Microbial Diversity and Assessment (II) Spring, 2007 Guangyi Wang, Ph.D. POST103B

Size: px
Start display at page:

Download "Microbial Diversity and Assessment (II) Spring, 2007 Guangyi Wang, Ph.D. POST103B"

Transcription

1 Microbial Diversity and Assessment (II) Spring, 007 Guangyi Wang, Ph.D. POST03B

2 General introduction and overview Taxonomy [Greek taxis, arrangement or order, and nonos, law, or nemein, to distribute or govern]-the science of biological classification. Three interrelated parts: classification, nomenclature, & identification. classification - arrangement of organisms into groups or based on mutual similarity or evolutionary relatedness. Nomenclature - the branch of taxonomy concerned with the assignment of names to taxonomic groups according to the published rules. identification the practical side of taxonomy, the process of determining that a particular isolate belongs to a recognized taxon.

3 Why should we care about taxonomy? Easy to organize huge amount of knowledge about (micro)organisms. To make predictions and fame hypotheses for further research based on knowledge of similar organism (animal research and human health?) Places microorganism in meaningful, useful groups with precise names so that microbiologists can work with them and communicate efficiently. Essential for accurate identification of microorganisms (clinical microbiology?). It closely related to ecology, epidemiology and other scientific disciplines.

4 Two Different Possible Goals () Convenient ordering scheme. Use of a "key" Phenetic system: groups organisms based on mutual similarity of phenotypic characteristics. May or may not correctly match evolutionary grouping. Example: Group flagellated (motile) organisms in one group, non-motile organisms in another group. () Scheme displaying evolutionary relationships. Phylogenetic system: groups organisms based on shared evolutionary heritage. Example: Mycoplasma (no wall) and Bacillus (walled Gram+ rods) are not obviously similar, would not be grouped together phenetically. But evolutionarily they are similar, more so than either to Gram- organisms

5 Terminology Strain: descended from a single organism different isolates may be same species but are different strains; often have slight differences Type strain: the first strain isolated or best characterized kept in collections; e.g., ATCC (American Type Culture Collection) maintains the following frozen or freeze-dried stocks: (number of species in parentheses) Algae (0); Bacteria (4400); Fungi (000); Yeasts (4300); Protozoa (090); Cell lines: animal (300); Cell lines: plant (5); Viruses: animal (350); Viruses: plant (590); Viruses: bacteria (400)

6 many similar strains = species strain, species, genus, family, order, class, division, kingdom Example: Genus: Escherichia Species: coli Family: Enterobacteriaceae Class: Scotobacteria Division: Gracilicutes Kingdom: Procaryotae

7 Classical Taxonomy Phenetic systems (natural classification system): group organisms together based on the mutual similarity of the phenotypic characteristics. Major characteristics used in classical taxonomy: Classical characteristics: morphological characteristics, physiological and metabolic characteristics, ecologic characteristics; genetic analysis.

8 Classification of bacterial based on metabolism Bacterial metabolism is exceptionally diverse. Many chemical substrates can serve as a source of energy for bacterial growth and production. Chemosynthesis (by bacteria) is generally not as important as photosynthesis in producing organic matter, but is clearly important in understanding elemental cycling in the oceans.

9 Molecular Taxonomy Basic assumptions Genes mutate randomly Many mutations are "neutral" -- do not lead to any obvious disadvantage to the strain. Once a mutation is established, all progeny of parent cell carry that particular mutation. For example, in figure below, if template "A" is erroneously replicated to a "C" in the opposite strand instead of T, then one generation later the error will be "locked into place", and all progeny with that DNA will be forever altered (unless a reversion mutation occurs at some later time).

10 Two organisms that differ by only a few bases have diverged more recently in evolutionary time than organisms that differ by more bases. The following example shows how an evolutionary tree is constructed for four hypothetical organisms whose DNA sequence in one homologous region is known. Organism A and B differ by one base substitution. C and D also differ by one base substitution. But A and C differ by three substitutions, and A and D by four. B and C differ by three substitutions, and B and D also by four. In terms of evolutionary history, A and B appear to be very similar,as do C and D. A-B and C-D are more distantly related.

11 Computers excel at taking such data and creating trees that accurately illustrate the divergence between different organisms, with linear distance being proportional to the number of accumulated errors. Here are a couple of ways a computer could represent the separation between these four organisms:

12 Goals of molecular phylogeny Phylogeny can answer questions such as: How many genes are related to my favorite gene? Was the extinct quagga more like a zebra or a horse? Was Darwin correct that humans are closest to chimps and gorillas? How related are whales, dolphins & porpoises to cows? Where and when did HIV originate? What is the history of life on earth?

13 Was the quagga (now extinct) more like a zebra or a horse?

14 Woese PNAS

15 Molecular phylogeny: nomenclature of trees There are two main kinds of information inherent to any tree: topology and branch lengths. We will now describe the parts of a tree.

16 A B C D E F G H I time 6 6 A B C D E one unit Molecular phylogeny uses trees to depict evolutionary relationships among organisms. These trees are based upon DNA and protein sequence data.

17 Tree nomenclature taxon taxon I G F H 6 A B C D 6 B D A C time E one unit E

18 Tree nomenclature operational taxonomic unit (OTU) such as a protein sequence taxon I G F H 6 A B C D 6 B D A C time E one unit E OUT-One of the organisms being compared in a phylogenetic analysis.

19 Tree nomenclature branch (edge) I G Node (intersection or terminating point of two or more branches) 6 F H A B C D 6 B D A C time E one unit E

20 Tree nomenclature Branches are unscaled... Branches are scaled... I G F H 6 A B C D 6 B D A C time OTUs are neatly aligned, and nodes reflect time E one unit branch lengths are proportional to number of amino acid changes E

21 Tree nomenclature bifurcating internal node multifurcating internal node I G F H 6 A B C D 6 B D A C time E one unit E

22 Tree nomenclature: clades Clade ABF (monophyletic group) I G F H 6 time A B C D E ) Monophyletic group is applied to a group of organisms that includes an ancestral species and all of its descendants; e.g. Aves, Mammalia. This group is a complete branch of the tree of life, the phylogeny of life. Such a branch is called a clade. ) The Polyphyletic taxon is a group composed of a number of organisms which might bear some similarities, but does not include the most recent common ancestor of all the member organisms (usually because that ancestor lacks some or all of the characteristics of the group). The taxon shares derived characters which originated several times by convergence.

23 Tree nomenclature I G F H 6 A B C D Clade CDH E time Fig..4 Page 366

24 Tree nomenclature Clade ABF/CDH/G I G F H A B C 6 D E time Fig..4 Page 366

25 Examples of clades Lindblad-Toh et al., Nature 438: 803, 8 Dec. 005, fig. 0

26 Tree roots The root of a phylogenetic tree represents the common ancestor of the sequences. Some trees are unrooted, and thus do not specify the common ancestor. A tree can be rooted using an outgroup (that is, a taxon known to be distantly related from all other OTUs).

27 Tree nomenclature: roots past present Rooted tree (specifies evolutionary path) Unrooted tree Fig..6 Page 368

28 Tree nomenclature: outgroup rooting past 9 0 root present 3 4 Rooted tree Outgroup (used to place the root) Fig..6 Page 368

29 Requirements for Molecular clock Attempt to use basic assumptions to establish history of evolutionary lineages Over long periods of time, assume mutations occur with roughly predictable frequency Universally distributed across the group chosen for study Functionally homologous in each organism or with identical function Properly align the two molecules in order to identify regions of sequence homology and sequence variance. Change at a rate commensurate with the evolutionary distance measure. e.g. cytochromes, iron-sulfur proteins (ferredoxins), ATPase, RecA, & Ribosome RNA.

30 Use of 6S RNA sequence homology 6S RNA is found in small ribosomal subunit (30S) of procaryotic ribosomes. Since mitochondria and chloroplasts have these ribosomes also, it is found in all 3 kingdoms. Most ribosomal RNA mutations are deleterious. Very few mutations are neutral. Therefore evolution of 6S RNA is very slow. It is a very good molecule to use to compare organisms that may have diverged as far back as 3 or 4 billion years ago. Visit the Ribosomal Database Project on the Web for access to data and software tools. This site lets users upload sequence information, generates alignments with other ribosomal genes, and returns aligned sequences with best matches, as well as generating phylogenetic trees.

31 Three Domains of Life CLASSIFICATION - 3 Domains (Woese, 978): Current Eubacteria - true bacteria Archaebacteria - ancient bacteria Eukaryotes - protists, fungi, plants, animals

32 ProKaryotes divided into two distinct groups very early on. The archaea and bacteria first diverged, the eukaryotes developed.

33

34 Phylogenetic Classifications Bergey s Manual of Systematic Bacteriology - nd ed emphasis on 6S rrna sequence phylogenetic classification Vol. Archae & Deeply Branching & Phototrophic Bacteria Vol. Proteobacteria Vol. 3 The Low G+C Gram-positive Bacteria Vol. 4 The High G+C Gram-positive Bacteria Vol. 5 The Planctomycetes, Spirochaetes, Fibrobacteria, Bacteroidetes & Fusobacteria

35 Phylogenetic Classifications Bergey s Manual of Systematic Bacteriology - nd ed

36

37 Phylogentic Overview of Bacteria Detailed phylogenetic tree of the major lineages (8 phyla) of Bacteria based on 6S ribosomal RNA sequence comparisons

38 Archaea consist of 3 distinct groups

39 Summary Importance of taxonomy Type of taxonomy Understand phylogenetic tree Main groups of bacteria

Chapter 19. Microbial Taxonomy

Chapter 19. Microbial Taxonomy Chapter 19 Microbial Taxonomy 12-17-2008 Taxonomy science of biological classification consists of three separate but interrelated parts classification arrangement of organisms into groups (taxa; s.,taxon)

More information

Microbial Taxonomy and the Evolution of Diversity

Microbial Taxonomy and the Evolution of Diversity 19 Microbial Taxonomy and the Evolution of Diversity Copyright McGraw-Hill Global Education Holdings, LLC. Permission required for reproduction or display. 1 Taxonomy Introduction to Microbial Taxonomy

More information

Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26

Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26 Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,

More information

8/23/2014. Phylogeny and the Tree of Life

8/23/2014. Phylogeny and the Tree of Life Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major

More information

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods

More information

Name: Class: Date: ID: A

Name: Class: Date: ID: A Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change

More information

Fig. 26.7a. Biodiversity. 1. Course Outline Outcomes Instructors Text Grading. 2. Course Syllabus. Fig. 26.7b Table

Fig. 26.7a. Biodiversity. 1. Course Outline Outcomes Instructors Text Grading. 2. Course Syllabus. Fig. 26.7b Table Fig. 26.7a Biodiversity 1. Course Outline Outcomes Instructors Text Grading 2. Course Syllabus Fig. 26.7b Table 26.2-1 1 Table 26.2-2 Outline: Systematics and the Phylogenetic Revolution I. Naming and

More information

Chapter 26 Phylogeny and the Tree of Life

Chapter 26 Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence

More information

Chapter 26 Phylogeny and the Tree of Life

Chapter 26 Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin

More information

Taxonomy. Content. How to determine & classify a species. Phylogeny and evolution

Taxonomy. Content. How to determine & classify a species. Phylogeny and evolution Taxonomy Content Why Taxonomy? How to determine & classify a species Domains versus Kingdoms Phylogeny and evolution Why Taxonomy? Classification Arrangement in groups or taxa (taxon = group) Nomenclature

More information

Outline. Classification of Living Things

Outline. Classification of Living Things Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics

More information

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic

More information

Microbial Diversity. Yuzhen Ye I609 Bioinformatics Seminar I (Spring 2010) School of Informatics and Computing Indiana University

Microbial Diversity. Yuzhen Ye I609 Bioinformatics Seminar I (Spring 2010) School of Informatics and Computing Indiana University Microbial Diversity Yuzhen Ye (yye@indiana.edu) I609 Bioinformatics Seminar I (Spring 2010) School of Informatics and Computing Indiana University Contents Microbial diversity Morphological, structural,

More information

Microbiology / Active Lecture Questions Chapter 10 Classification of Microorganisms 1 Chapter 10 Classification of Microorganisms

Microbiology / Active Lecture Questions Chapter 10 Classification of Microorganisms 1 Chapter 10 Classification of Microorganisms 1 2 Bergey s Manual of Systematic Bacteriology differs from Bergey s Manual of Determinative Bacteriology in that the former a. groups bacteria into species. b. groups bacteria according to phylogenetic

More information

Bergey s Manual Classification Scheme. Vertical inheritance and evolutionary mechanisms

Bergey s Manual Classification Scheme. Vertical inheritance and evolutionary mechanisms Bergey s Manual Classification Scheme Gram + Gram - No wall Funny wall Vertical inheritance and evolutionary mechanisms a b c d e * * a b c d e * a b c d e a b c d e * a b c d e Accumulation of neutral

More information

Taxonomy and Biodiversity

Taxonomy and Biodiversity Chapter 25/26 Taxonomy and Biodiversity Evolutionary biology The major goal of evolutionary biology is to reconstruct the history of life on earth Process: a- natural selection b- mechanisms that change

More information

Biology 211 (2) Week 1 KEY!

Biology 211 (2) Week 1 KEY! Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of

More information

AP Biology. Cladistics

AP Biology. Cladistics Cladistics Kingdom Summary Review slide Review slide Classification Old 5 Kingdom system Eukaryote Monera, Protists, Plants, Fungi, Animals New 3 Domain system reflects a greater understanding of evolution

More information

Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible.

Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible. Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional

More information

Microbial Taxonomy. Slowly evolving molecules (e.g., rrna) used for large-scale structure; "fast- clock" molecules for fine-structure.

Microbial Taxonomy. Slowly evolving molecules (e.g., rrna) used for large-scale structure; fast- clock molecules for fine-structure. Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional

More information

SPECIES OF ARCHAEA ARE MORE CLOSELY RELATED TO EUKARYOTES THAN ARE SPECIES OF PROKARYOTES.

SPECIES OF ARCHAEA ARE MORE CLOSELY RELATED TO EUKARYOTES THAN ARE SPECIES OF PROKARYOTES. THE TERMS RUN AND TUMBLE ARE GENERALLY ASSOCIATED WITH A) cell wall fluidity. B) cell membrane structures. C) taxic movements of the cell. D) clustering properties of certain rod-shaped bacteria. A MAJOR

More information

9/19/2012. Chapter 17 Organizing Life s Diversity. Early Systems of Classification

9/19/2012. Chapter 17 Organizing Life s Diversity. Early Systems of Classification Section 1: The History of Classification Section 2: Modern Classification Section 3: Domains and Kingdoms Click on a lesson name to select. Early Systems of Classification Biologists use a system of classification

More information

PHYLOGENY AND SYSTEMATICS

PHYLOGENY AND SYSTEMATICS AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study

More information

CHAPTERS 24-25: Evidence for Evolution and Phylogeny

CHAPTERS 24-25: Evidence for Evolution and Phylogeny CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology

More information

Microbial Taxonomy. Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible.

Microbial Taxonomy. Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible. Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional

More information

"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky

Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally

More information

Introductory Microbiology Dr. Hala Al Daghistani

Introductory Microbiology Dr. Hala Al Daghistani Introductory Microbiology Dr. Hala Al Daghistani Why Study Microbes? Microbiology is the branch of biological sciences concerned with the study of the microbes. 1. Microbes and Man in Sickness and Health

More information

CH. 18 Classification

CH. 18 Classification CH. 18 Classification Name:_ 1. Biologists use a classification system to group organisms in part because organisms a. are going extinct. b. are very numerous and diverse. c. are too much alike. d. share

More information

Introduction to Microbiology. CLS 212: Medical Microbiology Miss Zeina Alkudmani

Introduction to Microbiology. CLS 212: Medical Microbiology Miss Zeina Alkudmani Introduction to Microbiology CLS 212: Medical Microbiology Miss Zeina Alkudmani Microbiology Micro- means very small (that needs a microscope to see). Microbiology is the study of very small living organisms.

More information

Microbial Taxonomy. C. Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible.

Microbial Taxonomy. C. Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible. Microbial Taxonomy 1. Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eucaryote, is in a mess we are stuck with it for traditional

More information

Unit 5: Taxonomy. KEY CONCEPT Organisms can be classified based on physical similarities.

Unit 5: Taxonomy. KEY CONCEPT Organisms can be classified based on physical similarities. KEY CONCEPT Organisms can be classified based on physical similarities. Linnaeus developed the scientific naming system still used today. Taxonomy is the science of naming and classifying organisms. White

More information

Origins of Life. Fundamental Properties of Life. Conditions on Early Earth. Evolution of Cells. The Tree of Life

Origins of Life. Fundamental Properties of Life. Conditions on Early Earth. Evolution of Cells. The Tree of Life The Tree of Life Chapter 26 Origins of Life The Earth formed as a hot mass of molten rock about 4.5 billion years ago (BYA) -As it cooled, chemically-rich oceans were formed from water condensation Life

More information

Lecture 11 Friday, October 21, 2011

Lecture 11 Friday, October 21, 2011 Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system

More information

The Tree of Life. Chapter 17

The Tree of Life. Chapter 17 The Tree of Life Chapter 17 1 17.1 Taxonomy The science of naming and classifying organisms 2000 years ago Aristotle Grouped plants and animals Based on structural similarities Greeks and Romans included

More information

Classification, Phylogeny yand Evolutionary History

Classification, Phylogeny yand Evolutionary History Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize

More information

Macroevolution Part I: Phylogenies

Macroevolution Part I: Phylogenies Macroevolution Part I: Phylogenies Taxonomy Classification originated with Carolus Linnaeus in the 18 th century. Based on structural (outward and inward) similarities Hierarchal scheme, the largest most

More information

Multiple Choice Write the letter on the line provided that best answers the question or completes the statement.

Multiple Choice Write the letter on the line provided that best answers the question or completes the statement. Chapter 18 Classification Chapter Test A Multiple Choice Write the letter on the line provided that best answers the question or completes the statement. 1. Scientists assign each kind of organism a universally

More information

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern

More information

Microbial Taxonomy. Classification of living organisms into groups. A group or level of classification

Microbial Taxonomy. Classification of living organisms into groups. A group or level of classification Lec 2 Oral Microbiology Dr. Chatin Purpose Microbial Taxonomy Classification Systems provide an easy way grouping of diverse and huge numbers of microbes To provide an overview of how physicians think

More information

Classification and Viruses Practice Test

Classification and Viruses Practice Test Classification and Viruses Practice Test Multiple Choice Identify the choice that best completes the statement or answers the question. 1. Biologists use a classification system to group organisms in part

More information

Bio 1B Lecture Outline (please print and bring along) Fall, 2007

Bio 1B Lecture Outline (please print and bring along) Fall, 2007 Bio 1B Lecture Outline (please print and bring along) Fall, 2007 B.D. Mishler, Dept. of Integrative Biology 2-6810, bmishler@berkeley.edu Evolution lecture #5 -- Molecular genetics and molecular evolution

More information

Chapters 25 and 26. Searching for Homology. Phylogeny

Chapters 25 and 26. Searching for Homology. Phylogeny Chapters 25 and 26 The Origin of Life as we know it. Phylogeny traces evolutionary history of taxa Systematics- analyzes relationships (modern and past) of organisms Figure 25.1 A gallery of fossils The

More information

Phylogeny and the Tree of Life

Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from

More information

Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.

Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5. Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony

More information

Ch 10. Classification of Microorganisms

Ch 10. Classification of Microorganisms Ch 10 Classification of Microorganisms Student Learning Outcomes Define taxonomy, taxon, and phylogeny. List the characteristics of the Bacteria, Archaea, and Eukarya domains. Differentiate among eukaryotic,

More information

Phylogeny and the Tree of Life

Phylogeny and the Tree of Life LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 26 Phylogeny and the Tree of Life

More information

Section 18-1 Finding Order in Diversity

Section 18-1 Finding Order in Diversity Name Class Date Section 18-1 Finding Order in Diversity (pages 447-450) Key Concepts How are living things organized for study? What is binomial nomenclature? What is Linnaeus s system of classification?

More information

Phylogeny and the Tree of Life

Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from

More information

Chapter 27: Evolutionary Genetics

Chapter 27: Evolutionary Genetics Chapter 27: Evolutionary Genetics Student Learning Objectives Upon completion of this chapter you should be able to: 1. Understand what the term species means to biology. 2. Recognize the various patterns

More information

The Tree of Life. Phylogeny

The Tree of Life. Phylogeny The Tree of Life Phylogeny Phylogenetics Phylogenetic trees illustrate the evolutionary relationships among groups of organisms, or among a family of related nucleic acid or protein sequences Each branch

More information

Bio Microbiology - Spring 2013 Study Guide 14.

Bio Microbiology - Spring 2013 Study Guide 14. Bio 230 - Microbiology - Spring 2013 Study Guide 14 http://www.swarthmore.edu/natsci/cpurrin1/evolk12/slm/origindayimages/06soup.jpg Working Backwards to the Age of the Earth Radioactive decay is consistent

More information

Biology Curriculum Pacing Guide MONTGOMERY COUNTY PUBLIC SCHOOLS

Biology Curriculum Pacing Guide MONTGOMERY COUNTY PUBLIC SCHOOLS MONTGOMERY COUNTY PUBLIC SCHOOLS Biology Curriculum Pacing Guide 1 st 9 Weeks SOL Objectives Vocabulary 7 Days 14 Days BIO.1 The student will demonstrate an understanding of scientific reasoning, logic,

More information

A. Correct! Taxonomy is the science of classification. B. Incorrect! Taxonomy is the science of classification.

A. Correct! Taxonomy is the science of classification. B. Incorrect! Taxonomy is the science of classification. DAT - Problem Drill 07: Diversity of Life Question No. 1 of 10 Instructions: (1) Read the problem and answer choices carefully, (2) Work the problems on paper as 1. What is taxonomy? Question #01 (A) Taxonomy

More information

A. Incorrect! In the binomial naming convention the Kingdom is not part of the name.

A. Incorrect! In the binomial naming convention the Kingdom is not part of the name. Microbiology Problem Drill 08: Classification of Microorganisms No. 1 of 10 1. In the binomial system of naming which term is always written in lowercase? (A) Kingdom (B) Domain (C) Genus (D) Specific

More information

Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food.

Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food. Prokaryotic Cell Eukaryotic Cell Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food. Heterotrophs must get energy by eating autotrophs or other heterotrophs.

More information

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the

More information

Organizing Life on Earth

Organizing Life on Earth Organizing Life on Earth Inquire: Organizing Life on Earth Overview Scientists continually obtain new information that helps to understand the evolutionary history of life on Earth. Each group of organisms

More information

PHYLOGENY & THE TREE OF LIFE

PHYLOGENY & THE TREE OF LIFE PHYLOGENY & THE TREE OF LIFE PREFACE In this powerpoint we learn how biologists distinguish and categorize the millions of species on earth. Early we looked at the process of evolution here we look at

More information

BINF6201/8201. Molecular phylogenetic methods

BINF6201/8201. Molecular phylogenetic methods BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics

More information

SECTION 17-1 REVIEW BIODIVERSITY. VOCABULARY REVIEW Distinguish between the terms in each of the following pairs of terms.

SECTION 17-1 REVIEW BIODIVERSITY. VOCABULARY REVIEW Distinguish between the terms in each of the following pairs of terms. SECTION 17-1 REVIEW BIODIVERSITY VOCABULARY REVIEW Distinguish between the terms in each of the following pairs of terms. 1. taxonomy, taxon 2. kingdom, species 3. phylum, division 4. species name, species

More information

Summary Finding Order in Diversity Modern Evolutionary Classification

Summary Finding Order in Diversity Modern Evolutionary Classification ( Is (.'I.isiifiuilimi Summary 18-1 Finding Order in Diversity There are millions of different species on Earth. To study this great diversity of organisms, biologists must give each organ ism a name.

More information

Phylogeny & Systematics

Phylogeny & Systematics Phylogeny & Systematics Phylogeny & Systematics An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics has revealed that despite

More information

Chapter 26: Phylogeny and the Tree of Life

Chapter 26: Phylogeny and the Tree of Life Chapter 26: Phylogeny and the Tree of Life 1. Key Concepts Pertaining to Phylogeny 2. Determining Phylogenies 3. Evolutionary History Revealed in Genomes 1. Key Concepts Pertaining to Phylogeny PHYLOGENY

More information

Test Bank for Microbiology A Systems Approach 3rd edition by Cowan

Test Bank for Microbiology A Systems Approach 3rd edition by Cowan Test Bank for Microbiology A Systems Approach 3rd edition by Cowan Link download full: http://testbankair.com/download/test-bankfor-microbiology-a-systems-approach-3rd-by-cowan/ Chapter 1: The Main Themes

More information

AP Biology Notes Outline Enduring Understanding 1.B. Big Idea 1: The process of evolution drives the diversity and unity of life.

AP Biology Notes Outline Enduring Understanding 1.B. Big Idea 1: The process of evolution drives the diversity and unity of life. AP Biology Notes Outline Enduring Understanding 1.B Big Idea 1: The process of evolution drives the diversity and unity of life. Enduring Understanding 1.B: Organisms are linked by lines of descent from

More information

Cladistics and Bioinformatics Questions 2013

Cladistics and Bioinformatics Questions 2013 AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species

More information

Phylogenetic Analysis

Phylogenetic Analysis Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

More information

Phylogenetic Analysis

Phylogenetic Analysis Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

More information

Phylogenetic Analysis

Phylogenetic Analysis Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

More information

Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016

Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016 Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,

More information

Building the Tree of Life

Building the Tree of Life 18.3 Building the Tree of Life Changing Ideas About Kingdoms This diagram shows some of the ways in which organisms have been classified into kingdoms since the 1700s. Three Domains Genetic analysis has

More information

Concept Modern Taxonomy reflects evolutionary history.

Concept Modern Taxonomy reflects evolutionary history. Concept 15.4 Modern Taxonomy reflects evolutionary history. What is Taxonomy: identification, naming, and classification of species. Common Names: can cause confusion - May refer to several species (ex.

More information

Chapter 19: Taxonomy, Systematics, and Phylogeny

Chapter 19: Taxonomy, Systematics, and Phylogeny Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand

More information

CLASSIFICATION. Why Classify? 2/18/2013. History of Taxonomy Biodiversity: variety of organisms at all levels from populations to ecosystems.

CLASSIFICATION. Why Classify? 2/18/2013. History of Taxonomy Biodiversity: variety of organisms at all levels from populations to ecosystems. Why Classify? Classification has been around ever since people paid attention to organisms. CLASSIFICATION One primeval system was based on harmful and non-harmful organisms. Life is easier when we organize

More information

SPECIATION. REPRODUCTIVE BARRIERS PREZYGOTIC: Barriers that prevent fertilization. Habitat isolation Populations can t get together

SPECIATION. REPRODUCTIVE BARRIERS PREZYGOTIC: Barriers that prevent fertilization. Habitat isolation Populations can t get together SPECIATION Origin of new species=speciation -Process by which one species splits into two or more species, accounts for both the unity and diversity of life SPECIES BIOLOGICAL CONCEPT Population or groups

More information

Phylogeny & Systematics: The Tree of Life

Phylogeny & Systematics: The Tree of Life Phylogeny & Systematics: The Tree of Life An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics has revealed that despite appearances

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

Microbiology Helmut Pospiech

Microbiology Helmut Pospiech Microbiology http://researchmagazine.uga.edu/summer2002/bacteria.htm 05.04.2018 Helmut Pospiech The Species Concept in Microbiology No universally accepted concept of species for prokaryotes Current definition

More information

Classification and Phylogeny

Classification and Phylogeny Classification and Phylogeny The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme

More information

Test Bank for Microbiology A Systems Approach 3rd edition by Cowan

Test Bank for Microbiology A Systems Approach 3rd edition by Cowan Test Bank for Microbiology A Systems Approach 3rd edition by Cowan Link download full: https://digitalcontentmarket.org/download/test-bank-formicrobiology-a-systems-approach-3rd-edition-by-cowan Chapter

More information

Unit 8 Classification

Unit 8 Classification Unit 8 Classification Chapter 18: Classification www.pearsonrealize.com 18.1 Finding Order in Diversity (510) 18.2 Modern Evolutionary Classification (516) 18.3 Building the Tree of Life (523) Name: Teacher:

More information

Chapter 17. Organizing Life's Diversity

Chapter 17. Organizing Life's Diversity Chapter 17 Organizing Life's Diversity Key Concepts: Chapter 17 1. List the 3 domains and the 6 kingdoms. 2. Our current system of classification was originally based on structures; scientists now base

More information

Burton's Microbiology for the Health Sciences

Burton's Microbiology for the Health Sciences Burton's Microbiology for the Health Sciences Chapter 3. Cell Structure and Taxonomy Chapter 3 Outline Introduction Eucaryotic Cell Structure Procaryotic Cell Structure Summary of Structural Differences

More information

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS. !! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory

More information

BIOLOGY. Phylogeny and the Tree of Life CAMPBELL. Reece Urry Cain Wasserman Minorsky Jackson

BIOLOGY. Phylogeny and the Tree of Life CAMPBELL. Reece Urry Cain Wasserman Minorsky Jackson CAMPBELL BIOLOGY TENTH EDITION Reece Urry Cain Wasserman Minorsky Jackson 26 Phylogeny and the Tree of Life Lecture Presentation by Nicole Tunbridge and Kathleen Fitzpatrick Concept 26.1: Phylogenies show

More information

9.3 Classification. Lesson Objectives. Vocabulary. Introduction. Linnaean Classification

9.3 Classification. Lesson Objectives. Vocabulary. Introduction. Linnaean Classification 9.3 Classification Lesson Objectives Outline the Linnaean classification, and define binomial nomenclature. Describe phylogenetic classification, and explain how it differs from Linnaean classification.

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Classification and Phylogeny

Classification and Phylogeny Classification and Phylogeny The diversity it of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme

More information

Classification Cladistics & The Three Domains of Life. Biology Mrs. Flannery

Classification Cladistics & The Three Domains of Life. Biology Mrs. Flannery Classification Cladistics & The Three Domains of Life Biology Mrs. Flannery Finding Order in Diversity Earth is over 4.5 billion years old. Life on Earth appeared approximately 3.5 billion years ago and

More information

Fundamentals of Biology Valencia College BSC1010C

Fundamentals of Biology Valencia College BSC1010C 1 Fundamentals of Biology Valencia College BSC1010C 1 Studying Life Chapter objectives: What Is Biology? Is All Life on Earth Related? How Do Biologists Investigate Life? How Does Biology Influence Public

More information

Evolution Problem Drill 09: The Tree of Life

Evolution Problem Drill 09: The Tree of Life Evolution Problem Drill 09: The Tree of Life Question No. 1 of 10 Question 1. The age of the Earth is estimated to be about 4.0 to 4.5 billion years old. All of the following methods may be used to estimate

More information

Biodiversity. The Road to the Six Kingdoms of Life

Biodiversity. The Road to the Six Kingdoms of Life Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant

More information

Biodiversity. The Road to the Six Kingdoms of Life

Biodiversity. The Road to the Six Kingdoms of Life Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant

More information

Building the Tree of Life

Building the Tree of Life Building the Tree of Life THINK ABOUT IT The process of identifying and naming all known organisms, living and extinct, is a huge first step toward the goal of systematics. Yet naming organisms is only

More information

Phylogeny and the Tree of Life

Phylogeny and the Tree of Life LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 26 Phylogeny and the Tree of Life

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

Rapid Learning Center Chemistry :: Biology :: Physics :: Math

Rapid Learning Center Chemistry :: Biology :: Physics :: Math Rapid Learning Center Chemistry :: Biology :: Physics :: Math Rapid Learning Center Presents Teach Yourself AP Biology in 24 Hours 1/37 *AP is a registered trademark of the College Board, which does not

More information

What is Phylogenetics

What is Phylogenetics What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)

More information

CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny

CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny To trace phylogeny or the evolutionary history of life, biologists use evidence from paleontology, molecular data, comparative

More information