SUPPLEMENTARY INFORMATION
|
|
- Noah Ramsey
- 5 years ago
- Views:
Transcription
1 DOI:./nc In the formt provie y the uthors n uneite. c common fish/humn ncestor teleost WGD Trnsmemrne region PAPPA ppp ppp ASTN stn stn myl-rt* myl-rt* Serine/Threonine-Rich C-terminl omin ZEBRAFISH AVLGIAFGGFLIGVLLTGALWFIKIRTGHPVALGMRSTAAELSVLSISGCPCGLTKRQPV--PTHPSPSENSSANASIGSTQSTP--TSSMA HUMAN AVLGITFGAFLIGALLTAALWYIYSHT RSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA ** ** * * * ** ** * ** ** * ** DBC c c AK k k GPSM gpsm gpsm humn Chr.q- zerfish prlog Chr..-. M zerfish prlog Chr..-. M PDZ-ining motif zerfish tgfr frog tgfr stickleck tgfr fugu tgfr lizr tgfr chicken TGFBR mouse zer finch humn Tgfr TGFBR TGFBR Tgfrs mek tgfr stickleck fugu mek humn zerfish Enoglins opossum zer finch mouse Eng Xenopus / um DMSO BCA PCS PCS PHBC BA PHBC DMSO CtAs DMSO DMSO e / PCS PHBC CtAs um Nifeipine BCA PCS BA PHBC Nifeipine Nifeipine Nifeipine Supplementry Figure Ientifiction of zerfish enoglin orthologue. () Schemtic representtion of the enoglin locus showing conservtion of gene orer (synteny) etween humn chromosome q- n two prlogous loci on zerfish chromosome contining the Pregnncy-ssocite plsm protein A (ppp), Astrotctin (stn), retrotrnspose Atril myosin light chin (myl-rt), Delete in ler cncer (c), enoglin (), enylte kinse (k) n G-protein signling moultor (gpsm) genes. Prlogous genes tht were likely uplicte uring the teleost whole genome upliction (WGD) event re inicte in lue. Susequent gene loss on the prlogous chromosomes (lost genes in grey) most likely resulte in the current gene orer. Pink shing inictes smll synteny lock contining the Enoglin n AK genes. Dshe lines inicte synteny reks etween humn n zerfish. () Alignment of the conserve C-terminl region of zerfish n humn Enoglin. Asterisks inicte conserve resiues. (c) Phylogenetic tree se on the lignment of the C-terminl sequences (trnsmemrne region n C-terminl omin) of verterte Tgfr (green shing) n Enoglin (re shing). Numers t rnchpoints represent ootstrp vlues (percentge out of replictes). () Whole-mount in situ hyriiztion of shows vsculrrestricte expression in hpf zerfish emryos. Expression is etecte in the sl communicting rtery (BCA), the posterior communicting segments (PCS), silr rtery (BA), primoril hinrin chnnels (PHBC) n centrl rteries (CtAs) of the hinrin s well s the orsl ort (, rrows), posterior crinl vein () n orsl longituinl nstomotic vessel (DLAV, rrowhes) of the trunk vsculture. Scle r in overview picture is um, in high mgnifiction imges scle r is um. Imges re representtive of out of emryos. (e) Whole-mount in situ hyriiztion of expression in WT emryos trete with um nifeipine from - hpf. Note tht loo flow reuction oes not ffect hinrin expression, ut ecreses mrna levels in the DLAV (rrowhes). Scle r in overview picture is um, in high mgnifiction imges scle r is um. Imges re representtive of out of emryos. Mcmilln Pulishers Limite, prt of Springer Nture. All rights reserve.
2 qpcr * rteril ECs venous ECs Fol chnge WT mu hpf WT mrna mu mu +/+ +/+ / / +/- +/- / / -/- -/- / / Supplementry Figure mrna is suject to nonsense-meite ecy in mu mutnts. () qpcr to etect zerfish in FACSsorte rteril n venous ECs from poole hpf emryos. Dt is shown s reltive expression normlize to WT rteril EC levels. In WTs, trnscript cn e etecte t similr levels in the rteril n venous popultions, n is lmost non-etectle in mu mutnt ECs. Experiments were performe n= times inepenently n were nlyse y pire Stuent s t-test. () Whole-mount in situ hyriiztion for enoglin expression t hpf in emryos from WT, mu n mu heterozygous incrosses. All emryos crrying mu lleles (which contin nt sustitution tht oes not introuce frmeshift) show the sme stining intensity s WT, with prticulrly strong expression in the (rrowhe). mu +/- emryos lrey show ecrese stining, which isppers lmost entirely from the he n trunk vsculture in mu mutnts (rrows). Scle r is um. Imges re representtive of the numer of emryos s inicte in the respective pnel. n.s., not significnt, *P<., **P<., P<., error rs inicte s.e.m. Mcmilln Pulishers Limite, prt of Springer Nture. All rights reserve.
3 wiltype mu Tg(krl:EGFP) s merge pf pf Tg(gt:DsRe) s c e n.s. f % of totl ISVs ISVs visvs ISVs with RBCs Remoelle ISVs Arteril ISVs Venous ISVs n.s. n.s. sis mu sis mu sis mu sis mu % of totl ISVs % of totl ISVs % of totl ISVs Supplementry Figure ISV remoelling in WT n mu pf juveniles. (, ) Mximum intensity projections of confocl z-stcks of pf WT () n mu mutnts (). Yellow rrowhes point to remoelle ISVs tht no longer mintin connection to the DLAV. Scle r is um. (c-f) Quntifiction of ISV ientity (c), visv ientity (), ISVs contining DsRe+ erythrocytes (e) n remoelle ISVs (f). WTs n mu mutnts hve no ifference in ISV istriution or presence of RBCs, ut mu mutnts show increse remoelling (n= silings ( ISVs nlyse) n n= muts ( ISVs nlyse)). Anlyse y unpire Stuent s t-test. n.s., not significnt, *P<., **P<., P<., error rs inicte s.e.m. Mcmilln Pulishers Limite, prt of Springer Nture. All rights reserve.
4 WT % ISVs/segment n= ISVs mu % ISVs/segment n= ISVs % visvs/segment n= ISVs % visvs/segment n= ISVs c Tg(krl:Hs.HRAS-mCherry) s ; Tg(fli:-GFP) mu % unresolve ISVs/segment mu n= ISVs GFP negtive GFP positive % unresolve ISVs/segment Dimeter (um) e n= ISVs imeter mu mu + Tg(fli:-GFP) mu imeter n.s. (p=.) f mu % ISVs with RBC flow/segment n= ISVs mu + Tg(fli:-GFP) mu rescue construct Dimeter (um) mu mu + Tg(fli:-GFP) mu Supplementry Figure Arteril-venous specifiction is unffecte in enoglin mutnts. (, ) Arteril-venous ientity of ISVs s etermine y flow irection n/or morphology (connection to or ) in WTs n mu mutnts. WTs n mutnts hve similr istriution of rteries n veins, with slight increse in the numer of unresolve ISV connections in mu mutnts. Inicte numers of ISVs from WT n mut emryos were nlyse. (c) Mximum intensity projection of confocl z-stck of mu mutnts t hpf. Tg(fli:-GFP) mu emryos exhiit vsculr-specific GFP expression, evience y overlp with Tg(krl:Hs. HRAS-mCherry) s. Scle r is um. (, e) Quntifiction of () n (e) imeters in mu mutnts with or without the Tg(fli:- GFP) mu rescue construct. Tgge enoglin-gfp moestly rescues, ut not imeters (n= GFP-negtive, n= GFP-positive mu mutnts). Anlyse y unpire Stuent s t-test. (f) Quntifiction of the numer of ISVs ctively crrying RBCs shows rescue in mu emryos crrying the Tg(fli:-GFP) mu rescue construct. ISVs from GFP-positive mu mut emryos were nlyse. n.s., not significnt, *P<., **P<., P<., error rs inicte s.e.m. Mcmilln Pulishers Limite, prt of Springer Nture. All rights reserve.
5 ATG klf promoter Tg(krl:Hs.HRAS-mCherry) s ; Tg(klf:YFP) mu Tg(klf:YFP) mu hpf citrine pa knr CH-A ~ k ng ctr MO c ng tnnt MO Fluorescence intensity (.u.) intensity * e Fluorescence intensity (.u.) intensity ** f Fluorescence intensity (.u.) ISV intensity n.s. (p=.) ctr MO tnnt MO ctr MO tnnt MO ctr MO tnnt MO Supplementry Figure Genertion of the Tg(klf:YFP) mu reporter line. () Schemtic of the cloning strtegy. A Citrine cssette ws inserte ehin the enogenous ATG of the klf gene contine in the CH-A BAC y homologous recomintion. (, c) Tg(klf:YFP) mu emryos isply vsculr-specific YFP expression, evience y overlp with Tg(krl:Hs. HRAS-mCherry) s. Emryos trete with tnnt MO lose YFP expression in the n. Scle r is um. (-f) Quntifiction of YFP fluorescence intensity in the, n ISVs in ctr MO n tnnt MO injecte emryos (/: n= control MO, n= tnnt MO; ISVs: n= ISVs from control MO, n= ISVs from tnnt MO). Anlyse y Mnn-Whitney U test. n.s., not significnt, *P<., **P<., P<., error rs inicte s.e.m. Mcmilln Pulishers Limite, prt of Springer Nture. All rights reserve.
6 S U P P L E M E N TA R Y I N F O R M AT I O N Mosic vessels Host Overly WT --> WT Donor Lumen x-section WT -> WT n.s. (p=.) Dimeter (um) * Mut --> WT e Donor Mosic Mut -> WT n.s. (p=.) Dimeter (um) WT --> Mut c f Host Donor ** mu EC WT EC mu lumen Mosic lumen Dimeter (um) ISV lumen size Mosic WT -> Mut g WT lumen Host Host Donor Mosic (), while mutnt cells cuse iltion Sugen etnorml l.,imeters Supplementry Fig.whenthey forme prt or ll of the lumen in Mut->WT situtions (e). WT cells were le to reuce Supplementry Figure Trnsplnttion nlysis of mosic ISVs. (-c) Mximum intensity projections of confocl z-stck of mosic ISVs from () WT->WT, () Mut->WT n (c) WT->Mut trnsplnttions. Opticl sections revel portions of lumen comprise only of onor cells, only of host cells, or mosic comintion of host n onor cells. Scle r on overview is um, scle r on lumen cross-section is um. (-f) Quntifiction of mosic ISV imeters epening on cellulr composition from () WT->WT, (e) Mut->WT n (f) WT->Mut trnsplnttions. All ISVs from WT->WT trnsplnttions h ISV imeter when they forme ll of the lumen in WT->Mut scenrios (f). (WT>WT n= vessel segments from ISVs; Mut->WT n= vessel segments from ISVs; WT->Mut n= vessel segments from ISVs). Anlyse y One-Wy ANOVA. (g) Schemtic summrizing the requirement for function in every cell of vsculr tue to mintin proper imensions. n.s., not significnt, *P<., **P<., P<., error rs inicte s.e.m. Mcmilln Pulishers Limite, prt of Springer Nture. All rights reserve.
7 Moel c hpf cpillry flow wek hpf cpillry flow strong WT No hpf Growth n flow-inuce outwr remoelling flow-inuce EC cell shpe chnges EC res constnt F pressure No increse in EC re sher stress F cpillry flow wek EC res increse impire cell shpe chnges -/- Sugen et l., Supplementry Fig. Supplementry Figure Moel for enoglin s role in the iphsic response of ECs to loo flow. () By hpf, the first rtery n vein hve ssemle y vsculogenesis. Bloo flow strts. () As evelopment procees, cric output rises. The xil vessels increse in imeter n crry n incresing volume of loo. At hpf, the cpillries connecting the rtery n vein hve just egun to lumenize n crry flow. (c) Between n hpf, loo flow triggers shpe chnges in WT ECs. They elongte n lign in the irection of flow, without chnging their surfce res. This lthens the vessel n reuces its imeter. The rteril constriction reirects loo flow through the cpillry network. () In -eficient loo vessels, ECs re unle to limit their surfce res in response to loo flow. Although elongtion still occurs to some extent, the increse in size impees the ility of ECs to lign to the flow. Ultimtely, this results in vessel iltion n the formtion of n rterio-venous shunt. The high velocities chieve in the shunt prevent RBCs from pssing into cpillries, n the pulstile qulity of rteril flow is trnsmitte to the venous return. Mcmilln Pulishers Limite, prt of Springer Nture. All rights reserve.
8 Originl lot scns use in Figure e α-tuulin Neg-si -si -si Supplementry Figure Originl scnne lots use in Figure e. Mcmilln Pulishers Limite, prt of Springer Nture. All rights reserve.
9 Supplementry Movie Legens Supplementry Movie Distl loo flow in WT fin regenerte t p. Brightfiel movie of loo flow in the istl regenerting fin of WT fish t p. Numers lel iniviul ony rys. Arrows inicte flow irection, while she lines enote rteries (re) n veins (lue). from centrlly locte rtery istriutes through plexus to two veins t the en of ech ry. Note wek flow reversl in lterl vein of the first ry, rcing over n inctive rtery. Supplementry Movie AVMs n isture flow in mu fin regenerte t p. Brightfiel movie of loo flow in the istl regenerting fin of mu mutnt t p. Numers lel iniviul ony rys. Arrows inicte flow irection, while she lines enote rteries (re) n veins (lue). Note prominent AVMs in secon ry from the left. In ry #, more proximlly locte AVMs either stop or reverse loo flow in the veins, n the centrl rtery is not ctive. Ry # hs strong flow reversl in the left vein, rcing over n inctive centrl rtery. Note leeings t istl en of ll rys. Supplementry Movie ISV flow in hpf siling emryo. Brightfiel movie of RBC flow in the trunk of siling emryo t hpf. Nerly ll ISVs on oth sies of the emryo crry RBC flow. Supplementry Movie ISV flow in hpf mu emryo. Brightfiel movie of RBC flow in the trunk of mu emryo t hpf. Note tht only or ISVs hve persistent RBC flow, while most hve no or only very intermittent RBC flow. Supplementry Movie Opticl ril restores RBC flow in cpillries of mu mutnts. Brightfiel movie of RBC flow in the trunk of mu emryo t hpf. Hologrphic opticl tweezers (HOT) re focuse t entrnce to n ISV, ut lser is turne off. Aout hlfwy through movie the lser is turne on (re circle inictes HOT focl point), slows own RBCs tht pss through the lser, n iverts them from the min rteril loo flow into the cpillry. Supplementry Movie Time-lpse of cell shpe chnges in etween - hpf in siling emryo. Mximum intensity projection of confocl z-stcks of Tg(fli:lifectEGFP) mu ; Tg(fli:nEGFP) y, n Tg(-.flt:RFP) hu in siling emryo etween - hpf. Acquisitions were me t min intervls, shown t frmes per secon. Note ecrese in imeter etween - hpf, n elongtion of ECs. Supplementry Movie Time-lpse of cell shpe chnges in etween - hpf in mu emryo. Mximum intensity projection of confocl z-stcks of Tg(fli:lifectEGFP) mu ; Tg(fli:nEGFP) y, n Tg(-.flt:RFP) hu in mu emryo etween - hpf. Acquisitions were me t min intervls, shown t frmes per secon. Note similr imeter t hpf s siling in Supplementry Movie tht fils to ecrese pprecily y hpf. Note, itionlly, the rmtic increse in EC sizes compre to silings uring the movie. Mcmilln Pulishers Limite, prt of Springer Nture. All rights reserve.
Supporting Information. Cytosolic Irradiation of Femtosecond Laser Induces Mitochondria-dependent Apoptosis-like
Supporting Informtion Cytosolic Irrdition of Femtosecond Lser Induces Mitochondri-dependent Apoptosis-like Cell Deth vi Intrinsic Rective Oxygen Cscdes Jonghee Yoon 1,2, Seung-wook Ryu 1,3, Seunghee Lee
More informationa cacnb1 ts25/ts25 Supplemental Figure 1
ccn1 ts/ts α -ungrotoxin prlyzed 0.6 ΔF/F 0.0 2 ΔF/F 2 s stimulus α -ungrotoxin ccn1 ts/ts Supplementl Figure 1 CSF-cNs recorded from lrv prlyzed with α-ungrotoxin nd ccn1 mutnt lrv show no difference
More informationControllable Microfluidic Production of Multicomponent Multiple Emulsions
Supplementry Mteril (ESI) or L on Chip This journl is The Royl Society o Chemistry 0 Controllle Microluiic Prouction o Multicomponent Multiple Emulsions Supplementry Mteril Wei Wng, Rui Xie *, Xio-Jie
More informationSUPPLEMENTARY INFORMATION
DOI: 1.138/nc2975 GM13 / DNA F-ctin α shrna CLASP1 shrna shrna shrna CLASP1 shrna shrna e Tuulin CLASP1 CLASP1 shrna #32 shrna #33 #55 #58 Tuulin c Tuulin ppmlc E-Cdherin shrna CLASP1 shrna shrna f Golgi
More informationDOI:.8/nc5 Cpilities of MCAK Sidesliding, endctching on microtuules MCAKdecorted ed Functions in mitotic spindle Prometphse Slides on the microtuule surfce + Redily slides long the microtuule surfce Strongly
More informationsupplementary information
DOI: 1.138/nc8 Top-GFP!-ctenin GFP Intensity 3 1 1 3 5 6 7 8 Nucler Bet-Ctenin c MUC FABP KRT 8 5 3 6 15 1 5 LGR5 ASCL AXIN 15 5 15 5 Figure S1 TOP-GFP expression nd reltion with nucler β-ctenin, wnt trgets
More informationSituation Calculus. Situation Calculus Building Blocks. Sheila McIlraith, CSC384, University of Toronto, Winter Situations Fluents Actions
Plnning gent: single gent or multi-gent Stte: complete or Incomplete (logicl/probbilistic) stte of the worl n/or gent s stte of knowlege ctions: worl-ltering n/or knowlege-ltering (e.g. sensing) eterministic
More informationSUPPLEMENTARY INFORMATION
VOLUME: ARTICLE NUMBER: 3 In the formt provided y the uthors nd unedited. Developmentl constrints shpe the evolution of the nemtode mid-developmentl trnsition Hrel Zlts nd Iti Yni,3 Fculty of Biology,
More informationPhysics Lecture 14: MON 29 SEP
Physics 2113 Physics 2113 Lecture 14: MON 29 SEP CH25: Cpcitnce Von Kleist ws le to store electricity in the jr. Unknowingly, he h ctully invente novel evice to store potentil ifference. The wter in the
More informationSUPPLEMENTARY INFORMATION
doi:1.138/nture11444 CMKIIN Gold prticles/ mitochondril re ( m ) 4 3 1 CMKIIN mtcmkiin mtcmkiin SERCA ATP synthse HA mitoplsts mtcmkiin CMKIIN cytosolic mtcmkiin CMKIIN 97 kdl 64 kdl 51 kdl 14 kdl 6 kdl
More informationLect 11: Inbreeding, evolution at multiple loci. Exam 1, Monday, 2 October. Consequences of Inbreeding: Genotype frequencies
Lect 11: Inreeding, evolution t multiple loci Exm 1, Mondy, 2 Octoer Non-rndom mting-- Inreeding evolutionry consequences Synthesis: drift-migrtion: popultion structure Popultion genetics of pririe chickens
More informationVertical uniformity of cells and nuclei in epithelial monolayers
Supplementry informtion Verticl uniformity of cells nd nuclei in epithelil monolyers Srujn Neelm b, Peter Hyes, Qio Zhng, Richrd B. Dickinson nd Tnmy P. Lele, Figure S1. Histogrm plots compre the frequency
More informationLast Time emphasis on E-field. Potential of spherical conductor. Quick quiz. Connected spheres. Varying E-fields on conductor.
Lst Time emphsis on Efiel Electric flux through surfce Guss lw: Totl electric flux through close surfce proportionl to chrge enclose Q " E = E = 4$k e Q % o Chrge istribution on conuctors Chrge ccumultes
More informationSUPPLEMENTARY NOTES ON THE CONNECTION FORMULAE FOR THE SEMICLASSICAL APPROXIMATION
Physics 8.06 Apr, 2008 SUPPLEMENTARY NOTES ON THE CONNECTION FORMULAE FOR THE SEMICLASSICAL APPROXIMATION c R. L. Jffe 2002 The WKB connection formuls llow one to continue semiclssicl solutions from n
More informationConservation Law. Chapter Goal. 6.2 Theory
Chpter 6 Conservtion Lw 6.1 Gol Our long term gol is to unerstn how mthemticl moels re erive. Here, we will stuy how certin quntity chnges with time in given region (sptil omin). We then first erive the
More informationSUPPLEMENTARY INFORMATION
DOI:.38/n3343 DIC/Ht Ht DAPI Anphse/Telophse (% of ells) 6 1 18 Time from HU relese (min) untrete Nsg1-GFP Myo1-mCherry -4-4 6 8 untrete HU pulse 5 15 Onset of ring ontrtion to NE segregtion (min) untrete
More informationTremor-rich shallow dyke formation followed by silent magma flow at Bárðarbunga in Iceland
In the formt provided y the uthors nd unedited. SUPPLEMENTARY INFORMATION DOI: 1.138/NGEO9 Tremor-rich shllow dyke formtion followed y silent mgm flow t Bárðrung in Icelnd 1,, 1, 3 1, 1 1, NATURE GEOSCIENCE
More information7.1 Integral as Net Change and 7.2 Areas in the Plane Calculus
7.1 Integrl s Net Chnge nd 7. Ares in the Plne Clculus 7.1 INTEGRAL AS NET CHANGE Notecrds from 7.1: Displcement vs Totl Distnce, Integrl s Net Chnge We hve lredy seen how the position of n oject cn e
More informationCh. 24 Molecular Reaction Dynamics 1. Collision Theory 2. Diffusion-Controlled Reaction
Ch. 4 Moleculr Rection Dynmics 1. Collision Theory. Diffusion-Controlle Rection Lecture 17 3. The Mteril Blnce Eqution 4. Trnsition Stte Theory: The Eyring Eqution 5. Trnsition Stte Theory: Thermoynmic
More informationMidterm#1 comments. Overview- chapter 6. Recombination. Recombination 1 st sense
Midterm#1 comments So fr, ~ 10% of exms grded, wide rnge of results: 1 perfect score, 1 score < 100pts rtil credit is given if you get prt of the nswer right Tests will e returned next Thursdy Some of
More informationMath 211A Homework. Edward Burkard. = tan (2x + z)
Mth A Homework Ewr Burkr Eercises 5-C Eercise 8 Show tht the utonomous system: 5 Plne Autonomous Systems = e sin 3y + sin cos + e z, y = sin ( + 3y, z = tn ( + z hs n unstble criticl point t = y = z =
More informationSet 6 Paper 2. Set 6 Paper 2. 1 Pearson Education Asia Limited 2017
Set 6 Pper Set 6 Pper. C. C. A. D. B 6. D 7. D 8. A 9. D 0. A. B. B. A. B. B 6. B 7. D 8. C 9. D 0. D. A. A. B. B. C 6. C 7. A 8. B 9. A 0. A. C. D. B. B. B 6. A 7. D 8. A 9. C 0. C. C. D. C. C. D Section
More informationBME 207 Introduction to Biomechanics Spring 2018
April 6, 28 UNIVERSITY O RHODE ISAND Deprtment of Electricl, Computer nd Biomedicl Engineering BME 27 Introduction to Biomechnics Spring 28 Homework 8 Prolem 14.6 in the textook. In ddition to prts -e,
More informationSUPPLEMENTARY INFORMATION
doi:.38/nture8499 doi:.38/nture8499 5 6 5 4.5 Firing rte (Hz) -67-65 -66-6 -58 V m (mv) -7-67 -68-66 -64 c Thet power (mv ) -73-69 -7-7 -7.5.8 3....9.9.4.6.6. 9 8 9 8 9 8 9 8 9 8 Supplementry Figure Firing
More informationHere we consider the matrix transformation for a square matrix from a geometric point of view.
Section. he Mgnifiction Fctor In Section.5 we iscusse the mtri trnsformtion etermine mtri A. For n m n mtri A the function f(c) = Ac provies corresponence etween vectors in R n n R m. Here we consier the
More informationVersion 001 HW#6 - Electromagnetic Induction arts (00224) 1 3 T
Version 001 HW#6 - lectromgnetic Induction rts (00224) 1 This print-out should hve 12 questions. Multiple-choice questions my continue on the next column or pge find ll choices efore nswering. AP 1998
More informationSUPPLEMENTARY INFORMATION
SULEMENTARY INORMATION doi:1.138/nture1394 Trnsduced Mcrophges 293T-Nip trnsfectnts NAI2 N2 N5 5 Blot: Nip2 Blot: Nip5 N1 lg N6 5 c Blot: lg Blot: Nip6 Wild-type Legionell infection: fla Legionell infection:
More informationHaplotype Frequencies and Linkage Disequilibrium. Biostatistics 666
Hlotye Frequencies nd Linkge isequilirium iosttistics 666 Lst Lecture Genotye Frequencies llele Frequencies Phenotyes nd Penetrnces Hrdy-Weinerg Equilirium Simle demonstrtion Exercise: NO2 nd owel isese
More informationDiverse modes of eco-evolutionary dynamics in communities of antibiotic-producing microorganisms
In the formt provided y the uthors nd unedited. ULEMENTAY INFOMATION VOLUME: 1 ATICLE NUMBE: 0189 iverse modes of eco-evolutionry dynmics in communities of ntiiotic-producing microorgnisms Klin Vetsigin
More information4.5 THE FUNDAMENTAL THEOREM OF CALCULUS
4.5 The Funmentl Theorem of Clculus Contemporry Clculus 4.5 THE FUNDAMENTAL THEOREM OF CALCULUS This section contins the most importnt n most use theorem of clculus, THE Funmentl Theorem of Clculus. Discovere
More informationPH 102 Exam I Solutions
PH 102 Exm I Solutions 1. Three ienticl chrges of = 5.0 µc lie long circle of rius 2.0 m t ngles of 30, 150, n 270 s shown below. Wht is the resultnt electric fiel t the center of the circle? By symmetry,
More informationPhysics 202, Lecture 14
Physics 202, Lecture 14 Tody s Topics Sources of the Mgnetic Field (Ch. 28) Biot-Svrt Lw Ampere s Lw Mgnetism in Mtter Mxwell s Equtions Homework #7: due Tues 3/11 t 11 PM (4th problem optionl) Mgnetic
More informationSupplementary Figure 1
Supplementry Figure (nesthetized) (wke) Normlized mplitude.5 Pek width (ms).6.4.2 4 2 2 x 3 Wveform slope Normlized mplitude.5 Pek width (ms).6.4.2 x 3 3 2 Wveform slope c (nesthetized) d (wke) Normlized
More informationSection 6: Area, Volume, and Average Value
Chpter The Integrl Applied Clculus Section 6: Are, Volume, nd Averge Vlue Are We hve lredy used integrls to find the re etween the grph of function nd the horizontl xis. Integrls cn lso e used to find
More informationA, Electromagnetic Fields Final Exam December 14, 2001 Solution
304-351, Electrognetic Fiels Finl Ex Deceer 14, 2001 Solution 1. e9.8. In chpter9.proles.extr.two loops, e of thin wire crry equl n opposite currents s shown in the figure elow. The rius of ech loop is
More informationSupplementary figure 1
Supplementry figure 1 Igf 1 mrna 5 15 1 5 Arg1 mrna 16 1 8 Col11 mrna 5 3 1 Mmp 13 mrna 15 1 5 Tslp mrna 3 1 Il5 mrna 3 1-1 Il33 mrna 6 Figure 1s. Kinetis of woun heling ftors n erly Th-type response ytokines
More informationD. Harel, Statecharts: A visual formalism for complex systems, Science of Computer Programming 8, 1987, pp
Sttechrts y Kenr ooper ontents Introuction Stte igrms epth (hierrchy) Orthogonlity (concurrency) rocst ommuniction Exmple Prolems Introuction Sttechrts were introuce y vi Hrel in 1987. Hrel, Sttechrts:
More informationTopics Covered AP Calculus AB
Topics Covered AP Clculus AB ) Elementry Functions ) Properties of Functions i) A function f is defined s set of ll ordered pirs (, y), such tht for ech element, there corresponds ectly one element y.
More informationIf we have a function f(x) which is well-defined for some a x b, its integral over those two values is defined as
Y. D. Chong (26) MH28: Complex Methos for the Sciences 2. Integrls If we hve function f(x) which is well-efine for some x, its integrl over those two vlues is efine s N ( ) f(x) = lim x f(x n ) where x
More informationImproper Integrals. Introduction. Type 1: Improper Integrals on Infinite Intervals. When we defined the definite integral.
Improper Integrls Introduction When we defined the definite integrl f d we ssumed tht f ws continuous on [, ] where [, ] ws finite, closed intervl There re t lest two wys this definition cn fil to e stisfied:
More informationPhysics 2135 Exam 3 April 21, 2015
Em Totl hysics 2135 Em 3 April 21, 2015 Key rinted Nme: 200 / 200 N/A Rec. Sec. Letter: Five multiple choice questions, 8 points ech. Choose the best or most nerly correct nswer. 1. C Two long stright
More information2.4 Linear Inequalities and Interval Notation
.4 Liner Inequlities nd Intervl Nottion We wnt to solve equtions tht hve n inequlity symol insted of n equl sign. There re four inequlity symols tht we will look t: Less thn , Less thn or
More informationHomework Assignment 5 Solution Set
Homework Assignment 5 Solution Set PHYCS 44 3 Februry, 4 Problem Griffiths 3.8 The first imge chrge gurntees potentil of zero on the surfce. The secon imge chrge won t chnge the contribution to the potentil
More informationTransient Stimulation of Distinct Subpopulations of Striatal Neurons Mimics Changes in the Value of Competing Actions
Supplementl mterils for: Trnsient Stimultion of Distinct Supopultions of Stritl Neurons Mimics Chnges in the Vlue of Competing Actions Lung-Ho Ti, A. Moses Lee,2, Nor Benvidez 3, Antonello Bonci 4,,6,
More informationu( t) + K 2 ( ) = 1 t > 0 Analyzing Damped Oscillations Problem (Meador, example 2-18, pp 44-48): Determine the equation of the following graph.
nlyzing Dmped Oscilltions Prolem (Medor, exmple 2-18, pp 44-48): Determine the eqution of the following grph. The eqution is ssumed to e of the following form f ( t) = K 1 u( t) + K 2 e!"t sin (#t + $
More informationBasic Derivative Properties
Bsic Derivtive Properties Let s strt this section by remining ourselves tht the erivtive is the slope of function Wht is the slope of constnt function? c FACT 2 Let f () =c, where c is constnt Then f 0
More informationx dx does exist, what does the answer look like? What does the answer to
Review Guie or MAT Finl Em Prt II. Mony Decemer th 8:.m. 9:5.m. (or the 8:3.m. clss) :.m. :5.m. (or the :3.m. clss) Prt is worth 5% o your Finl Em gre. NO CALCULATORS re llowe on this portion o the Finl
More informationYear 11 Matrices. A row of seats goes across an auditorium So Rows are horizontal. The columns of the Parthenon stand upright and Columns are vertical
Yer 11 Mtrices Terminology: A single MATRIX (singulr) or Mny MATRICES (plurl) Chpter 3A Intro to Mtrices A mtrix is escribe s n orgnise rry of t. We escribe the ORDER of Mtrix (it's size) by noting how
More informationMinnesota State University, Mankato 44 th Annual High School Mathematics Contest April 12, 2017
Minnesot Stte University, Mnkto 44 th Annul High School Mthemtics Contest April, 07. A 5 ft. ldder is plced ginst verticl wll of uilding. The foot of the ldder rests on the floor nd is 7 ft. from the wll.
More informationInstantaneous Rate of Change of at a :
AP Clculus AB Formuls & Justiictions Averge Rte o Chnge o on [, ]:.r.c. = ( ) ( ) (lger slope o Deinition o the Derivtive: y ) (slope o secnt line) ( h) ( ) ( ) ( ) '( ) lim lim h0 h 0 3 ( ) ( ) '( ) lim
More informationHints for Exercise 1 on: Current and Resistance
Hints for Exercise 1 on: Current nd Resistnce Review the concepts of: electric current, conventionl current flow direction, current density, crrier drift velocity, crrier numer density, Ohm s lw, electric
More informationSupplementary Information
Supplementry Informtion Coopertion of locl motions in the Hsp90 moleculr chperone ATPse mechnism Andre Schulze 1, Gerti Beliu 1, Dominic A. Helmerich 1, Jonthn Schubert 1, Lurence H. Perl 2, Chrisostomos
More informationApplications of Bernoulli s theorem. Lecture - 7
Applictions of Bernoulli s theorem Lecture - 7 Prcticl Applictions of Bernoulli s Theorem The Bernoulli eqution cn be pplied to gret mny situtions not just the pipe flow we hve been considering up to now.
More informationSUPPLEMENTARY FIGURES
A m ultory distnce (cm ) % C enter distnce C e n te r tim e (s ) A m ultory distnce (cm ) % C enter distnce C e n te r tim e (s ) N o v e l c g e % h o m e c g e c o n s u m p tio n % M ic e fe e d in
More informationGenetic Programming. Outline. Evolutionary Strategies. Evolutionary strategies Genetic programming Summary
Outline Genetic Progrmming Evolutionry strtegies Genetic progrmming Summry Bsed on the mteril provided y Professor Michel Negnevitsky Evolutionry Strtegies An pproch simulting nturl evolution ws proposed
More informationPHYS Summer Professor Caillault Homework Solutions. Chapter 2
PHYS 1111 - Summer 2007 - Professor Cillult Homework Solutions Chpter 2 5. Picture the Problem: The runner moves long the ovl trck. Strtegy: The distnce is the totl length of trvel, nd the displcement
More informationBridging the gap: GCSE AS Level
Bridging the gp: GCSE AS Level CONTENTS Chpter Removing rckets pge Chpter Liner equtions Chpter Simultneous equtions 8 Chpter Fctors 0 Chpter Chnge the suject of the formul Chpter 6 Solving qudrtic equtions
More informationR(3, 8) P( 3, 0) Q( 2, 2) S(5, 3) Q(2, 32) P(0, 8) Higher Mathematics Objective Test Practice Book. 1 The diagram shows a sketch of part of
Higher Mthemtics Ojective Test Prctice ook The digrm shows sketch of prt of the grph of f ( ). The digrm shows sketch of the cuic f ( ). R(, 8) f ( ) f ( ) P(, ) Q(, ) S(, ) Wht re the domin nd rnge of
More informationSpace Curves. Recall the parametric equations of a curve in xy-plane and compare them with parametric equations of a curve in space.
Clculus 3 Li Vs Spce Curves Recll the prmetric equtions of curve in xy-plne nd compre them with prmetric equtions of curve in spce. Prmetric curve in plne x = x(t) y = y(t) Prmetric curve in spce x = x(t)
More informationDesigning Information Devices and Systems I Spring 2018 Homework 7
EECS 16A Designing Informtion Devices nd Systems I Spring 2018 omework 7 This homework is due Mrch 12, 2018, t 23:59. Self-grdes re due Mrch 15, 2018, t 23:59. Sumission Formt Your homework sumission should
More informationMinimum Energy State of Plasmas with an Internal Transport Barrier
Minimum Energy Stte of Plsms with n Internl Trnsport Brrier T. Tmno ), I. Ktnum ), Y. Skmoto ) ) Formerly, Plsm Reserch Center, University of Tsukub, Tsukub, Ibrki, Jpn ) Plsm Reserch Center, University
More informationAlignment of Long Sequences. BMI/CS Spring 2016 Anthony Gitter
Alignment of Long Sequences BMI/CS 776 www.biostt.wisc.edu/bmi776/ Spring 2016 Anthony Gitter gitter@biostt.wisc.edu Gols for Lecture Key concepts how lrge-scle lignment differs from the simple cse the
More informationThe Fundamental Theorem of Calculus Part 2, The Evaluation Part
AP Clculus AB 6.4 Funmentl Theorem of Clculus The Funmentl Theorem of Clculus hs two prts. These two prts tie together the concept of integrtion n ifferentition n is regre by some to by the most importnt
More informationA Brief Review on Akkar, Sandikkaya and Bommer (ASB13) GMPE
Southwestern U.S. Ground Motion Chrcteriztion Senior Seismic Hzrd Anlysis Committee Level 3 Workshop #2 October 22-24, 2013 A Brief Review on Akkr, Sndikky nd Bommer (ASB13 GMPE Sinn Akkr Deprtment of
More informationThe Influence of Interface and Semiconductor Bulk Traps Generated Under HEFS on MOSFET`s Electrical Characteristics
Proceedings of the 5th Smll Systems Simultion Symposium 2014, Niš, Seri, 12th-14th Ferury 2014 The Influence of Interfce nd Semiconductor Bulk Trps Generted Under HEFS on MOSFET`s Electricl Chrcteristics
More informationReview of Gaussian Quadrature method
Review of Gussin Qudrture method Nsser M. Asi Spring 006 compiled on Sundy Decemer 1, 017 t 09:1 PM 1 The prolem To find numericl vlue for the integrl of rel vlued function of rel vrile over specific rnge
More informationSupplementary material
10.1071/FP11237_AC CSIRO 2012 Accessory Puliction: Functionl Plnt Biology 2012, 39(5), 379 393. Supplementry mteril Tle S1. Effect of wter regime nd genotype on different growth prmeters: spike dry mtter
More informationObjectives. Materials
Techer Notes Activity 17 Fundmentl Theorem of Clculus Objectives Explore the connections between n ccumultion function, one defined by definite integrl, nd the integrnd Discover tht the derivtive of the
More informationSUPPLEMENTARY INFORMATION
doi:.38/nture896 c Resting stte Resting stte Resting stte Supplementry Figure Illustrtion of pttern clssifiction nd its effects on neuronl representtions. Dynmic ctivity ptterns evoked y different stimuli
More informationI1 = I2 I1 = I2 + I3 I1 + I2 = I3 + I4 I 3
2 The Prllel Circuit Electric Circuits: Figure 2- elow show ttery nd multiple resistors rrnged in prllel. Ech resistor receives portion of the current from the ttery sed on its resistnce. The split is
More informationAPPLICATIONS OF DEFINITE INTEGRALS
Chpter 6 APPICATIONS OF DEFINITE INTEGRAS OVERVIEW In Chpter 5 we discovered the connection etween Riemnn sums ssocited with prtition P of the finite closed intervl [, ] nd the process of integrtion. We
More informationSTRAND J: TRANSFORMATIONS, VECTORS and MATRICES
Mthemtics SKE: STRN J STRN J: TRNSFORMTIONS, VETORS nd MTRIES J3 Vectors Text ontents Section J3.1 Vectors nd Sclrs * J3. Vectors nd Geometry Mthemtics SKE: STRN J J3 Vectors J3.1 Vectors nd Sclrs Vectors
More informationReading from Young & Freedman: For this topic, read the introduction to chapter 24 and sections 24.1 to 24.5.
PHY1 Electricity Topic 5 (Lectures 7 & 8) pcitors nd Dielectrics In this topic, we will cover: 1) pcitors nd pcitnce ) omintions of pcitors Series nd Prllel 3) The energy stored in cpcitor 4) Dielectrics
More informationKeys to Success. 1. MC Calculator Usually only 5 out of 17 questions actually require calculators.
Keys to Success Aout the Test:. MC Clcultor Usully only 5 out of 7 questions ctully require clcultors.. Free-Response Tips. You get ooklets write ll work in the nswer ooklet (it is white on the insie)
More informationTrigonometric Functions
Exercise. Degrees nd Rdins Chpter Trigonometric Functions EXERCISE. Degrees nd Rdins 4. Since 45 corresponds to rdin mesure of π/4 rd, we hve: 90 = 45 corresponds to π/4 or π/ rd. 5 = 7 45 corresponds
More informationLecture 08: Feb. 08, 2019
4CS4-6:Theory of Computtion(Closure on Reg. Lngs., regex to NDFA, DFA to regex) Prof. K.R. Chowdhry Lecture 08: Fe. 08, 2019 : Professor of CS Disclimer: These notes hve not een sujected to the usul scrutiny
More informationFirst Semester Review Calculus BC
First Semester Review lculus. Wht is the coordinte of the point of inflection on the grph of Multiple hoice: No lcultor y 3 3 5 4? 5 0 0 3 5 0. The grph of piecewise-liner function f, for 4, is shown below.
More informationFundamental Theorem of Calculus
Funmentl Teorem of Clculus Liming Png 1 Sttement of te Teorem Te funmentl Teorem of Clculus is one of te most importnt teorems in te istory of mtemtics, wic ws first iscovere by Newton n Leibniz inepenently.
More informationVII. The Integral. 50. Area under a Graph. y = f(x)
VII. The Integrl In this chpter we efine the integrl of function on some intervl [, b]. The most common interprettion of the integrl is in terms of the re uner the grph of the given function, so tht is
More informationMotion of Electrons in Electric and Magnetic Fields & Measurement of the Charge to Mass Ratio of Electrons
n eperiment of the Electron topic Motion of Electrons in Electric nd Mgnetic Fields & Mesurement of the Chrge to Mss Rtio of Electrons Instructor: 梁生 Office: 7-318 Emil: shling@bjtu.edu.cn Purposes 1.
More informationA027 Uncertainties in Local Anisotropy Estimation from Multi-offset VSP Data
A07 Uncertinties in Locl Anisotropy Estimtion from Multi-offset VSP Dt M. Asghrzdeh* (Curtin University), A. Bon (Curtin University), R. Pevzner (Curtin University), M. Urosevic (Curtin University) & B.
More informationParticle Lifetime. Subatomic Physics: Particle Physics Lecture 3. Measuring Decays, Scatterings and Collisions. N(t) = N 0 exp( t/τ) = N 0 exp( Γt/)
Sutomic Physics: Prticle Physics Lecture 3 Mesuring Decys, Sctterings n Collisions Prticle lifetime n with Prticle ecy moes Prticle ecy kinemtics Scttering cross sections Collision centre of mss energy
More information5: The Definite Integral
5: The Definite Integrl 5.: Estimting with Finite Sums Consider moving oject its velocity (meters per second) t ny time (seconds) is given y v t = t+. Cn we use this informtion to determine the distnce
More informationFull file at
COMPREHENSION QUESTIONS Multiple Choice Use the following informtion for questions 1 3. iploi somtic cell from rt hs totl of 42 chromosomes (2n = 42). s in humns, sex chromosomes etermine sex: XX in femles
More information( x) ( ) takes at the right end of each interval to approximate its value on that
III. INTEGRATION Economists seem much more intereste in mrginl effects n ifferentition thn in integrtion. Integrtion is importnt for fining the expecte vlue n vrince of rnom vriles, which is use in econometrics
More informationf a L Most reasonable functions are continuous, as seen in the following theorem:
Limits Suppose f : R R. To sy lim f(x) = L x mens tht s x gets closer n closer to, then f(x) gets closer n closer to L. This suggests tht the grph of f looks like one of the following three pictures: f
More informationPhysics 2135 Exam 1 September 23, 2014
Exm Totl Physics 2135 Exm 1 September 23, 2014 Key Printe Nme: 200 / 200 N/A Rec. Sec. Letter: Five multiple choice questions, 8 points ech. Choose the best or most nerly correct nswer. B 1. Object A hs
More informationsupplementary information
DOI:.38/nc293 KNL-3 knl- KBP- ZWL- knl- NDC-8 KLP-9 knl- KNL-3 NDC-8 knl-3 ndc-8 KLP-9 u- klp-9 ZWL- zwl- Figure S Locliztion of kinetochore proteins nd of KLP-9 on meiosis I spindles. Immunostining of
More information1 ST ROUND, SOLUTIONS
ST ROUND, SOLUTIONS Problem (Lithuni) Self destructing pper ( points) Solution ( ) ( ) ( ) [Al HO OH ) ph pk lg [Al H O ( ) ( ) [Al H O OH [Al ( ).9 [Al H O.9.47 [Al ( ) ( ) ( ) [Al H O OH.9 pk ph lg.
More informationSample pages. 9:04 Equations with grouping symbols
Equtions 9 Contents I know the nswer is here somewhere! 9:01 Inverse opertions 9:0 Solving equtions Fun spot 9:0 Why did the tooth get dressed up? 9:0 Equtions with pronumerls on both sides GeoGebr ctivity
More informationMitosis vs meiosis: Lecture Outline 10/26/05. Independent Assortment
Lectue Outline 10/26/05 Consequences of meiosis Gmetes e geneticlly vile Inepenent ssotment Cossing ove Lots of pctice polems Eos in meiosis Why epouce sexully? Mitosis vs meiosis: Mitosis ensues exct
More informationHomework Assignment 6 Solution Set
Homework Assignment 6 Solution Set PHYCS 440 Mrch, 004 Prolem (Griffiths 4.6 One wy to find the energy is to find the E nd D fields everywhere nd then integrte the energy density for those fields. We know
More informationSimple Harmonic Motion I Sem
Simple Hrmonic Motion I Sem Sllus: Differentil eqution of liner SHM. Energ of prticle, potentil energ nd kinetic energ (derivtion), Composition of two rectngulr SHM s hving sme periods, Lissjous figures.
More information(See Notes on Spontaneous Emission)
ECE 240 for Cvity from ECE 240 (See Notes on ) Quntum Rdition in ECE 240 Lsers - Fll 2017 Lecture 11 1 Free Spce ECE 240 for Cvity from Quntum Rdition in The electromgnetic mode density in free spce is
More informationProblem Solving 7: Faraday s Law Solution
MASSACHUSETTS NSTTUTE OF TECHNOLOGY Deprtment of Physics: 8.02 Prolem Solving 7: Frdy s Lw Solution Ojectives 1. To explore prticulr sitution tht cn led to chnging mgnetic flux through the open surfce
More informationThe area under the graph of f and above the x-axis between a and b is denoted by. f(x) dx. π O
1 Section 5. The Definite Integrl Suppose tht function f is continuous nd positive over n intervl [, ]. y = f(x) x The re under the grph of f nd ove the x-xis etween nd is denoted y f(x) dx nd clled the
More informationMath 142: Final Exam Formulas to Know
Mth 4: Finl Exm Formuls to Know This ocument tells you every formul/strtegy tht you shoul know in orer to o well on your finl. Stuy it well! The helpful rules/formuls from the vrious review sheets my be
More information( ) Same as above but m = f x = f x - symmetric to y-axis. find where f ( x) Relative: Find where f ( x) x a + lim exists ( lim f exists.
AP Clculus Finl Review Sheet solutions When you see the words This is wht you think of doing Find the zeros Set function =, fctor or use qudrtic eqution if qudrtic, grph to find zeros on clcultor Find
More informationpolyimide Spray-coated ZrP/epoxy film Spray-coated ZrP/epoxy film glass
c d e polyimide Spry-coted ZrP/epoxy film glss Spry-coted ZrP/epoxy film f g Supplementry Figure 1. Opticl microscopy of smectic ( = 0.044) α-zrp/epoxy films., Trnsmission opticl microscopy (TOM) of smectic
More informationAMPERE CONGRESS AMPERE on Magnetic Resonance and Related Phenomena. Under the auspices of The GROUPEMENT AMPERE
AMPERE 2000 th 30 CONGRESS AMPERE on Mgnetic Resonnce nd Relted Phenomen Lison, Portugl, 23-2 July 2000 Under the uspices of The GROUPEMENT AMPERE Edited y: A.F. MARTINS, A.G. FEIO nd J.G. MOURA Sponsoring
More information