Neurophysiology Danil Hammoudi.MD ACTION POTENTIAL An action potential is a wave of electrical discharge that travels along the membrane of a cell. Action potentials are an essential feature of animal
More informationAction potentials. Conductances channels
Action potentials Conductances channels Cole and Curtis AC Wheatstone bridge resistance decreased during action potential R1 & R2 divide one path, Rv (variable) and Ru divide the other Galvanometer between
More informationChapter 2: Neurons and Glia
Chapter 2: Neurons and Glia The Prototypical Neuron The Soma Cytosol: watery fluid inside the cell Organelles: membrane-enclosed structures within the soma Cytoplasm: contents within a cell membrane, e.g.,
More informationtre of Mark Louie D. Lop
NERVE PHYSIOLOGY Mark Louie D. Lopez College of Science Polytechnic University of the Philippines FUNCTIONS OF NERVOUS SYSTEM Sensory input or detection Integration processing transmission of information
More informationMembrane Potentials, Action Potentials, and Synaptic Transmission. Membrane Potential
Cl Cl - - + K + K+ K + K Cl - 2/2/15 Membrane Potentials, Action Potentials, and Synaptic Transmission Core Curriculum II Spring 2015 Membrane Potential Example 1: K +, Cl - equally permeant no charge
More informationLecture goals: Learning Objectives
Title: Membrane Potential in Excitable Cells 1 Subtitle: Voltage-Gated Ion Channels and the basis of the Action Potential Diomedes E. Logothetis, Ph.D. Lecture goals: This first of two lectures will use
More informationGeneral Physics. Nerve Conduction. Newton s laws of Motion Work, Energy and Power. Fluids. Direct Current (DC)
Newton s laws of Motion Work, Energy and Power Fluids Direct Current (DC) Nerve Conduction Wave properties of light Ionizing Radiation General Physics Prepared by: Sujood Alazzam 2017/2018 CHAPTER OUTLINE
More informationChannels can be activated by ligand-binding (chemical), voltage change, or mechanical changes such as stretch.
1. Describe the basic structure of an ion channel. Name 3 ways a channel can be "activated," and describe what occurs upon activation. What are some ways a channel can decide what is allowed to pass through?
More informationCh 8: Neurons: Cellular and Network Properties, Part 1
Developed by John Gallagher, MS, DVM Ch 8: Neurons: Cellular and Network Properties, Part 1 Objectives: Describe the Cells of the NS Explain the creation and propagation of an electrical signal in a nerve
More informationVoltage-clamp and Hodgkin-Huxley models
Voltage-clamp and Hodgkin-Huxley models Read: Hille, Chapters 2-5 (best) Koch, Chapters 6, 8, 9 See also Clay, J. Neurophysiol. 80:903-913 (1998) (for a recent version of the HH squid axon model) Rothman
More informationLESSON 2.2 WORKBOOK How do our axons transmit electrical signals?
LESSON 2.2 WORKBOOK How do our axons transmit electrical signals? This lesson introduces you to the action potential, which is the process by which axons signal electrically. In this lesson you will learn
More information9.01 Introduction to Neuroscience Fall 2007
MIT OpenCourseWare http://ocw.mit.edu 9.01 Introduction to Neuroscience Fall 2007 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. 9.01 Recitation (R02)
More informationResting Membrane Potential
Resting Membrane Potential Fig. 12.09a,b Recording of Resting and It is recorded by cathode ray oscilloscope action potentials -70 0 mv + it is negative in polarized (resting, the membrane can be excited)
More informationPurpose: Perception, Movement, Learning, Memory, Thinking, Communication Functions:
Nervous System Purpose: Perception, Movement, Learning, Memory, Thinking, Communication Functions: Sensory Input: Obtaining stimulation from the environment (light, heat, pressure, vibration, chemical,
More informationUNIT 6 THE MUSCULAR SYSTEM
UNIT 6 THE MUSCULAR SYSTEM I. Functions of Muscular System A. Produces Movement Internal vs. External «locomotion & manipulation «circulate blood & maintain blood pressure «move fluids, food, baby B. Maintaining
More informationUNIT I INTRODUCTION TO ARTIFICIAL NEURAL NETWORK IT 0469 NEURAL NETWORKS
UNIT I INTRODUCTION TO ARTIFICIAL NEURAL NETWORK IT 0469 NEURAL NETWORKS Elementary Neuro Physiology Neuron: A neuron nerve cell is an electricallyexcitable cell that processes and transmits information
More informationControl and Integration. Nervous System Organization: Bilateral Symmetric Animals. Nervous System Organization: Radial Symmetric Animals
Control and Integration Neurophysiology Chapters 10-12 Nervous system composed of nervous tissue cells designed to conduct electrical impulses rapid communication to specific cells or groups of cells Endocrine
More informationThe Nervous System. Nervous System Organization. Nerve Tissue. Two parts to the nervous system 11/27/2016
The Nervous System Nervous System Organization Animals must be able to respond to environmental stimuli. Three functions of the nervous system: Sensory input conduction of signals from sensory receptors.
More informationUniversality of sensory-response systems
excite.org(anism): Electrical Signaling Universality of sensory-response systems Three step process: sensation-integration-response Bacterial chemotaxis Madigan et al. Fig. 8.24 Rick Stewart (CBMG) Human
More informationCELL BIOLOGY - CLUTCH CH. 9 - TRANSPORT ACROSS MEMBRANES.
!! www.clutchprep.com K + K + K + K + CELL BIOLOGY - CLUTCH CONCEPT: PRINCIPLES OF TRANSMEMBRANE TRANSPORT Membranes and Gradients Cells must be able to communicate across their membrane barriers to materials
More informationSimulation of Cardiac Action Potentials Background Information
Simulation of Cardiac Action Potentials Background Information Rob MacLeod and Quan Ni February 7, 2 Introduction The goal of assignments related to this document is to experiment with a numerical simulation
More informationThe Nervous System and the Sodium-Potassium Pump
The Nervous System and the Sodium-Potassium Pump 1. Define the following terms: Ion: A Student Activity on Membrane Potentials Cation: Anion: Concentration gradient: Simple diffusion: Sodium-Potassium
More informationNaseem Demeri. Mohammad Alfarra. Mohammad Khatatbeh
7 Naseem Demeri Mohammad Alfarra Mohammad Khatatbeh In the previous lectures, we have talked about how the difference in permeability for ions across the cell membrane can generate a potential. The potential
More informationInformation processing. Divisions of nervous system. Neuron structure and function Synapse. Neurons, synapses, and signaling 11/3/2017
Neurons, synapses, and signaling Chapter 48 Information processing Divisions of nervous system Central nervous system (CNS) Brain and a nerve cord Integration center Peripheral nervous system (PNS) Nerves
More informationParticles with opposite charges (positives and negatives) attract each other, while particles with the same charge repel each other.
III. NEUROPHYSIOLOGY A) REVIEW - 3 basic ideas that the student must remember from chemistry and physics: (i) CONCENTRATION measure of relative amounts of solutes in a solution. * Measured in units called
More informationPhysiology Unit 2. MEMBRANE POTENTIALS and SYNAPSES
Physiology Unit 2 MEMBRANE POTENTIALS and SYNAPSES In Physiology Today Ohm s Law I = V/R Ohm s law: the current through a conductor between two points is directly proportional to the voltage across the
More informationQUESTION? Communication between neurons depends on the cell membrane. Why is this so?? Consider the structure of the membrane.
QUESTION? Communication between neurons depends on the cell membrane Why is this so?? Consider the structure of the membrane. ECF ICF Possible ANSWERS?? Membrane Ion Channels and Receptors: neuron membranes
More informationAdvanced Higher Biology. Unit 1- Cells and Proteins 2c) Membrane Proteins
Advanced Higher Biology Unit 1- Cells and Proteins 2c) Membrane Proteins Membrane Structure Phospholipid bilayer Transmembrane protein Integral protein Movement of Molecules Across Membranes Phospholipid
More informationSide View with Rings of Charge
1 Ion Channel Biophysics Describe the main biophysical characteristics of at least one type of ionic channel. How does its biophysical properties contribute to its physiological function. What is thought
More informationPerspective Coupled Movements in Voltage-gated Ion Channels
Perspective Coupled Movements in Voltage-gated Ion Channels Richard Horn Department of Physiology, Jefferson Medical College, Philadelphia, PA 19107 Ion channels, like most other proteins, are designed
More informationOur patient for the day...
Muscles Ch.12 Our patient for the day... Name: Eddy Age: Newborn Whole-body muscle contractions No relaxation Severe difficulty breathing due to inadequate relaxation of breathing muscles Diagnosed with
More informationOverview of ion channel proteins. What do ion channels do? Three important points:
Overview of ion channel proteins Protein Structure Membrane proteins & channels Specific channels Several hundred distinct types Organization Evolution We need to consider 1. Structure 2. Functions 3.
More informationNeurons, Synapses, and Signaling
Chapter 48 Neurons, Synapses, and Signaling PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions
More informationSTEIN IN-TERM EXAM -- BIOLOGY FEBRUARY 12, PAGE 1 of 7
STEIN IN-TERM EXAM -- BIOLOGY 3058 -- FEBRUARY 12, 2009 -- PAGE 1 of 7 There are 25 questions in this Biology 3058 exam. All questions are "A, B, C, D, E, F, G, H" questions worth one point each. There
More informationNervous System: Part II How A Neuron Works
Nervous System: Part II How A Neuron Works Essential Knowledge Statement 3.E.2 Continued Animals have nervous systems that detect external and internal signals, transmit and integrate information, and
More informationNervous System AP Biology
Nervous System 2007-2008 Why do animals need a nervous system? What characteristics do animals need in a nervous system? fast accurate reset quickly Remember Poor think bunny! about the bunny signal direction
More informationTransport of glucose across epithelial cells: a. Gluc/Na cotransport; b. Gluc transporter Alberts
Figure 7 a. Secondary transporters make up the largest subfamily of transport proteins. TAGI 2000. Nature 408, 796 1. Na+- or H+-coupled cotransporters - Secondary active transport 2/7-02 Energy released
More informationMEMBRANE POTENTIALS AND ACTION POTENTIALS:
University of Jordan Faculty of Medicine Department of Physiology & Biochemistry Medical students, 2017/2018 +++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ Review: Membrane physiology
More informationNeural Conduction. biologyaspoetry.com
Neural Conduction biologyaspoetry.com Resting Membrane Potential -70mV A cell s membrane potential is the difference in the electrical potential ( charge) between the inside and outside of the cell. The
More informationthe axons of the nerve meet with the muscle cell.
Steps to Contraction 1. A nerve impulse travels to the neuromuscular junction on a muscle cell. The neuromuscular junction is the point where the axons of the nerve meet with the muscle cell. 2. Ach is
More informationDr. Ketki Assistant Professor Department of Biochemistry Heritage IMS, Varanasi
TRANSPORT MECHANISMS Dr. Ketki Assistant Professor Department of Biochemistry Heritage IMS, Varanasi Membrane selectivity allows adjustments of cell composition and function If plasma membrane is relatively
More informationOverview Organization: Central Nervous System (CNS) Peripheral Nervous System (PNS) innervate Divisions: a. Afferent
Overview Organization: Central Nervous System (CNS) Brain and spinal cord receives and processes information. Peripheral Nervous System (PNS) Nerve cells that link CNS with organs throughout the body.
More informationNeuron Func?on. Principles of Electricity. Defini?ons 2/6/15
Neuron Func?on 11 Fundamentals of the Nervous System and Nervous Tissue: Part B Neurons are highly Respond to adequate s?mulus by genera?ng an ac?on poten?al (nerve impulse) Impulse is always the regardless
More informationBIOL Week 5. Nervous System II. The Membrane Potential. Question : Is the Equilibrium Potential a set number or can it change?
Collin County Community College BIOL 2401 Week 5 Nervous System II 1 The Membrane Potential Question : Is the Equilibrium Potential a set number or can it change? Let s look at the Nernst Equation again.
More informationNeurons: Cellular and Network Properties HUMAN PHYSIOLOGY POWERPOINT
POWERPOINT LECTURE SLIDE PRESENTATION by LYNN CIALDELLA, MA, MBA, The University of Texas at Austin Additional text by J Padilla exclusively for physiology at ECC UNIT 2 8 Neurons: PART A Cellular and
More informationNeurochemistry 1. Nervous system is made of neurons & glia, as well as other cells. Santiago Ramon y Cajal Nobel Prize 1906
Neurochemistry 1 Nervous system is made of neurons & glia, as well as other cells. Santiago Ramon y Cajal Nobel Prize 1906 How Many Neurons Do We Have? The human brain contains ~86 billion neurons and
More informationLecture 13, 05 October 2004 Chapter 10, Muscle. Vertebrate Physiology ECOL 437 University of Arizona Fall instr: Kevin Bonine t.a.
Lecture 13, 05 October 2004 Chapter 10, Muscle Vertebrate Physiology ECOL 437 University of Arizona Fall 2004 instr: Kevin Bonine t.a.: Nate Swenson Vertebrate Physiology 437 18 1. Muscle A. Sarcomere
More informationNeurophysiology. Review from 12b. Topics in neurophysiology 7/08/12. Lecture 11b BIOL241
Neurophysiology Lecture 11b BIOL241 Review from 12b. CNS brain and spinal cord PNS nerves SNS (somatic) ANS (autonomic) Sympathetic NS Parasympathetic NS Afferent vs efferent (SAME) Cells of the nervous
More informationMembrane Potentials. Why are some cells electrically active? Model 1: The Sodium/Potassium pump. Critical Thinking Questions
Membrane Potentials Model 1: The Sodium/Potassium pump Why are some cells electrically active? 1. What ion is being moved out of the cell according to model 1? a. How many of these are being moved out?
More information1. Neurons & Action Potentials
Lecture 6, 30 Jan 2008 Vertebrate Physiology ECOL 437 (MCB/VetSci 437) Univ. of Arizona, spring 2008 Kevin Bonine & Kevin Oh 1. Intro Nervous System Fxn (slides 32-60 from Mon 28 Jan; Ch10) 2. Neurons
More informationLecture Notes 8C120 Inleiding Meten en Modelleren. Cellular electrophysiology: modeling and simulation. Nico Kuijpers
Lecture Notes 8C2 Inleiding Meten en Modelleren Cellular electrophysiology: modeling and simulation Nico Kuijpers nico.kuijpers@bf.unimaas.nl February 9, 2 2 8C2 Inleiding Meten en Modelleren Extracellular
More informationNEURONS, SENSE ORGANS, AND NERVOUS SYSTEMS CHAPTER 34
NEURONS, SENSE ORGANS, AND NERVOUS SYSTEMS CHAPTER 34 KEY CONCEPTS 34.1 Nervous Systems Are Composed of Neurons and Glial Cells 34.2 Neurons Generate Electric Signals by Controlling Ion Distributions 34.3
More informationPotassium channel gating and structure!
Reading: Potassium channel gating and structure Hille (3rd ed.) chapts 10, 13, 17 Doyle et al. The Structure of the Potassium Channel: Molecular Basis of K1 Conduction and Selectivity. Science 280:70-77
More informationChapter 9. Nerve Signals and Homeostasis
Chapter 9 Nerve Signals and Homeostasis A neuron is a specialized nerve cell that is the functional unit of the nervous system. Neural signaling communication by neurons is the process by which an animal
More information! Depolarization continued. AP Biology. " The final phase of a local action
! Resting State Resting potential is maintained mainly by non-gated K channels which allow K to diffuse out! Voltage-gated ion K and channels along axon are closed! Depolarization A stimulus causes channels
More informationThe Nervous System. What did you learn at school today? Neurophysiology!
The Nervous System What did you learn at school today? Neurophysiology! The Nervous System Controls heart rate, emotions, memories, consciousness, and much more. The most intricate and beautifully complex
More informationIntro and Homeostasis
Intro and Homeostasis Physiology - how the body works. Homeostasis - staying the same. Functional Types of Neurons Sensory (afferent - coming in) neurons: Detects the changes in the body. Informations
More informationTHE BIT OF information in nerves is the action potential, a
34 IEEE TRANSACTIONS ON NANOBIOSCIENCE, VOL. 4, NO. 1, MARCH 2005 Voltage-Gated Ion Channels Francisco Bezanilla Abstract Voltage-dependent ion channels are membrane proteins that conduct ions at high
More informationTransmission of Nerve Impulses (see Fig , p. 403)
How a nerve impulse works Transmission of Nerve Impulses (see Fig. 12.13, p. 403) 1. At Rest (Polarization) outside of neuron is positively charged compared to inside (sodium ions outside, chloride and
More informationElectrical Signaling. Lecture Outline. Using Ions as Messengers. Potentials in Electrical Signaling
Lecture Outline Electrical Signaling Using ions as messengers Potentials in electrical signaling Action Graded Other electrical signaling Gap junctions The neuron Using Ions as Messengers Important things
More informationMuscle regulation and Actin Topics: Tropomyosin and Troponin, Actin Assembly, Actin-dependent Movement
1 Muscle regulation and Actin Topics: Tropomyosin and Troponin, Actin Assembly, Actin-dependent Movement In the last lecture, we saw that a repeating alternation between chemical (ATP hydrolysis) and vectorial
More informationIntroduction Principles of Signaling and Organization p. 3 Signaling in Simple Neuronal Circuits p. 4 Organization of the Retina p.
Introduction Principles of Signaling and Organization p. 3 Signaling in Simple Neuronal Circuits p. 4 Organization of the Retina p. 5 Signaling in Nerve Cells p. 9 Cellular and Molecular Biology of Neurons
More informationBIOELECTRIC PHENOMENA
Chapter 11 BIOELECTRIC PHENOMENA 11.3 NEURONS 11.3.1 Membrane Potentials Resting Potential by separation of charge due to the selective permeability of the membrane to ions From C v= Q, where v=60mv and
More informationChapter 48 Neurons, Synapses, and Signaling
Chapter 48 Neurons, Synapses, and Signaling Concept 48.1 Neuron organization and structure reflect function in information transfer Neurons are nerve cells that transfer information within the body Neurons
More informationPhys498BIO; Prof. Paul Selvin Hw #9 Assigned Wed. 4/18/12: Due 4/25/08
1. Ionic Movements Across a Permeable Membrane: The Nernst Potential. In class we showed that if a non-permeable membrane separates a solution with high [KCl] from a solution with low [KCl], the net charge
More informationCh 7. The Nervous System 7.1 & 7.2
Ch 7 The Nervous System 7.1 & 7.2 SLOs Describe the different types of neurons and supporting cells, and identify their functions. Identify the myelin sheath and describe how it is formed in the CNS and
More informationNeurons, Synapses, and Signaling
LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 48 Neurons, Synapses, and Signaling
More information2401 : Anatomy/Physiology
Dr. Chris Doumen Week 6 2401 : Anatomy/Physiology Action Potentials NeuroPhysiology TextBook Readings Pages 400 through 408 Make use of the figures in your textbook ; a picture is worth a thousand words!
More informationIntroduction to electrophysiology 1. Dr. Tóth András
Introduction to electrophysiology 1. Dr. Tóth András Topics Transmembran transport Donnan equilibrium Resting potential Ion channels Local and action potentials Intra- and extracellular propagation of
More informationNeural Tissue. PowerPoint Lecture Presentations prepared by Jason LaPres. Lone Star College North Harris Pearson Education, Inc.
12 Neural Tissue PowerPoint Lecture Presentations prepared by Jason LaPres Lone Star College North Harris An Introduction to the Nervous System The Nervous System Includes all neural tissue in the body
More informationAction Potential (AP) NEUROEXCITABILITY II-III. Na + and K + Voltage-Gated Channels. Voltage-Gated Channels. Voltage-Gated Channels
NEUROEXCITABILITY IIIII Action Potential (AP) enables longdistance signaling woohoo! shows threshold activation allornone in amplitude conducted without decrement caused by increase in conductance PNS
More informationHousekeeping, 26 January 2009
5 th & 6 th Lectures Mon 26 & Wed 28 Jan 2009 Vertebrate Physiology ECOL 437 (MCB/VetSci 437) Univ. of Arizona, spring 2009 Neurons Chapter 11 Kevin Bonine & Kevin Oh 1. Finish Solutes + Water 2. Neurons
More informationNeurons. 5 th & 6 th Lectures Mon 26 & Wed 28 Jan Finish Solutes + Water. 2. Neurons. Chapter 11
5 th & 6 th Lectures Mon 26 & Wed 28 Jan 2009 Vertebrate Physiology ECOL 437 (MCB/VetSci 437) Univ. of Arizona, spring 2009 Neurons Chapter 11 Kevin Bonine & Kevin Oh 1. Finish Solutes + Water 2. Neurons
More informationRahaf Nasser mohammad khatatbeh
7 7... Hiba Abu Hayyeh... Rahaf Nasser mohammad khatatbeh Mohammad khatatbeh Brief introduction about membrane potential The term membrane potential refers to a separation of opposite charges across the
More informationNeurons. General neuron anatomy. BIOL 164 Human Biology Ch 7 Neurons. Nervous system:
BIOL 164 Human Biology Ch 7 Neurons Nervous system: Neurons Integrates and coordinates the body s ac3vi3es Provides rapid and brief responses to s3muli Major divisions: Central nervous system (CNS) brain
More informationQuantitative Electrophysiology
ECE 795: Quantitative Electrophysiology Notes for Lecture #1 Tuesday, September 18, 2012 1. INTRODUCTION TO EXCITABLE CELLS Historical perspective: Bioelectricity first discovered by Luigi Galvani in 1780s
More information