TMSEG Michael Bernhofer, Jonas Reeb pp1_tmseg
|
|
- Jeffry Banks
- 5 years ago
- Views:
Transcription
1 title: short title: TMSEG Michael Bernhofer, Jonas Reeb pp1_tmseg lecture: Protein Prediction 1 (for Computational Biology) Protein structure TUM summer semester
2 Last time 2
3 3
4 Yet another transmembrane predictor? More data available Re-training old methods is viable but no one does it Less extensive machine learning Runtime 4
5 Dataset Transmembrane helices I 166 membrane protein sequences (TMP166) TMH assignment from 3D-structure by OPM & PDBTM Assignments differ, both used for training Map to UniProt sequence using SIFTS Redundancy reduction with Uniqueprot at HVAL>0 Lomize et al., 2006, Bioinformatics Kozma et al., 2013, NAR Velankar et al., 2013, NAR Mika et al., 2003, NAR 5
6 Dataset Transmembrane helices II Inside/Outside topology assignment OPM Lomize et al., 2006, Bioinformatics 6
7 Dataset Proteins w/ and w/o signal peptides Derived from the SignalP 4.0 training set Redundancy reduced against set of 166 TMPs at HVAL>0 Redundancy reduced within at HVAL>0 Soluble: 1142 (452 w/ SP) Membrane: 299 (25 w/ SP) SP1441 7
8 Dataset Split Split into 4 subsets, maintaining distribution of TMPs, SPs and sequence lengths Use 3 sets for cross-validation, keep one for final independent evaluation (Blind set) Blind Blind TMP SP Train Train 8
9 Classification trees Given N training samples and M input features find the best recursive partitioning to predict the class labels in the leaf nodes Splitting, pruning, balancing... approaches differentiate algorithms 9
10 Classification trees example Loh, 2011, Wiley Interdisciplinary Reviews: Data Mining and Knowledge Discovery 10
11 Random forests Ensemble method: grow T trees for a forest For M input features, choose m < M For each t T: Select N training samples with replacement from all N samples At every split, choose m random features. Use the best split among those for building the tree 11
12 Random forests - Popularity Fast No black box Intuitive to interpret Good performance Jensen et al., 2011, Bioinformatics 12
13 TMSEG step 1 Initial prediction Random Forest (T = 100, m = 9) Sliding window of 19 residues (w = 19) 3 scores for each residue (0-1000): Signal peptide Transmembrane helix Soluble Scores scaled from to
14 TMSEG overview Step 1 14
15 TMSEG step 1 - Feature set I Global features: Global amino acid composition Protein length Local features: PSSM score Distance to N- and C-terminus Average hydrophobicity (Kyte-Doolittle) % hydrophobic % charged (positive & negative) w = 9 % polar 15
16 TMSEG step 1 - Feature set II Adjusting for conservation Substitutions with score > 0 = 16 Substitutions with score < 0 = 79 16
17 TMSEG step 1 - Feature set III Adjusting for conservation Amino acid composition M (PSSM>0) = 1/16 17
18 TMSEG step 1 - Feature set IV Adjusting for conservation Amino acid composition M (PSSM>0) = 1/16 Amino acid composition M (PSSM<0) = 3/79 18
19 TMSEG step 1 - Feature set V Adjusting for conservation % positive charge (PSSM>0) = 2/16 % positive charge (PSSM<0) = 8/79 19
20 TMSEG step 1 - Feature set VI Global features: PSSM 0 Global amino acid composition 2*20 Protein length (binned) 1 Local features: PSSM score 21*19 Distance to N- and C-terminus 2 PSSM 0 PSSM 0 PSSM 0 PSSM 0 Average hydrophobicity (Kyte-Doolittle) 2*1 % hydrophobic 2*1 % charged (positive & negative) 2*2 % polar 2*1 20
21 TMSEG step 2 Empirical filter Smooth scores with median filter (w = 5) Adjust scores to avoid overprediction soluble: -185 TMH: -60 Assign each residue to state with highest score Remove signal peptides with <4 residues Remove TMHs with <7 residues 21
22 TMSEG step 2 Example SEQ: M G P R A R P A L L L L... SIG: SOL: TMH: à Median filter SIG: SOL: TMH: à Adjust for overprediction SIG: SOL: TMH: OUT: S S S S S S S S S S... 22
23 TMSEG overview Step 1 & 2 23
24 TMSEG step 3 Refine TMH prediction I Neural Network (25 hidden nodes) Input: TMH segments of variable length Features: PSSM 0 PSSM 0 PSSM 0 PSSM 0 Amino acid composition 2*20 Average hydrophobicity (Kyte-Doolittle) 2*1 % hydrophobic 2*1 % charged 2*1 Segment length (exact) 1 24
25 TMSEG step 3 Refine TMH prediction II Split long TMHs ( 35 residues) into two shorter TMHs ( 17 residues) Keep two TMHs if higher average score after split Adjust TMH endpoints by up to 3 residues in either direction 25
26 TMSEG overview Step
27 TMSEG step 4 Topology prediction I Random Forest (T = 100, m = 7) Assign soluble segments to side 1 or 2 Features: PSSM 0 PSSM 0 PSSM 0 Amino acid composition 2*2*20 % positive charge 2*2*1 % abs. difference of pos. charge side1/side2 2*1 27
28 TMSEG step 4 Topology prediction II Consider only residues close to TMHs 15 residues next to TMHs and 8 residues into TMHs Predict topology of N-terminus and extrapolate If SP predicted à Residues after SP outside 28
29 TMSEG overview Step
30 Performance measures I Per-residue measures often misleading à Score by TMH segments instead Whole-protein scores: Q ok and Q top 30
31 Performance measures II r i : #correctly predicted TMHs B #observed TMHs p i : #correctly predicted TMHs B #predicted TMHs Q ok : L 100 N C 1, if pi = ri = 100% x i ; xi = G 0, else MNO 31
32 Performance measures III What is a correctly predicted TMH? Strict criteria Endpoint deviation 5 residues Overlap at least 50% 32
33 Performance measures IV t i : 100% if toplogy is correct, otherwise 0% Q top : L 100 N C 1, if ti = pi = ri = 100% y i ; yi = G 0, else MNO 33
34 Performance of TMH predictions 34
35 Performance measures TMP classification FPR: 100 # of incorrectly predicted TMPs # of soluble proteins Sensitvity: 100 # of correctly predicted TMPs # of observed TMPs Compare to a simple predictor ( Baseline ) Uses only hydrophobicity scale and positive-inside rule 35
36 TMP classification Very low misclassification rates Method TMP sensitivity TMP FPR Topology correct Misclassified in human More mistakes than TMSEG in human TMSEG 98 ± 2 3 ± 1 93 ± PolyPhobius 100 ± 0 5 ± 1 78 ± MEMSAT3 100 ± 0 28 ± 2 93 ± 4 4,313 3,755 MEMSAT-SVM 98 ± 2 14 ± 2 88 ± 5 2,253 1,695 Baseline 95 ± 3 31 ± 2 75 ± 7 5,015 4,457 36
37 Dataset of 12 new proteins How to get more data? Use what was published since starting work à Data unknown by any method From 07/2013 to 2016/02: Only 12 new TMPs published Very small dataset TMSEG predicts every TMH of the 10 recognized TMPs 37
38 Applying TMSEG to other methods I High modularity (steps 1-4) Apply steps 3 and 4 to other methods Step3: NN-based TMH prediction improvement Step4: RF-based topology prediction Can this improve other methods? 38
39 Applying TMSEG to other methods II 39
40 Potential extensions Re-entrant regions not modelled (little data) Idea: Check abnormal TMH segments for reentrant Does not switching topology increase scores? 40
41 Availability Debian package: Github: github.com/rostlab/tmseg PredictProtein: predictprotein.org Yachdav et al., 2014, NAR 41
42 Thank you Unknown source L 42
43 References Yachdav, G., Kloppmann, E., Kajan, L., Hecht, M., Goldberg, T., Hamp, T., Rost, B. (2014). PredictProtein-an open resource for online prediction of protein structural and functional features. Nucleic Acids Research, 42(Web Server issue), W Jensen, L. J., & Bateman, A. (2011). The rise and fall of supervised machine learning techniques. Bioinformatics, 27(24), Loh, W.-Y. (2011). Classification and regression trees. Wiley Interdisciplinary Reviews: Data Mining and Knowledge Discovery, 1(1), Lomize, M. a, Lomize, A. L., Pogozheva, I. D., & Mosberg, H. I. (2006). OPM: orientations of proteins in membranes database. Bioinformatics (Oxford, England), 22(5), Velankar, S., McNeil, P., Mittard-Runte, V., Suarez, a, Barrell, D., Apweiler, R., & Henrick, K. (2005). E-MSD: an integrated data resource for bioinformatics. Nucleic Acids Research, 33(Database issue), D Kozma, D., Simon, I., & Tusnády, G. E. (2013). PDBTM: Protein Data Bank of transmembrane proteins after 8 years. Nucleic Acids Research, 41(Database issue), D Mika, S., & Rost, B. (2003). UniqueProt: creating representative protein sequence sets. Nucleic Acids Research, 31(13),
proteins TMSEG: Novel prediction of transmembrane helices Michael Bernhofer, 1 * Edda Kloppmann, 1,2 Jonas Reeb, 1 and Burkhard Rost 1,2,3,4
proteins STRUCTURE O FUNCTION O BIOINFORMATICS TMSEG: Novel prediction of transmembrane helices Michael Bernhofer, 1 * Edda Kloppmann, 1,2 Jonas Reeb, 1 and Burkhard Rost 1,2,3,4 1 Department of Informatics
More informationprotein. Evaluation of transmembrane helix predictions in 2014 Jonas Reeb, 1 Edda Kloppmann, 1,2 * Michael Bernhofer, 1 and Burkhard Rost 1,2,3,4
proteins STRUCTURE O FUNCTION O BIOINFORMATICS Evaluation of transmembrane helix predictions in 2014 Jonas Reeb, 1 Edda Kloppmann, 1,2 * Michael Bernhofer, 1 and Burkhard Rost 1,2,3,4 1 Department of Informatics
More informationSUPPLEMENTARY MATERIALS
SUPPLEMENTARY MATERIALS Enhanced Recognition of Transmembrane Protein Domains with Prediction-based Structural Profiles Baoqiang Cao, Aleksey Porollo, Rafal Adamczak, Mark Jarrell and Jaroslaw Meller Contact:
More informationStatistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics
Statistical Machine Learning Methods for Bioinformatics IV. Neural Network & Deep Learning Applications in Bioinformatics Jianlin Cheng, PhD Department of Computer Science University of Missouri, Columbia
More informationHoldout and Cross-Validation Methods Overfitting Avoidance
Holdout and Cross-Validation Methods Overfitting Avoidance Decision Trees Reduce error pruning Cost-complexity pruning Neural Networks Early stopping Adjusting Regularizers via Cross-Validation Nearest
More informationData Mining und Maschinelles Lernen
Data Mining und Maschinelles Lernen Ensemble Methods Bias-Variance Trade-off Basic Idea of Ensembles Bagging Basic Algorithm Bagging with Costs Randomization Random Forests Boosting Stacking Error-Correcting
More informationA Machine Text-Inspired Machine Learning Approach for Identification of Transmembrane Helix Boundaries
A Machine Text-Inspired Machine Learning Approach for Identification of Transmembrane Helix Boundaries Betty Yee Man Cheng 1, Jaime G. Carbonell 1, and Judith Klein-Seetharaman 1, 2 1 Language Technologies
More informationStatistics and learning: Big Data
Statistics and learning: Big Data Learning Decision Trees and an Introduction to Boosting Sébastien Gadat Toulouse School of Economics February 2017 S. Gadat (TSE) SAD 2013 1 / 30 Keywords Decision trees
More informationA benchmark server using high resolution protein structure data, and benchmark results for membrane helix predictions. Rath et al.
A benchmark server using high resolution protein structure data, and benchmark results for membrane helix predictions Rath et al. Rath et al. BMC Bioinformatics 2013, 14:111 Rath et al. BMC Bioinformatics
More informationLearning with multiple models. Boosting.
CS 2750 Machine Learning Lecture 21 Learning with multiple models. Boosting. Milos Hauskrecht milos@cs.pitt.edu 5329 Sennott Square Learning with multiple models: Approach 2 Approach 2: use multiple models
More informationMachine Learning in Action
Machine Learning in Action Tatyana Goldberg (goldberg@rostlab.org) August 16, 2016 @ Machine Learning in Biology Beijing Genomics Institute in Shenzhen, China June 2014 GenBank 1 173,353,076 DNA sequences
More informationTMHMM2.0 User's guide
TMHMM2.0 User's guide This program is for prediction of transmembrane helices in proteins. July 2001: TMHMM has been rated best in an independent comparison of programs for prediction of TM helices: S.
More informationA General Method for Combining Predictors Tested on Protein Secondary Structure Prediction
A General Method for Combining Predictors Tested on Protein Secondary Structure Prediction Jakob V. Hansen Department of Computer Science, University of Aarhus Ny Munkegade, Bldg. 540, DK-8000 Aarhus C,
More informationBIOINFORMATICS. Enhanced Recognition of Protein Transmembrane Domains with Prediction-based Structural Profiles
BIOINFORMATICS Vol.? no.? 200? Pages 1 1 Enhanced Recognition of Protein Transmembrane Domains with Prediction-based Structural Profiles Baoqiang Cao 2, Aleksey Porollo 1, Rafal Adamczak 1, Mark Jarrell
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2014 1 HMM Lecture Notes Dannie Durand and Rose Hoberman November 6th Introduction In the last few lectures, we have focused on three problems related
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationMachine learning comes from Bayesian decision theory in statistics. There we want to minimize the expected value of the loss function.
Bayesian learning: Machine learning comes from Bayesian decision theory in statistics. There we want to minimize the expected value of the loss function. Let y be the true label and y be the predicted
More informationNonlinear Classification
Nonlinear Classification INFO-4604, Applied Machine Learning University of Colorado Boulder October 5-10, 2017 Prof. Michael Paul Linear Classification Most classifiers we ve seen use linear functions
More informationModel Accuracy Measures
Model Accuracy Measures Master in Bioinformatics UPF 2017-2018 Eduardo Eyras Computational Genomics Pompeu Fabra University - ICREA Barcelona, Spain Variables What we can measure (attributes) Hypotheses
More informationTopology Prediction of Helical Transmembrane Proteins: How Far Have We Reached?
550 Current Protein and Peptide Science, 2010, 11, 550-561 Topology Prediction of Helical Transmembrane Proteins: How Far Have We Reached? Gábor E. Tusnády and István Simon* Institute of Enzymology, BRC,
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationNeural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha
Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this
More informationReal Estate Price Prediction with Regression and Classification CS 229 Autumn 2016 Project Final Report
Real Estate Price Prediction with Regression and Classification CS 229 Autumn 2016 Project Final Report Hujia Yu, Jiafu Wu [hujiay, jiafuwu]@stanford.edu 1. Introduction Housing prices are an important
More informationJessica Wehner. Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008
Journal Club Jessica Wehner Summer Fellow Bioengineering and Bioinformatics Summer Institute University of Pittsburgh 29 May 2008 Comparison of Probabilistic Combination Methods for Protein Secondary Structure
More informationCSE 352 (AI) LECTURE NOTES Professor Anita Wasilewska. NEURAL NETWORKS Learning
CSE 352 (AI) LECTURE NOTES Professor Anita Wasilewska NEURAL NETWORKS Learning Neural Networks Classifier Short Presentation INPUT: classification data, i.e. it contains an classification (class) attribute.
More informationClassification using stochastic ensembles
July 31, 2014 Topics Introduction Topics Classification Application and classfication Classification and Regression Trees Stochastic ensemble methods Our application: USAID Poverty Assessment Tools Topics
More informationCSE 417T: Introduction to Machine Learning. Final Review. Henry Chai 12/4/18
CSE 417T: Introduction to Machine Learning Final Review Henry Chai 12/4/18 Overfitting Overfitting is fitting the training data more than is warranted Fitting noise rather than signal 2 Estimating! "#$
More informationDyadic Classification Trees via Structural Risk Minimization
Dyadic Classification Trees via Structural Risk Minimization Clayton Scott and Robert Nowak Department of Electrical and Computer Engineering Rice University Houston, TX 77005 cscott,nowak @rice.edu Abstract
More informationPredictive Modeling: Classification. KSE 521 Topic 6 Mun Yi
Predictive Modeling: Classification Topic 6 Mun Yi Agenda Models and Induction Entropy and Information Gain Tree-Based Classifier Probability Estimation 2 Introduction Key concept of BI: Predictive modeling
More informationAnomaly Detection for the CERN Large Hadron Collider injection magnets
Anomaly Detection for the CERN Large Hadron Collider injection magnets Armin Halilovic KU Leuven - Department of Computer Science In cooperation with CERN 2018-07-27 0 Outline 1 Context 2 Data 3 Preprocessing
More informationNeural Networks and Ensemble Methods for Classification
Neural Networks and Ensemble Methods for Classification NEURAL NETWORKS 2 Neural Networks A neural network is a set of connected input/output units (neurons) where each connection has a weight associated
More informationMachine Learning Ensemble Learning I Hamid R. Rabiee Jafar Muhammadi, Alireza Ghasemi Spring /
Machine Learning Ensemble Learning I Hamid R. Rabiee Jafar Muhammadi, Alireza Ghasemi Spring 2015 http://ce.sharif.edu/courses/93-94/2/ce717-1 / Agenda Combining Classifiers Empirical view Theoretical
More informationBoosting. Ryan Tibshirani Data Mining: / April Optional reading: ISL 8.2, ESL , 10.7, 10.13
Boosting Ryan Tibshirani Data Mining: 36-462/36-662 April 25 2013 Optional reading: ISL 8.2, ESL 10.1 10.4, 10.7, 10.13 1 Reminder: classification trees Suppose that we are given training data (x i, y
More informationLearning Time-Series Shapelets
Learning Time-Series Shapelets Josif Grabocka, Nicolas Schilling, Martin Wistuba and Lars Schmidt-Thieme Information Systems and Machine Learning Lab (ISMLL) University of Hildesheim, Germany SIGKDD 14,
More informationInduction of Decision Trees
Induction of Decision Trees Peter Waiganjo Wagacha This notes are for ICS320 Foundations of Learning and Adaptive Systems Institute of Computer Science University of Nairobi PO Box 30197, 00200 Nairobi.
More informationData Mining Classification: Basic Concepts and Techniques. Lecture Notes for Chapter 3. Introduction to Data Mining, 2nd Edition
Data Mining Classification: Basic Concepts and Techniques Lecture Notes for Chapter 3 by Tan, Steinbach, Karpatne, Kumar 1 Classification: Definition Given a collection of records (training set ) Each
More informationKnowledge Discovery and Data Mining
Knowledge Discovery and Data Mining Lecture 06 - Regression & Decision Trees Tom Kelsey School of Computer Science University of St Andrews http://tom.home.cs.st-andrews.ac.uk twk@st-andrews.ac.uk Tom
More informationData Mining Prof. Pabitra Mitra Department of Computer Science & Engineering Indian Institute of Technology, Kharagpur
Data Mining Prof. Pabitra Mitra Department of Computer Science & Engineering Indian Institute of Technology, Kharagpur Lecture 21 K - Nearest Neighbor V In this lecture we discuss; how do we evaluate the
More informationOliver Dürr. Statistisches Data Mining (StDM) Woche 11. Institut für Datenanalyse und Prozessdesign Zürcher Hochschule für Angewandte Wissenschaften
Statistisches Data Mining (StDM) Woche 11 Oliver Dürr Institut für Datenanalyse und Prozessdesign Zürcher Hochschule für Angewandte Wissenschaften oliver.duerr@zhaw.ch Winterthur, 29 November 2016 1 Multitasking
More informationEnhanced membrane protein topology prediction using a hierarchical classification method and a new scoring function
Enhanced membrane protein topology prediction using a hierarchical classification method and a new scoring function Allan Lo 1, 2, Hua-Sheng Chiu 3, Ting-Yi Sung 3, Ping-Chiang Lyu 2, and Wen-Lian Hsu
More informationSupervised Learning. George Konidaris
Supervised Learning George Konidaris gdk@cs.brown.edu Fall 2017 Machine Learning Subfield of AI concerned with learning from data. Broadly, using: Experience To Improve Performance On Some Task (Tom Mitchell,
More informationSource localization in an ocean waveguide using supervised machine learning
Source localization in an ocean waveguide using supervised machine learning Haiqiang Niu, Emma Reeves, and Peter Gerstoft Scripps Institution of Oceanography, UC San Diego Part I Localization on Noise09
More informationSupport Vector Machine & Its Applications
Support Vector Machine & Its Applications A portion (1/3) of the slides are taken from Prof. Andrew Moore s SVM tutorial at http://www.cs.cmu.edu/~awm/tutorials Mingyue Tan The University of British Columbia
More informationReview of Lecture 1. Across records. Within records. Classification, Clustering, Outlier detection. Associations
Review of Lecture 1 This course is about finding novel actionable patterns in data. We can divide data mining algorithms (and the patterns they find) into five groups Across records Classification, Clustering,
More informationCLUe Training An Introduction to Machine Learning in R with an example from handwritten digit recognition
CLUe Training An Introduction to Machine Learning in R with an example from handwritten digit recognition Ad Feelders Universiteit Utrecht Department of Information and Computing Sciences Algorithmic Data
More informationDecision trees COMS 4771
Decision trees COMS 4771 1. Prediction functions (again) Learning prediction functions IID model for supervised learning: (X 1, Y 1),..., (X n, Y n), (X, Y ) are iid random pairs (i.e., labeled examples).
More informationPublic Database 의이용 (1) - SignalP (version 4.1)
Public Database 의이용 (1) - SignalP (version 4.1) 2015. 8. KIST 이철주 Secretion pathway prediction ProteinCenter (Proxeon Bioinformatics, Odense, Denmark; http://www.cbs.dtu.dk/services) SignalP (version 4.1)
More informationSUPERVISED LEARNING: INTRODUCTION TO CLASSIFICATION
SUPERVISED LEARNING: INTRODUCTION TO CLASSIFICATION 1 Outline Basic terminology Features Training and validation Model selection Error and loss measures Statistical comparison Evaluation measures 2 Terminology
More information1-D Predictions. Prediction of local features: Secondary structure & surface exposure
1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local
More informationUVA CS 4501: Machine Learning
UVA CS 4501: Machine Learning Lecture 21: Decision Tree / Random Forest / Ensemble Dr. Yanjun Qi University of Virginia Department of Computer Science Where are we? è Five major sections of this course
More informationAn Artificial Neural Network Classifier for the Prediction of Protein Structural Classes
International Journal of Current Engineering and Technology E-ISSN 2277 4106, P-ISSN 2347 5161 2017 INPRESSCO, All Rights Reserved Available at http://inpressco.com/category/ijcet Research Article An Artificial
More informationDecision T ree Tree Algorithm Week 4 1
Decision Tree Algorithm Week 4 1 Team Homework Assignment #5 Read pp. 105 117 of the text book. Do Examples 3.1, 3.2, 3.3 and Exercise 3.4 (a). Prepare for the results of the homework assignment. Due date
More information10701/15781 Machine Learning, Spring 2007: Homework 2
070/578 Machine Learning, Spring 2007: Homework 2 Due: Wednesday, February 2, beginning of the class Instructions There are 4 questions on this assignment The second question involves coding Do not attach
More informationThe human transmembrane proteome
Dobson et al. Biology Direct (2015) 10:31 DOI 10.1186/s13062-015-0061-x RESEARCH Open Access The human transmembrane proteome László Dobson, István Reményi and Gábor E. Tusnády * Abstract Background: Transmembrane
More informationSecondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure
Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted
More informationArticle from. Predictive Analytics and Futurism. July 2016 Issue 13
Article from Predictive Analytics and Futurism July 2016 Issue 13 Regression and Classification: A Deeper Look By Jeff Heaton Classification and regression are the two most common forms of models fitted
More informationProtein 8-class Secondary Structure Prediction Using Conditional Neural Fields
2010 IEEE International Conference on Bioinformatics and Biomedicine Protein 8-class Secondary Structure Prediction Using Conditional Neural Fields Zhiyong Wang, Feng Zhao, Jian Peng, Jinbo Xu* Toyota
More informationAccurate Prediction of Protein Disordered Regions by Mining Protein Structure Data
Data Mining and Knowledge Discovery, 11, 213 222, 2005 c 2005 Springer Science + Business Media, Inc. Manufactured in The Netherlands. DOI: 10.1007/s10618-005-0001-y Accurate Prediction of Protein Disordered
More informationComparison of Shannon, Renyi and Tsallis Entropy used in Decision Trees
Comparison of Shannon, Renyi and Tsallis Entropy used in Decision Trees Tomasz Maszczyk and W lodzis law Duch Department of Informatics, Nicolaus Copernicus University Grudzi adzka 5, 87-100 Toruń, Poland
More informationPredictive Analytics on Accident Data Using Rule Based and Discriminative Classifiers
Advances in Computational Sciences and Technology ISSN 0973-6107 Volume 10, Number 3 (2017) pp. 461-469 Research India Publications http://www.ripublication.com Predictive Analytics on Accident Data Using
More informationLecture 2. Judging the Performance of Classifiers. Nitin R. Patel
Lecture 2 Judging the Performance of Classifiers Nitin R. Patel 1 In this note we will examine the question of how to udge the usefulness of a classifier and how to compare different classifiers. Not only
More informationA Deep Convolutional Neural Network for Bioactivity Prediction in Structure-based Drug Discovery
AtomNet A Deep Convolutional Neural Network for Bioactivity Prediction in Structure-based Drug Discovery Izhar Wallach, Michael Dzamba, Abraham Heifets Victor Storchan, Institute for Computational and
More informationK-means-based Feature Learning for Protein Sequence Classification
K-means-based Feature Learning for Protein Sequence Classification Paul Melman and Usman W. Roshan Department of Computer Science, NJIT Newark, NJ, 07102, USA pm462@njit.edu, usman.w.roshan@njit.edu Abstract
More informationLinear Classifiers. Michael Collins. January 18, 2012
Linear Classifiers Michael Collins January 18, 2012 Today s Lecture Binary classification problems Linear classifiers The perceptron algorithm Classification Problems: An Example Goal: build a system that
More informationDecision Tree Learning Lecture 2
Machine Learning Coms-4771 Decision Tree Learning Lecture 2 January 28, 2008 Two Types of Supervised Learning Problems (recap) Feature (input) space X, label (output) space Y. Unknown distribution D over
More informationPrediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines
Article Prediction and Classif ication of Human G-protein Coupled Receptors Based on Support Vector Machines Yun-Fei Wang, Huan Chen, and Yan-Hong Zhou* Hubei Bioinformatics and Molecular Imaging Key Laboratory,
More informationMachine Learning Lecture 7
Course Outline Machine Learning Lecture 7 Fundamentals (2 weeks) Bayes Decision Theory Probability Density Estimation Statistical Learning Theory 23.05.2016 Discriminative Approaches (5 weeks) Linear Discriminant
More informationCombination of M-Estimators and Neural Network Model to Analyze Inside/Outside Bark Tree Diameters
Combination of M-Estimators and Neural Network Model to Analyze Inside/Outside Bark Tree Diameters Kyriaki Kitikidou, Elias Milios, Lazaros Iliadis, and Minas Kaymakis Democritus University of Thrace,
More informationEnsemble learning 11/19/13. The wisdom of the crowds. Chapter 11. Ensemble methods. Ensemble methods
The wisdom of the crowds Ensemble learning Sir Francis Galton discovered in the early 1900s that a collection of educated guesses can add up to very accurate predictions! Chapter 11 The paper in which
More informationProtein structure alignments
Protein structure alignments Proteins that fold in the same way, i.e. have the same fold are often homologs. Structure evolves slower than sequence Sequence is less conserved than structure If BLAST gives
More informationNeural Networks: Backpropagation
Neural Networks: Backpropagation Machine Learning Fall 2017 Based on slides and material from Geoffrey Hinton, Richard Socher, Dan Roth, Yoav Goldberg, Shai Shalev-Shwartz and Shai Ben-David, and others
More informationIdentification of Representative Protein Sequence and Secondary Structure Prediction Using SVM Approach
Identification of Representative Protein Sequence and Secondary Structure Prediction Using SVM Approach Prof. Dr. M. A. Mottalib, Md. Rahat Hossain Department of Computer Science and Information Technology
More informationSymbolic methods in TC: Decision Trees
Symbolic methods in TC: Decision Trees ML for NLP Lecturer: Kevin Koidl Assist. Lecturer Alfredo Maldonado https://www.cs.tcd.ie/kevin.koidl/cs0/ kevin.koidl@scss.tcd.ie, maldonaa@tcd.ie 01-017 A symbolic
More informationAnalysis of N-terminal Acetylation data with Kernel-Based Clustering
Analysis of N-terminal Acetylation data with Kernel-Based Clustering Ying Liu Department of Computational Biology, School of Medicine University of Pittsburgh yil43@pitt.edu 1 Introduction N-terminal acetylation
More informationSCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like
SCOP all-β class 4-helical cytokines T4 endonuclease V all-α class, 3 different folds Globin-like TIM-barrel fold α/β class Profilin-like fold α+β class http://scop.mrc-lmb.cam.ac.uk/scop CATH Class, Architecture,
More informationThe TOPCONS webserver for consensus prediction of membrane protein topology and signal peptides
The TOPCONS webserver f consensus prediction of membrane protein topology and signal peptides Konstantinos D. Tsirigos 1,2, Christoph Peters 1,2, Nanjiang Shu 1,2,3, Lukas Käll 1,2 and Arne Elofsson 1,2,*
More informationIntroduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple
More information.. Cal Poly CSC 466: Knowledge Discovery from Data Alexander Dekhtyar.. for each element of the dataset we are given its class label.
.. Cal Poly CSC 466: Knowledge Discovery from Data Alexander Dekhtyar.. Data Mining: Classification/Supervised Learning Definitions Data. Consider a set A = {A 1,...,A n } of attributes, and an additional
More informationIMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS
IMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS Aslı Filiz 1, Eser Aygün 2, Özlem Keskin 3 and Zehra Cataltepe 2 1 Informatics Institute and 2 Computer Engineering Department,
More informationECE521 Lectures 9 Fully Connected Neural Networks
ECE521 Lectures 9 Fully Connected Neural Networks Outline Multi-class classification Learning multi-layer neural networks 2 Measuring distance in probability space We learnt that the squared L2 distance
More informationBayesian Hierarchical Classification. Seminar on Predicting Structured Data Jukka Kohonen
Bayesian Hierarchical Classification Seminar on Predicting Structured Data Jukka Kohonen 17.4.2008 Overview Intro: The task of hierarchical gene annotation Approach I: SVM/Bayes hybrid Barutcuoglu et al:
More informationA Discriminatively Trained, Multiscale, Deformable Part Model
A Discriminatively Trained, Multiscale, Deformable Part Model P. Felzenszwalb, D. McAllester, and D. Ramanan Edward Hsiao 16-721 Learning Based Methods in Vision February 16, 2009 Images taken from P.
More informationDay 3: Classification, logistic regression
Day 3: Classification, logistic regression Introduction to Machine Learning Summer School June 18, 2018 - June 29, 2018, Chicago Instructor: Suriya Gunasekar, TTI Chicago 20 June 2018 Topics so far Supervised
More informationSupport Vector Machines. Machine Learning Fall 2017
Support Vector Machines Machine Learning Fall 2017 1 Where are we? Learning algorithms Decision Trees Perceptron AdaBoost 2 Where are we? Learning algorithms Decision Trees Perceptron AdaBoost Produce
More informationStat 502X Exam 2 Spring 2014
Stat 502X Exam 2 Spring 2014 I have neither given nor received unauthorized assistance on this exam. Name Signed Date Name Printed This exam consists of 12 parts. I'll score it at 10 points per problem/part
More informationHarrison B. Prosper. Bari Lectures
Harrison B. Prosper Florida State University Bari Lectures 30, 31 May, 1 June 2016 Lectures on Multivariate Methods Harrison B. Prosper Bari, 2016 1 h Lecture 1 h Introduction h Classification h Grid Searches
More informationImproving Protein Secondary-Structure Prediction by Predicting Ends of Secondary-Structure Segments
Improving Protein Secondary-Structure Prediction by Predicting Ends of Secondary-Structure Segments Uros Midic 1 A. Keith Dunker 2 Zoran Obradovic 1* 1 Center for Information Science and Technology Temple
More informationHierarchical models for the rainfall forecast DATA MINING APPROACH
Hierarchical models for the rainfall forecast DATA MINING APPROACH Thanh-Nghi Do dtnghi@cit.ctu.edu.vn June - 2014 Introduction Problem large scale GCM small scale models Aim Statistical downscaling local
More informationPredictors (of secondary structure) based on Machine Learning tools
Predictors (of secondary structure) based on Machine Learning tools Predictors of secondary structure 1 Generation methods: propensity of each residue to be in a given conformation Chou-Fasman 2 Generation
More informationPROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES
PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES Eser Aygün 1, Caner Kömürlü 2, Zafer Aydin 3 and Zehra Çataltepe 1 1 Computer Engineering Department and 2
More informationMachine Learning Recitation 8 Oct 21, Oznur Tastan
Machine Learning 10601 Recitation 8 Oct 21, 2009 Oznur Tastan Outline Tree representation Brief information theory Learning decision trees Bagging Random forests Decision trees Non linear classifier Easy
More informationMachine Learning & Data Mining
Group M L D Machine Learning M & Data Mining Chapter 7 Decision Trees Xin-Shun Xu @ SDU School of Computer Science and Technology, Shandong University Top 10 Algorithm in DM #1: C4.5 #2: K-Means #3: SVM
More informationMachine Learning: Chenhao Tan University of Colorado Boulder LECTURE 9
Machine Learning: Chenhao Tan University of Colorado Boulder LECTURE 9 Slides adapted from Jordan Boyd-Graber Machine Learning: Chenhao Tan Boulder 1 of 39 Recap Supervised learning Previously: KNN, naïve
More informationMultivariate Methods in Statistical Data Analysis
Multivariate Methods in Statistical Data Analysis Web-Site: http://tmva.sourceforge.net/ See also: "TMVA - Toolkit for Multivariate Data Analysis, A. Hoecker, P. Speckmayer, J. Stelzer, J. Therhaag, E.
More informationProtein Secondary Structure Prediction
Protein Secondary Structure Prediction Doug Brutlag & Scott C. Schmidler Overview Goals and problem definition Existing approaches Classic methods Recent successful approaches Evaluating prediction algorithms
More informationProtein Secondary Structure Prediction using Feed-Forward Neural Network
COPYRIGHT 2010 JCIT, ISSN 2078-5828 (PRINT), ISSN 2218-5224 (ONLINE), VOLUME 01, ISSUE 01, MANUSCRIPT CODE: 100713 Protein Secondary Structure Prediction using Feed-Forward Neural Network M. A. Mottalib,
More informationLogistic Regression. COMP 527 Danushka Bollegala
Logistic Regression COMP 527 Danushka Bollegala Binary Classification Given an instance x we must classify it to either positive (1) or negative (0) class We can use {1,-1} instead of {1,0} but we will
More informationMidterm: CS 6375 Spring 2015 Solutions
Midterm: CS 6375 Spring 2015 Solutions The exam is closed book. You are allowed a one-page cheat sheet. Answer the questions in the spaces provided on the question sheets. If you run out of room for an
More information