Protein function prediction via graph kernels
|
|
- Karen Foster
- 5 years ago
- Views:
Transcription
1 Protein function prediction via graph kernels Karsten Borgwardt Joint work with Cheng oon Ong and.v.n. Vishwanathan, tefan chönauer, Hans-Peter Kriegel and Alex mola appeared in IMB
2 Content Introduction The problem: protein function prediction The method: upport Vector Machines (VM) Our approach to function prediction Protein graph model Protein graph kernel Experimental evaluation Technique to analyze our graph model Hyperkernels Discussion 2
3 Current approaches to protein function prediction similar structures similar phylogenetic profiles similar motifs similar interaction partners similar function similar sequences similar chemical properties similar surface clefts 3
4 Current approaches to protein function prediction similar structures similar phylogenetic profiles similar motifs similar function similar sequences similar interaction partners similar surface clefts similar chemical properties 4
5 upport Vector Machines Are new data points (x) red or black? The blue decision boundary allows to predict class membership of new data points. 5
6 Kernel trick input space feature space mapping Ф kernel function The kernel trick allows to introduce a separating hyperplane in feature space. 6
7 Feature vectors for function prediction protein structure and/or protein sequence e.g. Cai et al. (2004), Dobson and Doig (2003) hydrophobicity polarity polarizability van der Waals volume fraction of amino acid types fraction of surface area disulphide bonds size of largest surface pocket 7
8 Our approach equence + tructure + Chemical properties Graph model VMs + Graph models Protein function 8
9 Protein graph model protein secondary structure sequence structure 9
10 Protein graph model Node attributes hydrophobicity polarity polarizability van der Waals volume length helix, sheet, loop Edge attributes type (sequence, structure) length 10
11 Protein graph kernel (Kashima et al. (2003) and Gärtner et al. (2003)) compares walks of identical length l k walk ((v 1,...,v l ),(w 1,...,w l )) = l 1 k step ((v i,v i+1 ),(w i,w i+1 )) i=1 Walks are similar, if along both walks types of secondary structure elements (Es) are the same distances between Es are similar chemical properties of Es are similar 11
12 Example: Protein kernel Protein A Protein B imilar (H,10,,1,,3,H) (H,9,,1,,3,H) 12
13 Example: Protein kernel Protein A Protein B Dissimilar (H,10,,1,) (,3,H,5,) 13
14 Evaluation: enzymes vs. non-enzymes 10-fold cross-validation on 1128 proteins from dataset by Dobson and Doig (2003); 59 % are enzymes. 14
15 Attribute selection Which structural or chemical attribute is most important for correct classification? For this purpose, we employ hyperkernels (Ong et. al, 2003). Hyperkernels find an optimal linear combination of input kernel matrices : n i=1µ i K i minimizing training error and fulfilling regularization constraints 15
16 Attribute selection Our approach: Calculate kernel matrix for 600 proteins on graph model with only ONE single attribute! Repeat this for all attributes Normalize these kernel matrices Determine hyperkernel combination Weights then reflect contribution of individual attributes to correct classification 16
17 Attribute selection Attribute EC 1 EC 2 EC 3 EC 4 EC 5 EC 6 Amino acid length bin van der Waals 3-bin Hydrophobicity 3-bin Polarity bin Polarizability d length 0.40 Total van der Waals Total Hydrophobicity Total Polarity Total Polarizability
18 Discussion Novel combined approach to protein function prediction integrating sequence, structure and chemical information Reaches state-of-the-art classification accuracy on less information; higher accuracy levels on same amount of information Hyperkernels for finding most interesting protein characteristics 18
19 Discussion More detailed graph models (amino acids, atoms) might be more interesting, yet raise computational difficulties (graphs too large!) Two directions of future research: Efficient, yet expressive graph kernels for structure Integrating more proteomic information, e.g. surface pockets, into our graph model 19
BIOINFORMATICS. Protein function prediction via graph kernels
BIOINFORMATICS Vol. 00 no. 00 2005 Pages 1 9 Protein function prediction via graph kernels Karsten M. Borgwardt a, Cheng Soon Ong b, Stefan Schönauer a, S.V.N. Vishwanathan b, Alex J. Smola b, Hans-Peter
More informationMachine learning for ligand-based virtual screening and chemogenomics!
Machine learning for ligand-based virtual screening and chemogenomics! Jean-Philippe Vert Institut Curie - INSERM U900 - Mines ParisTech In silico discovery of molecular probes and drug-like compounds:
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationAdvanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions
BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationProtein Folding by Robotics
Protein Folding by Robotics 1 TBI Winterseminar 2006 February 21, 2006 Protein Folding by Robotics 1 TBI Winterseminar 2006 February 21, 2006 Protein Folding by Robotics Probabilistic Roadmap Planning
More informationFrom Amino Acids to Proteins - in 4 Easy Steps
From Amino Acids to Proteins - in 4 Easy Steps Although protein structure appears to be overwhelmingly complex, you can provide your students with a basic understanding of how proteins fold by focusing
More informationProtein Structure Prediction Using Neural Networks
Protein Structure Prediction Using Neural Networks Martha Mercaldi Kasia Wilamowska Literature Review December 16, 2003 The Protein Folding Problem Evolution of Neural Networks Neural networks originally
More informationBio nformatics. Lecture 23. Saad Mneimneh
Bio nformatics Lecture 23 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely
More informationProtein folding. α-helix. Lecture 21. An α-helix is a simple helix having on average 10 residues (3 turns of the helix)
Computat onal Biology Lecture 21 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationc 4, < y 2, 1 0, otherwise,
Fundamentals of Big Data Analytics Univ.-Prof. Dr. rer. nat. Rudolf Mathar Problem. Probability theory: The outcome of an experiment is described by three events A, B and C. The probabilities Pr(A) =,
More informationProtein Structure Basics
Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes
More informationA Submodular Framework for Graph Comparison
A Submodular Framework for Graph Comparison Pinar Yanardag Department of Computer Science Purdue University West Lafayette, IN, 47906, USA ypinar@purdue.edu S.V.N. Vishwanathan Department of Computer Science
More informationLearning SVM Classifiers with Indefinite Kernels
Learning SVM Classifiers with Indefinite Kernels Suicheng Gu and Yuhong Guo Dept. of Computer and Information Sciences Temple University Support Vector Machines (SVMs) (Kernel) SVMs are widely used in
More informationPredicting Protein Interactions with Motifs
Predicting Protein Interactions with Motifs Jessica Long Chetan Sharma Lekan Wang December 12, 2008 1 Background Proteins are essential to almost all living organisms. They are comprised of a long, tangled
More informationBIMS 503 Exam I. Sign Pledge Here: Questions from Robert Nakamoto (40 pts. Total)
BIMS 503 Exam I September 24, 2007 _ /email: Sign Pledge Here: Questions from Robert Nakamoto (40 pts. Total) Questions 1-6 refer to this situation: You are able to partially purify an enzyme activity
More informationMotif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
More informationA Novel Low-Complexity HMM Similarity Measure
A Novel Low-Complexity HMM Similarity Measure Sayed Mohammad Ebrahim Sahraeian, Student Member, IEEE, and Byung-Jun Yoon, Member, IEEE Abstract In this letter, we propose a novel similarity measure for
More informationBiomolecules: lecture 10
Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet
More informationProtein function prediction via graph kernels. Oettingenstraße 67, Munich, Germany and 2 National ICT Australia, Canberra, 0200 ACT, Australia
BIOINFORMATICS Vol. 21 Suppl. 1 2005, pages i1 i10 doi:10.1093/bioinformatics/bti1007 Protein function prediction via graph kernels Karsten M. Borgwardt 1,, Cheng Soon Ong 2, Stefan Schönauer 1, S. V.
More informationF. Piazza Center for Molecular Biophysics and University of Orléans, France. Selected topic in Physical Biology. Lecture 1
Zhou Pei-Yuan Centre for Applied Mathematics, Tsinghua University November 2013 F. Piazza Center for Molecular Biophysics and University of Orléans, France Selected topic in Physical Biology Lecture 1
More informationBIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) PROTEINS
BIOLOGY BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) NAME NAME PERIOD PROTEINS GENERAL CHARACTERISTICS AND IMPORTANCES: Polymers of amino acids Each has unique 3-D shape Vary in sequence of amino
More informationSupport Vector Machines (SVM) in bioinformatics. Day 1: Introduction to SVM
1 Support Vector Machines (SVM) in bioinformatics Day 1: Introduction to SVM Jean-Philippe Vert Bioinformatics Center, Kyoto University, Japan Jean-Philippe.Vert@mines.org Human Genome Center, University
More informationElectronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2015 Table S1. Structures and bioactivitiess ID Structure ACS Registry Number pec50 CoMFA
More informationPatrick: An Introduction to Medicinal Chemistry 5e Chapter 04
01) Which of the following statements is not true about receptors? a. Most receptors are proteins situated inside the cell. b. Receptors contain a hollow or cleft on their surface which is known as a binding
More informationMotif Extraction and Protein Classification
Motif Extraction and Protein Classification Vered Kunik 1 Zach Solan 2 Shimon Edelman 3 Eytan Ruppin 1 David Horn 2 1 School of Computer Science, Tel Aviv University, Tel Aviv 69978, Israel {kunikver,ruppin}@tau.ac.il
More informationBinet-Cauchy Kernerls on Dynamical Systems and its Application to the Analysis of Dynamic Scenes
on Dynamical Systems and its Application to the Analysis of Dynamic Scenes Dynamical Smola Alexander J. Vidal René presented by Tron Roberto July 31, 2006 Support Vector Machines (SVMs) Classification
More informationMachine Learning Practice Page 2 of 2 10/28/13
Machine Learning 10-701 Practice Page 2 of 2 10/28/13 1. True or False Please give an explanation for your answer, this is worth 1 pt/question. (a) (2 points) No classifier can do better than a naive Bayes
More informationStatistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics
Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia
More informationBayesian Data Fusion with Gaussian Process Priors : An Application to Protein Fold Recognition
Bayesian Data Fusion with Gaussian Process Priors : An Application to Protein Fold Recognition Mar Girolami 1 Department of Computing Science University of Glasgow girolami@dcs.gla.ac.u 1 Introduction
More informationChapter 6: Classification
Chapter 6: Classification 1) Introduction Classification problem, evaluation of classifiers, prediction 2) Bayesian Classifiers Bayes classifier, naive Bayes classifier, applications 3) Linear discriminant
More informationCSCE555 Bioinformatics. Protein Function Annotation
CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The
More informationBME Engineering Molecular Cell Biology. Structure and Dynamics of Cellular Molecules. Basics of Cell Biology Literature Reading
BME 42-620 Engineering Molecular Cell Biology Lecture 05: Structure and Dynamics of Cellular Molecules Basics of Cell Biology Literature Reading BME42-620 Lecture 05, September 13, 2011 1 Outline Review:
More informationOrientational degeneracy in the presence of one alignment tensor.
Orientational degeneracy in the presence of one alignment tensor. Rotation about the x, y and z axes can be performed in the aligned mode of the program to examine the four degenerate orientations of two
More informationLecture 2-3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability
Lecture 2-3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Part I. Review of forces Covalent bonds Non-covalent Interactions Van der Waals Interactions
More informationBayesian Models and Algorithms for Protein Beta-Sheet Prediction
0 Bayesian Models and Algorithms for Protein Beta-Sheet Prediction Zafer Aydin, Student Member, IEEE, Yucel Altunbasak, Senior Member, IEEE, and Hakan Erdogan, Member, IEEE Abstract Prediction of the three-dimensional
More informationPatrick: An Introduction to Medicinal Chemistry 5e Chapter 03
01) Which of the following statements is not true regarding the active site of an enzyme? a. An active site is normally on the surface of an enzyme. b. An active site is normally hydrophobic in nature.
More informationFluorine in Peptide and Protein Engineering
Fluorine in Peptide and Protein Engineering Rita Fernandes Porto, February 11 th 2016 Supervisor: Prof. Dr. Beate Koksch 1 Fluorine a unique element for molecule design The most abundant halogen in earth
More informationSAM Teacher s Guide Protein Partnering and Function
SAM Teacher s Guide Protein Partnering and Function Overview Students explore protein molecules physical and chemical characteristics and learn that these unique characteristics enable other molecules
More informationPresentation Outline. Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy
Prediction of Protein Secondary Structure using Neural Networks at Better than 70% Accuracy Burkhard Rost and Chris Sander By Kalyan C. Gopavarapu 1 Presentation Outline Major Terminology Problem Method
More informationWhen intermolecular forces are strong, the atoms, molecules, or ions are strongly attracted to each other, and draw closer together.
INTERMOLECULAR FORCES: THE FORCE BEHIND VARIOUS PROPERTIES WHY? Intermolecular forces are largely responsible for the properties of affinity, solubility, volatility, melting/ boiling point, and viscosity.
More informationBiochemistry,530:,, Introduc5on,to,Structural,Biology, Autumn,Quarter,2015,
Biochemistry,530:,, Introduc5on,to,Structural,Biology, Autumn,Quarter,2015, Course,Informa5on, BIOC%530% GraduateAlevel,discussion,of,the,structure,,func5on,,and,chemistry,of,proteins,and, nucleic,acids,,control,of,enzyma5c,reac5ons.,please,see,the,course,syllabus,and,
More informationDana Alsulaibi. Jaleel G.Sweis. Mamoon Ahram
15 Dana Alsulaibi Jaleel G.Sweis Mamoon Ahram Revision of last lectures: Proteins have four levels of structures. Primary,secondary, tertiary and quaternary. Primary structure is the order of amino acids
More informationSyllabus BINF Computational Biology Core Course
Course Description Syllabus BINF 701-702 Computational Biology Core Course BINF 701/702 is the Computational Biology core course developed at the KU Center for Computational Biology. The course is designed
More informationCharged amino acids (side-chains)
Proteins are composed of monomers called amino acids There are 20 different amino acids Amine Group Central ydrocarbon N C C R Group Carboxyl Group ALL amino acids have the exact same structure except
More informationKernels for Dynamic Textures
Kernels for Dynamic Textures S.V.N. Vishwanathan SVN.Vishwanathan@nicta.com.au http://web.anu.edu.au/~vishy National ICT Australia and Australian National University Joint work with Alex Smola and René
More informationAlpha-helical Topology and Tertiary Structure Prediction of Globular Proteins Scott R. McAllister Christodoulos A. Floudas Princeton University
Alpha-helical Topology and Tertiary Structure Prediction of Globular Proteins Scott R. McAllister Christodoulos A. Floudas Princeton University Department of Chemical Engineering Program of Applied and
More informationSubstitution Matrix based Kernel Functions for Protein Secondary Structure Prediction
Substitution Matrix based Kernel Functions for Protein Secondary Structure Prediction Bram Vanschoenwinkel Vrije Universiteit Brussel Computational Modeling Lab Pleinlaan 2, 1050 Brussel, Belgium Email:
More informationUsing Machine Learning to Determine Fold Class and Secondary Structure Content from Raman Optical Activity and Raman Vibrational Spectroscopy
Using Machine Learning to Determine Fold Class and Secondary Structure Content from Raman Optical Activity and Raman Vibrational Spectroscopy A thesis submitted to the University of Manchester for the
More informationCS798: Selected topics in Machine Learning
CS798: Selected topics in Machine Learning Support Vector Machine Jakramate Bootkrajang Department of Computer Science Chiang Mai University Jakramate Bootkrajang CS798: Selected topics in Machine Learning
More informationMachine Learning: Exercise Sheet 2
Machine Learning: Exercise Sheet 2 Manuel Blum AG Maschinelles Lernen und Natürlichsprachliche Systeme Albert-Ludwigs-Universität Freiburg mblum@informatik.uni-freiburg.de Manuel Blum Machine Learning
More informationNeural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha
Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this
More informationMonte Carlo Simulations of Protein Folding using Lattice Models
Monte Carlo Simulations of Protein Folding using Lattice Models Ryan Cheng 1,2 and Kenneth Jordan 1,3 1 Bioengineering and Bioinformatics Summer Institute, Department of Computational Biology, University
More informationSupport Vector Machine. Industrial AI Lab.
Support Vector Machine Industrial AI Lab. Classification (Linear) Autonomously figure out which category (or class) an unknown item should be categorized into Number of categories / classes Binary: 2 different
More informationDihedral Angles. Homayoun Valafar. Department of Computer Science and Engineering, USC 02/03/10 CSCE 769
Dihedral Angles Homayoun Valafar Department of Computer Science and Engineering, USC The precise definition of a dihedral or torsion angle can be found in spatial geometry Angle between to planes Dihedral
More informationCrowdsourcing via Tensor Augmentation and Completion (TAC)
Crowdsourcing via Tensor Augmentation and Completion (TAC) Presenter: Yao Zhou joint work with: Dr. Jingrui He - 1 - Roadmap Background Related work Crowdsourcing based on TAC Experimental results Conclusion
More informationComputational methods for predicting protein-protein interactions
Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More information1-D Predictions. Prediction of local features: Secondary structure & surface exposure
1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local
More informationClassification. Department Biosysteme Karsten Borgwardt Data Mining Course Basel Fall Semester / 162
Classification Department Biosysteme Karsten Borgwardt Data Mining Course Basel Fall Semester 2015 66 / 162 Department Biosysteme Karsten Borgwardt Data Mining Course Basel Fall Semester 2015 67 / 162
More informationHMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder
HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding
More informationSupport Vector Machines. Introduction to Data Mining, 2 nd Edition by Tan, Steinbach, Karpatne, Kumar
Data Mining Support Vector Machines Introduction to Data Mining, 2 nd Edition by Tan, Steinbach, Karpatne, Kumar 02/03/2018 Introduction to Data Mining 1 Support Vector Machines Find a linear hyperplane
More informationKernel Learning with Bregman Matrix Divergences
Kernel Learning with Bregman Matrix Divergences Inderjit S. Dhillon The University of Texas at Austin Workshop on Algorithms for Modern Massive Data Sets Stanford University and Yahoo! Research June 22,
More informationProtein Secondary Structure Prediction
part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 the goal is the prediction of the secondary structure conformation which is local each amino
More informationDenaturation and renaturation of proteins
Denaturation and renaturation of proteins Higher levels of protein structure are formed without covalent bonds. Therefore, they are not as stable as peptide covalent bonds which make protein primary structure
More informationLinear vs Non-linear classifier. CS789: Machine Learning and Neural Network. Introduction
Linear vs Non-linear classifier CS789: Machine Learning and Neural Network Support Vector Machine Jakramate Bootkrajang Department of Computer Science Chiang Mai University Linear classifier is in the
More informationA General Method for Combining Predictors Tested on Protein Secondary Structure Prediction
A General Method for Combining Predictors Tested on Protein Secondary Structure Prediction Jakob V. Hansen Department of Computer Science, University of Aarhus Ny Munkegade, Bldg. 540, DK-8000 Aarhus C,
More informationBIOINFORMATICS ORIGINAL PAPER doi: /bioinformatics/btl642
Vol. 23 no. 9 2007, pages 1090 1098 BIOINFORMATICS ORIGINAL PAPER doi:10.1093/bioinformatics/btl642 Structural bioinformatics A structural alignment kernel for protein structures Jian Qiu 1, Martial Hue
More informationEnhancing Specificity in the Janus Kinases: A Study on the Thienopyridine. JAK2 Selective Mechanism Combined Molecular Dynamics Simulation
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2015 Supporting Information Enhancing Specificity in the Janus Kinases: A Study on the Thienopyridine
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationHYPERGRAPH BASED SEMI-SUPERVISED LEARNING ALGORITHMS APPLIED TO SPEECH RECOGNITION PROBLEM: A NOVEL APPROACH
HYPERGRAPH BASED SEMI-SUPERVISED LEARNING ALGORITHMS APPLIED TO SPEECH RECOGNITION PROBLEM: A NOVEL APPROACH Hoang Trang 1, Tran Hoang Loc 1 1 Ho Chi Minh City University of Technology-VNU HCM, Ho Chi
More informationBiomolecules: lecture 9
Biomolecules: lecture 9 - understanding further why amino acids are the building block for proteins - understanding the chemical properties amino acids bring to proteins - realizing that many proteins
More informationA Three-Way Model for Collective Learning on Multi-Relational Data
A Three-Way Model for Collective Learning on Multi-Relational Data 28th International Conference on Machine Learning Maximilian Nickel 1 Volker Tresp 2 Hans-Peter Kriegel 1 1 Ludwig-Maximilians Universität,
More informationThe prediction of membrane protein types with NPE
The prediction of membrane protein types with NPE Lipeng Wang 1a), Zhanting Yuan 1, Xuhui Chen 1, and Zhifang Zhou 2 1 College of Electrical and Information Engineering Lanzhou University of Technology,
More informationProtein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1
Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2
More informationPeptides And Proteins
Kevin Burgess, May 3, 2017 1 Peptides And Proteins from chapter(s) in the recommended text A. Introduction B. omenclature And Conventions by amide bonds. on the left, right. 2 -terminal C-terminal triglycine
More informationBIBC 100. Structural Biochemistry
BIBC 100 Structural Biochemistry http://classes.biology.ucsd.edu/bibc100.wi14 Papers- Dialogue with Scientists Questions: Why? How? What? So What? Dialogue Structure to explain function Knowledge Food
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationProtein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds
Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino
More informationChemistry in Biology. Section 1. Atoms, Elements, and Compounds
Section 1 Atoms, Elements, and Compounds Atoms! Chemistry is the study of matter.! Atoms are the building blocks of matter.! Neutrons and protons are located at the center of the atom.! Protons are positively
More information2MHR. Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity.
Protein structure classification is important because it organizes the protein structure universe that is independent of sequence similarity. A global picture of the protein universe will help us to understand
More informationWhy Proteins Fold. How Proteins Fold? e - ΔG/kT. Protein Folding, Nonbonding Forces, and Free Energy
Why Proteins Fold Proteins are the action superheroes of the body. As enzymes, they make reactions go a million times faster. As versatile transport vehicles, they carry oxygen and antibodies to fight
More informationMachine learning comes from Bayesian decision theory in statistics. There we want to minimize the expected value of the loss function.
Bayesian learning: Machine learning comes from Bayesian decision theory in statistics. There we want to minimize the expected value of the loss function. Let y be the true label and y be the predicted
More informationProteins. Division Ave. High School Ms. Foglia AP Biology. Proteins. Proteins. Multipurpose molecules
Proteins Proteins Multipurpose molecules 2008-2009 Proteins Most structurally & functionally diverse group Function: involved in almost everything u enzymes (pepsin, DNA polymerase) u structure (keratin,
More informationTraining algorithms for fuzzy support vector machines with nois
Training algorithms for fuzzy support vector machines with noisy data Presented by Josh Hoak Chun-fu Lin 1 Sheng-de Wang 1 1 National Taiwan University 13 April 2010 Prelude Problem: SVMs are particularly
More informationPapers listed: Cell2. This weeks papers. Chapt 4. Protein structure and function. The importance of proteins
1 Papers listed: Cell2 During the semester I will speak of information from several papers. For many of them you will not be required to read these papers, however, you can do so for the fun of it (and
More informationBenchmarking of Protein Descriptor Sets in. Proteochemometric Modeling (Part 1)
Benchmarking of Protein Descriptor Sets in Proteochemometric Modeling (Part 1) Comparative Study of 13 Amino Acid Descriptors Additional File 1 Gerard J.P. van Westen 1, Remco F. Swier 1, Jörg K. Wegner
More informationBCH 4053 Spring 2003 Chapter 6 Lecture Notes
BCH 4053 Spring 2003 Chapter 6 Lecture Notes 1 CHAPTER 6 Proteins: Secondary, Tertiary, and Quaternary Structure 2 Levels of Protein Structure Primary (sequence) Secondary (ordered structure along peptide
More informationLinear Classifiers: Expressiveness
Linear Classifiers: Expressiveness Machine Learning Spring 2018 The slides are mainly from Vivek Srikumar 1 Lecture outline Linear classifiers: Introduction What functions do linear classifiers express?
More informationNanobiotechnology. Place: IOP 1 st Meeting Room Time: 9:30-12:00. Reference: Review Papers. Grade: 40% midterm, 60% final report (oral + written)
Nanobiotechnology Place: IOP 1 st Meeting Room Time: 9:30-12:00 Reference: Review Papers Grade: 40% midterm, 60% final report (oral + written) Midterm: 5/18 Oral Presentation 1. 20 minutes each person
More informationBiochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture - 06 Protein Structure IV
Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur Lecture - 06 Protein Structure IV We complete our discussion on Protein Structures today. And just to recap
More informationNeural Networks, Computation Graphs. CMSC 470 Marine Carpuat
Neural Networks, Computation Graphs CMSC 470 Marine Carpuat Binary Classification with a Multi-layer Perceptron φ A = 1 φ site = 1 φ located = 1 φ Maizuru = 1 φ, = 2 φ in = 1 φ Kyoto = 1 φ priest = 0 φ
More informationSupport Vector Machine. Industrial AI Lab. Prof. Seungchul Lee
Support Vector Machine Industrial AI Lab. Prof. Seungchul Lee Classification (Linear) Autonomously figure out which category (or class) an unknown item should be categorized into Number of categories /
More informationModeling Biological Systems Opportunities for Computer Scientists
Modeling Biological Systems Opportunities for Computer Scientists Filip Jagodzinski RBO Tutorial Series 25 June 2007 Computer Science Robotics & Biology Laboratory Protein: πρώτα, "prota, of Primary Importance
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein
More informationKernelized Perceptron Support Vector Machines
Kernelized Perceptron Support Vector Machines Emily Fox University of Washington February 13, 2017 What is the perceptron optimizing? 1 The perceptron algorithm [Rosenblatt 58, 62] Classification setting:
More informationProtein Structure: Data Bases and Classification Ingo Ruczinski
Protein Structure: Data Bases and Classification Ingo Ruczinski Department of Biostatistics, Johns Hopkins University Reference Bourne and Weissig Structural Bioinformatics Wiley, 2003 More References
More information